Citrus Sinensis ID: 003459

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQDVS
cccccccEEEEEEcccccEEEEEEccccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEccccccccEEEEEcccccEEEccccccccccccccccccEEEEEEccccccEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEHHHHHHHHccccEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccc
cccccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEccccccccccccEEccccccccEEEcccccEEEEccccccccccccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEcccccccEEEccccccccccccccccccEEEEcccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccHHcccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccc
MTTKRAYKLQEFVAHSSTvnclkigrkssrvlvtggedhkvnlwaigkpnailslsghtsgidsvsfdSSEVLVAAGAASGTIKLWDLEEAKIVRTLtghrsncisvdfhpfgeffasgsldtnlkiWDIRKKgcihtykghtrgvnairftpdgrwvvsggedntvklWDLTAgkllhdfkchegqiqcidfhphefllatgsadrtvkfwDLETFEligsagpetsgvrcltfnpdgrtLLCGLHEslkvfswepirchdavdvgwsrlsdlnvhegkllgcsynqscvgVWVVdisriepytigsvtrvnglseskssasgnlsvlnensakaslgklsvsqnsdplvketkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktSVVNSTAVVSKRtstrantasnvpilnksdivpvivprtntRFEQAVESRKDidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCEntgskatevssvadrntfAAIKGSIQgvsvternskediftvsgksgtmsmsespasyederydslghksnrdgyamesqkrgRMHSLVINwekrgsspnydgptssissgtvstvsmppfnafkqrgysssaeketasvsdedatADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISastsvgvdieAEQRIERCNRCFIELekvkcclptlmrggsvaKSAQELNLALQDVS
mttkrayklqefvahsstvnclkigrkSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAasgtiklwdLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIhtykghtrgvnairftpdgrwvvsggeDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELigsagpetsgvRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASlgklsvsqnsdpLVKEtkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktsvVNSTavvskrtstrantasnvpilnksdivpvivprtntrfeqavesrkdidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCENTGskatevssvadrntfaaikgsiqgvsvternskediftvsgksgtmsmsespasYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAisastsvgvdiEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQDVS
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPtssissgtvstvsMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCllplltgllESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQDVS
******YKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRV*****************************************************************************************************************************VPILNKSDIVPVIVPRTNTRFEQAV*****IDVIG***************************************************FAAI**********************************************************************************************************************************************LAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGG*****************
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQN**PLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPA***KVLSSTG************************************************************************************************************************************************************************************************************************************************************ATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVK****************QELNLALQD**
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNG**********NLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLS********************PGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQ***************VDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVS*****************ERYDSLGHKSNRDG*********RMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQ******************ATADVMEQ**********RLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQDVS
****RAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVP**************************************************************************************************************************************************************************************************TASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRGGSVAKSAQELNLALQDVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query818 2.2.26 [Sep-21-2011]
Q8H0T9837 Katanin p80 WD40 repeat-c yes no 0.992 0.970 0.666 0.0
O61585690 Katanin p80 WD40 repeat-c yes no 0.426 0.505 0.551 1e-116
Q4V7Y7655 Katanin p80 WD40 repeat-c N/A no 0.567 0.708 0.398 1e-103
Q6NVM2655 Katanin p80 WD40 repeat-c yes no 0.541 0.676 0.403 1e-103
Q5ZIU8657 Katanin p80 WD40 repeat-c yes no 0.367 0.458 0.524 1e-102
Q9BVA0655 Katanin p80 WD40 repeat-c yes no 0.537 0.671 0.404 1e-102
Q7ZUV2694 Katanin p80 WD40 repeat-c yes no 0.383 0.452 0.518 1e-101
Q8BG40658 Katanin p80 WD40 repeat-c yes no 0.364 0.452 0.526 1e-101
Q8YRI11526 Uncharacterized WD repeat yes no 0.290 0.155 0.363 1e-40
Q8YTC21258 Uncharacterized WD repeat no no 0.262 0.170 0.351 9e-36
>sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 Back     alignment and function desciption
 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/842 (66%), Positives = 653/842 (77%), Gaps = 30/842 (3%)

Query: 1   MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTS 60
           MTTKRAYKLQEFVAHS+ VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSL GH+S
Sbjct: 1   MTTKRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSS 60

Query: 61  GIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120
           GIDSV+FD+SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS
Sbjct: 61  GIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120

Query: 121 LDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHD 180
           LDTNLKIWDIRKKGCIHTYKGHTRGVN +RFTPDGRWVVSGGEDN VK+WDLTAGKLL +
Sbjct: 121 LDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTE 180

Query: 181 FKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGR 240
           FK HEGQIQ +DFHPHEFLLATGSADRTVKFWDLETFELIGS GPET+GVRCL+FNPDG+
Sbjct: 181 FKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGK 240

Query: 241 TLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISR 300
           T+LCGL ESLK+FSWEPIRCHD VDVGWSRLSD+NVHEGKLLGCSYNQSCVGVWVVD+SR
Sbjct: 241 TVLCGLQESLKIFSWEPIRCHDGVDVGWSRLSDMNVHEGKLLGCSYNQSCVGVWVVDLSR 300

Query: 301 IEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRL 360
            EP   G   + NG  E +S +  +  VLN+N++K  LGKLSVSQN DPL+KETKSLGRL
Sbjct: 301 TEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRL 360

Query: 361 SVSQNSDP-------------------LLKETKTLGRLSVSQNSEPAKESKVLSSTGSVP 401
           SVSQNSDP                    +KE+K LGRLSVSQNS+ +KES+  SSTGS+P
Sbjct: 361 SVSQNSDPSTKETKSIGRSSTSQNSESSMKESKPLGRLSVSQNSDVSKESRTFSSTGSLP 420

Query: 402 GTPQRV-NLNMGSKTSVVN---STAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTR 457
           GTP RV + N+   TS V+   S A  S+R  T+AN  +N P+   +D  PVIVPR + R
Sbjct: 421 GTPHRVSSTNVSKATSGVSTAVSNAATSRRNFTKANPKAN-PVNKAADFAPVIVPRADPR 479

Query: 458 FEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSS 517
            EQA ESR ++D+I RTMP+SLQ  A DSR+  +S +  D P  SVL E + S+  E ++
Sbjct: 480 IEQATESRAELDIIARTMPYSLQ--AADSRRSPSSRNNPDLPDASVL-EMSESQPVEPNN 536

Query: 518 VADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSN 577
           + D  T    K  ++G   TER+  +  +   G+S + S   SP    DE YD + H+SN
Sbjct: 537 IPDGGTLPGGKVGMRG--ATERSINDFRYKRYGRSNSRSRMGSPPRNHDENYDLVSHRSN 594

Query: 578 RDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSS 637
           RD    ESQK GR  SLVIN E+RG   N++GP S+ SSG +   ++ P N FKQRG   
Sbjct: 595 RDPSPTESQKGGRFQSLVINRERRGRFSNFEGPVSNFSSGNMPAPNIRPSNMFKQRGNHM 654

Query: 638 SAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMAD 697
             E+   S S+E+   D+M +H+QFVSSMQSRLAKLQ V RYWERNDVK +I +++KMAD
Sbjct: 655 PVEQGIDSPSEENIVEDIMGKHNQFVSSMQSRLAKLQVVRRYWERNDVKNSIGSIEKMAD 714

Query: 698 HTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMI 757
           + V ADV+ I+ E+ EI+TLD C+ LLPLLT LL S MD+HLS+SLD+LLKLVR +GS I
Sbjct: 715 NAVTADVLGIITERNEILTLDNCTSLLPLLTALLGSGMDQHLSVSLDLLLKLVRLYGSPI 774

Query: 758 YSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLM-RGGSVAKSAQELNLALQD 816
           YS++SA  SVGVDIEAEQRIER +RCF+ELEKVK CLP+L  RGG VAKS  ELNLA Q+
Sbjct: 775 YSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLARRGGLVAKSVLELNLAFQE 834

Query: 817 VS 818
           VS
Sbjct: 835 VS 836
May participate in a complex which severs microtubules in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.
Arabidopsis thaliana (taxid: 3702)
>sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query818
255545317803 katanin P80 subunit, putative [Ricinus c 0.963 0.981 0.752 0.0
224100461802 predicted protein [Populus trichocarpa] 0.974 0.993 0.753 0.0
359484098800 PREDICTED: katanin p80 WD40 repeat-conta 0.975 0.997 0.749 0.0
449458795795 PREDICTED: katanin p80 WD40 repeat-conta 0.960 0.988 0.710 0.0
356573375758 PREDICTED: katanin p80 WD40 repeat-conta 0.919 0.992 0.692 0.0
30688991836 Katanin p80 WD40 repeat-containing subun 0.992 0.971 0.667 0.0
30688988837 Katanin p80 WD40 repeat-containing subun 0.992 0.970 0.666 0.0
224113211728 predicted protein [Populus trichocarpa] 0.865 0.972 0.675 0.0
297812493837 transducin family protein [Arabidopsis l 0.992 0.970 0.668 0.0
145357786839 katanin p80 subunit-like protein [Arabid 0.995 0.970 0.640 0.0
>gi|255545317|ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus communis] gi|223547170|gb|EEF48666.1| katanin P80 subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1243 bits (3215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/816 (75%), Positives = 686/816 (84%), Gaps = 28/816 (3%)

Query: 10  QEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS 69
           +EFVAHSS+VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS
Sbjct: 5   KEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS 64

Query: 70  SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD 129
           SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD
Sbjct: 65  SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD 124

Query: 130 IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQ 189
           IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFK HEGQ+Q
Sbjct: 125 IRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQVQ 184

Query: 190 CIDFHPHEFLLATG-SADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE 248
           CIDFHPHEFLLATG SADRTVKFWDLETFELIGSAGPET+GVRCLTFNPDGRTLLCGLHE
Sbjct: 185 CIDFHPHEFLLATGDSADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGRTLLCGLHE 244

Query: 249 SLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGS 308
           +LKVFSWEP+RCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPY+  +
Sbjct: 245 NLKVFSWEPLRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYSPSN 304

Query: 309 VTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDP 368
           V R+NG SESKS  S N SVL +++AK SLG                   RLS +QNS+ 
Sbjct: 305 VNRLNGYSESKSGISANQSVLLDSTAKTSLG-------------------RLSAAQNSEI 345

Query: 369 LLKETKTLGRLSVSQNSEPAKES----KVLSSTGSVPGTPQRVNLNMGSKTSV---VNST 421
           L+KETK+ GRLSVSQN++P KES    K+L+STG+VPGTPQRVN N   KT++   +   
Sbjct: 346 LVKETKSFGRLSVSQNTDPVKESTKESKILASTGNVPGTPQRVNFNTALKTTLSGPITVN 405

Query: 422 AVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQS 481
               KRTST+  +A NVP+LNK+D++PVIVPRTNTR +   E RK+I + GRTMPFSLQS
Sbjct: 406 VAAPKRTSTKVQSAVNVPVLNKADVIPVIVPRTNTRPDPVAEPRKEIGIAGRTMPFSLQS 465

Query: 482 KATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNS 541
           KA D RKF NS D++DQP +S+  + T SK+  +S+V DRN F+ +KGSI+ +S  +RN 
Sbjct: 466 KACDYRKFTNSRDDMDQPTISIPSDTTSSKSMALSNVGDRNIFSTVKGSIREISTADRNI 525

Query: 542 KEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKR 601
           KED    SGK  +  ++E P SY++E Y++ GHK NRD  ++E QK GRM SLVINWEKR
Sbjct: 526 KEDRPVGSGKQDSSLIAEPPVSYQEENYETRGHKLNRDATSLEGQKAGRMRSLVINWEKR 585

Query: 602 GSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQ 661
           G SPNY+GP S  S  T S+V+M  FN  KQRG S + EKE  S SDEDA ADVMEQH Q
Sbjct: 586 GRSPNYEGPISGSSPETASSVNMLSFNMLKQRGCSPTTEKEMVSASDEDAIADVMEQHDQ 645

Query: 662 FVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICS 721
           FVSSMQSR  KLQAV+R+WERNDVKGAISAM+KMADH VLADV+S++ EKI+IVTLD+C+
Sbjct: 646 FVSSMQSRFGKLQAVHRFWERNDVKGAISAMEKMADHGVLADVISVINEKIDIVTLDVCT 705

Query: 722 CLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCN 781
           CLLPLL GLLESDMDRHLSISLD+LLKLVRTFGSMIYS +SAST VGVDIEAEQR+ERCN
Sbjct: 706 CLLPLLAGLLESDMDRHLSISLDVLLKLVRTFGSMIYSTVSASTPVGVDIEAEQRLERCN 765

Query: 782 RCFIELEKVKCCLPTLM-RGGSVAKSAQELNLALQD 816
            CF+ELEKVK CLPTLM RGGSVAK  QELNLALQD
Sbjct: 766 LCFVELEKVKRCLPTLMRRGGSVAKITQELNLALQD 801

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224100461|ref|XP_002311885.1| predicted protein [Populus trichocarpa] gi|222851705|gb|EEE89252.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484098|ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458795|ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] gi|449524677|ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|356573375|ref|XP_003554837.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|30688991|ref|NP_197734.2| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|332005784|gb|AED93167.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30688988|ref|NP_851064.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|73620972|sp|Q8H0T9.3|KTNB1_ARATH RecName: Full=Katanin p80 WD40 repeat-containing subunit B1 homolog gi|25083345|gb|AAN72064.1| putative protein [Arabidopsis thaliana] gi|332005783|gb|AED93166.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224113211|ref|XP_002316424.1| predicted protein [Populus trichocarpa] gi|222865464|gb|EEF02595.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297812493|ref|XP_002874130.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297319967|gb|EFH50389.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145357786|ref|NP_568194.2| katanin p80 subunit-like protein [Arabidopsis thaliana] gi|332003911|gb|AED91294.1| katanin p80 subunit-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query818
TAIR|locus:2154438837 AT5G23430 "AT5G23430" [Arabido 0.718 0.702 0.623 3.2e-184
TAIR|locus:2150788839 AT5G08390 "AT5G08390" [Arabido 0.590 0.575 0.680 5.9e-176
TAIR|locus:2202129 1021 AT1G11160 "AT1G11160" [Arabido 0.508 0.407 0.562 2.1e-167
UNIPROTKB|Q5ZIU8657 KATNB1 "Katanin p80 WD40 repea 0.482 0.601 0.450 2.3e-112
MGI|MGI:1921437658 Katnb1 "katanin p80 (WD40-cont 0.589 0.732 0.403 7.9e-112
RGD|1311256655 Katnb1 "katanin p80 (WD repeat 0.479 0.598 0.448 1e-111
ZFIN|ZDB-GENE-040426-1954694 katnb1 "katanin p80 (WD repeat 0.667 0.786 0.376 4.3e-111
UNIPROTKB|E2QTQ5655 KATNB1 "Uncharacterized protei 0.477 0.596 0.452 1.1e-110
UNIPROTKB|F1P0F4661 KATNB1 "Katanin p80 WD40 repea 0.482 0.597 0.444 1.5e-108
UNIPROTKB|E3W9A3661 KATNB1 "Katanin p80 WD40 repea 0.482 0.597 0.440 2.4e-108
TAIR|locus:2154438 AT5G23430 "AT5G23430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1787 (634.1 bits), Expect = 3.2e-184, P = 3.2e-184
 Identities = 384/616 (62%), Positives = 437/616 (70%)

Query:     1 MTTKRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTS 60
             MTTKRAYKLQEFVAHS+ VNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSL GH+S
Sbjct:     1 MTTKRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSS 60

Query:    61 GIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120
             GIDSV+FD+SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS
Sbjct:    61 GIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGS 120

Query:   121 LDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHD 180
             LDTNLKIWDIRKKGCIHTYKGHTRGVN +RFTPDGRWVVSGGEDN VK+WDLTAGKLL +
Sbjct:   121 LDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTE 180

Query:   181 FKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGR 240
             FK HEGQIQ +DFHPHEFLLATGSADRTVKFWDLETFELIGS GPET+GVRCL+FNPDG+
Sbjct:   181 FKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGK 240

Query:   241 TLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISR 300
             T+LCGL ESLK+FSWEPIRCHD VDVGWSRLSD+NVHEGKLLGCSYNQSCVGVWVVD+SR
Sbjct:   241 TVLCGLQESLKIFSWEPIRCHDGVDVGWSRLSDMNVHEGKLLGCSYNQSCVGVWVVDLSR 300

Query:   301 IEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRL 360
              EP   G   + NG  E +S +  +  VLN+N++K  LGKLSVSQN DPL+KETKSLGRL
Sbjct:   301 TEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRL 360

Query:   361 SVSQNSDPLLKETKTLGRLSVSQNSEPA-KESKVLS----STGSVPGTPQRVNLNMGSKT 415
             SVSQNSDP  KETK++GR S SQNSE + KESK L     S  S      R   + GS  
Sbjct:   361 SVSQNSDPSTKETKSIGRSSTSQNSESSMKESKPLGRLSVSQNSDVSKESRTFSSTGSLP 420

Query:   416 SVVN--STAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGR 473
                +  S+  VSK TS  +   SN     ++       P+ N    +A +    I  + R
Sbjct:   421 GTPHRVSSTNVSKATSGVSTAVSNAATSRRN--FTKANPKANP-VNKAADFAPVI--VPR 475

Query:   474 TMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQG 533
               P   Q  AT+SR       E+D   ++     +   A    S + RN       S+  
Sbjct:   476 ADPRIEQ--ATESRA------ELD--IIARTMPYSLQAADSRRSPSSRNNPDLPDASVLE 525

Query:   534 VSVT---ERNSKEDIFTV-SGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRG 589
             +S +   E N+  D  T+  GK G    +E   S  D RY   G  ++R       +   
Sbjct:   526 MSESQPVEPNNIPDGGTLPGGKVGMRGATER--SINDFRYKRYGRSNSRSRMGSPPRNHD 583

Query:   590 RMHSLVINWEKRGSSP 605
               + LV +   R  SP
Sbjct:   584 ENYDLVSHRSNRDPSP 599
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2150788 AT5G08390 "AT5G08390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202129 AT1G11160 "AT1G11160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIU8 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1921437 Katnb1 "katanin p80 (WD40-containing) subunit B 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311256 Katnb1 "katanin p80 (WD repeat containing) subunit B 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1954 katnb1 "katanin p80 (WD repeat containing) subunit B 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTQ5 KATNB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0F4 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E3W9A3 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H0T9KTNB1_ARATHNo assigned EC number0.66620.99260.9701yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query818
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-64
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-61
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-58
pfam13925164 pfam13925, Katanin_con80, con80 domain of Katanin 1e-55
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-32
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-32
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-29
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-27
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-12
smart0032040 smart00320, WD40, WD40 repeats 1e-10
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-10
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 3e-09
smart0032040 smart00320, WD40, WD40 repeats 6e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 7e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-08
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 1e-07
smart0032040 smart00320, WD40, WD40 repeats 2e-07
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 9e-07
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 1e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 1e-04
pfam08662194 pfam08662, eIF2A, Eukaryotic translation initiatio 1e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 4e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score =  216 bits (551), Expect = 4e-64
 Identities = 87/254 (34%), Positives = 136/254 (53%), Gaps = 2/254 (0%)

Query: 9   LQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFD 68
            +    H+  V C+       ++L TG  D  + +W +     + +L GHT  +  V+  
Sbjct: 2   RRTLKGHTGGVTCVAFSP-DGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAAS 60

Query: 69  SSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIW 128
           +    +A+G++  TI+LWDLE  + VRTLTGH S   SV F P G   +S S D  +K+W
Sbjct: 61  ADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVW 120

Query: 129 DIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQI 188
           D+    C+ T +GHT  VN++ F+PDG +V S  +D T+KLWDL  GK +     H G++
Sbjct: 121 DVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEV 180

Query: 189 QCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE 248
             + F P    L + S+D T+K WDL T + +G+     +GV  + F+PDG  L  G  +
Sbjct: 181 NSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSED 240

Query: 249 -SLKVFSWEPIRCH 261
            +++V+      C 
Sbjct: 241 GTIRVWDLRTGECV 254

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|222456 pfam13925, Katanin_con80, con80 domain of Katanin Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|149648 pfam08662, eIF2A, Eukaryotic translation initiation factor eIF2A Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 818
KOG0267825 consensus Microtubule severing protein katanin p80 100.0
PF13925164 Katanin_con80: con80 domain of Katanin 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.98
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0296399 consensus Angio-associated migratory cell protein 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0645312 consensus WD40 repeat protein [General function pr 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
PTZ00421493 coronin; Provisional 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.95
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.94
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.94
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0267825 consensus Microtubule severing protein katanin p80 99.94
PTZ00420568 coronin; Provisional 99.94
PTZ00420568 coronin; Provisional 99.93
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.93
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.93
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.93
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.93
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.93
KOG0772641 consensus Uncharacterized conserved protein, conta 99.93
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.93
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.93
KOG0301745 consensus Phospholipase A2-activating protein (con 99.93
KOG0641350 consensus WD40 repeat protein [General function pr 99.93
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.92
KOG0289506 consensus mRNA splicing factor [General function p 99.92
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.92
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG0639705 consensus Transducin-like enhancer of split protei 99.91
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.91
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.91
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.91
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.91
KOG0301745 consensus Phospholipase A2-activating protein (con 99.9
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.9
KOG2055514 consensus WD40 repeat protein [General function pr 99.9
KOG0641350 consensus WD40 repeat protein [General function pr 99.9
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.89
KOG1539910 consensus WD repeat protein [General function pred 99.89
KOG1274 933 consensus WD40 repeat protein [General function pr 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.88
KOG0300481 consensus WD40 repeat-containing protein [Function 99.88
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.88
KOG2096420 consensus WD40 repeat protein [General function pr 99.88
KOG0646476 consensus WD40 repeat protein [General function pr 99.88
KOG1273405 consensus WD40 repeat protein [General function pr 99.88
KOG4283397 consensus Transcription-coupled repair protein CSA 99.88
KOG2048691 consensus WD40 repeat protein [General function pr 99.88
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.88
KOG0772641 consensus Uncharacterized conserved protein, conta 99.87
KOG0269839 consensus WD40 repeat-containing protein [Function 99.87
KOG0646476 consensus WD40 repeat protein [General function pr 99.86
KOG0302440 consensus Ribosome Assembly protein [General funct 99.86
KOG0639705 consensus Transducin-like enhancer of split protei 99.86
KOG0269839 consensus WD40 repeat-containing protein [Function 99.86
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG2106626 consensus Uncharacterized conserved protein, conta 99.85
KOG4328498 consensus WD40 protein [Function unknown] 99.85
KOG1274 933 consensus WD40 repeat protein [General function pr 99.85
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.84
KOG2106626 consensus Uncharacterized conserved protein, conta 99.84
KOG1539910 consensus WD repeat protein [General function pred 99.84
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.83
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.83
KOG4283397 consensus Transcription-coupled repair protein CSA 99.83
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.83
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.83
COG2319466 FOG: WD40 repeat [General function prediction only 99.83
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.83
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.82
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.82
KOG0270463 consensus WD40 repeat-containing protein [Function 99.82
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.82
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.81
KOG2048691 consensus WD40 repeat protein [General function pr 99.8
KOG2055514 consensus WD40 repeat protein [General function pr 99.8
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.8
KOG1273405 consensus WD40 repeat protein [General function pr 99.8
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.79
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.79
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.79
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.79
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.77
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.77
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.77
KOG0270463 consensus WD40 repeat-containing protein [Function 99.77
KOG2096420 consensus WD40 repeat protein [General function pr 99.77
KOG4328498 consensus WD40 protein [Function unknown] 99.76
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.76
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.75
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.74
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG0303472 consensus Actin-binding protein Coronin, contains 99.73
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.73
KOG1188376 consensus WD40 repeat protein [General function pr 99.73
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.72
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.72
KOG4227609 consensus WD40 repeat protein [General function pr 99.72
KOG2110391 consensus Uncharacterized conserved protein, conta 99.71
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.71
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.71
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.69
KOG06441113 consensus Uncharacterized conserved protein, conta 99.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.69
KOG0649325 consensus WD40 repeat protein [General function pr 99.69
KOG0649325 consensus WD40 repeat protein [General function pr 99.68
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.68
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.68
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.68
KOG0303472 consensus Actin-binding protein Coronin, contains 99.67
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.67
PRK11028330 6-phosphogluconolactonase; Provisional 99.67
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.65
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.65
KOG1963792 consensus WD40 repeat protein [General function pr 99.65
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.62
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.62
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.61
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.61
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.61
PRK01742429 tolB translocation protein TolB; Provisional 99.61
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.61
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.61
KOG1188376 consensus WD40 repeat protein [General function pr 99.6
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.59
PRK01742429 tolB translocation protein TolB; Provisional 99.59
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.59
KOG2139445 consensus WD40 repeat protein [General function pr 99.57
KOG0771398 consensus Prolactin regulatory element-binding pro 99.55
KOG0771398 consensus Prolactin regulatory element-binding pro 99.55
KOG1963792 consensus WD40 repeat protein [General function pr 99.55
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.55
KOG2110391 consensus Uncharacterized conserved protein, conta 99.54
KOG1310758 consensus WD40 repeat protein [General function pr 99.54
KOG4227609 consensus WD40 repeat protein [General function pr 99.54
KOG1334559 consensus WD40 repeat protein [General function pr 99.54
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.53
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
KOG1310758 consensus WD40 repeat protein [General function pr 99.53
PRK05137435 tolB translocation protein TolB; Provisional 99.52
PRK03629429 tolB translocation protein TolB; Provisional 99.51
KOG2111346 consensus Uncharacterized conserved protein, conta 99.51
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.5
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.5
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.49
KOG2321703 consensus WD40 repeat protein [General function pr 99.49
PRK04922433 tolB translocation protein TolB; Provisional 99.48
PRK03629429 tolB translocation protein TolB; Provisional 99.48
KOG1334559 consensus WD40 repeat protein [General function pr 99.46
PRK04922433 tolB translocation protein TolB; Provisional 99.46
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.46
KOG2111346 consensus Uncharacterized conserved protein, conta 99.46
PRK02889427 tolB translocation protein TolB; Provisional 99.45
PRK02889427 tolB translocation protein TolB; Provisional 99.45
PRK05137435 tolB translocation protein TolB; Provisional 99.44
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.41
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.41
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.41
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.4
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.4
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.4
KOG2139445 consensus WD40 repeat protein [General function pr 99.38
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.38
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.38
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.34
PRK00178430 tolB translocation protein TolB; Provisional 99.33
PRK00178430 tolB translocation protein TolB; Provisional 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.3
KOG4547541 consensus WD40 repeat-containing protein [General 99.29
PRK01029428 tolB translocation protein TolB; Provisional 99.28
PRK04792448 tolB translocation protein TolB; Provisional 99.27
KOG2315566 consensus Predicted translation initiation factor 99.25
PRK01029428 tolB translocation protein TolB; Provisional 99.25
PRK04792448 tolB translocation protein TolB; Provisional 99.25
KOG4547541 consensus WD40 repeat-containing protein [General 99.25
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.23
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.2
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.2
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.18
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.17
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.17
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.16
KOG2315566 consensus Predicted translation initiation factor 99.15
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.14
KOG2321703 consensus WD40 repeat protein [General function pr 99.13
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.13
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.12
KOG1409404 consensus Uncharacterized conserved protein, conta 99.11
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.1
KOG2314698 consensus Translation initiation factor 3, subunit 99.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.07
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.07
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.06
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.01
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.99
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.99
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.98
PRK04043419 tolB translocation protein TolB; Provisional 98.97
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.97
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.96
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.95
COG4946668 Uncharacterized protein related to the periplasmic 98.94
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.92
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.92
PRK04043419 tolB translocation protein TolB; Provisional 98.9
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.9
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.89
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.89
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.88
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.88
COG4946668 Uncharacterized protein related to the periplasmic 98.88
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.87
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.86
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.84
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.83
KOG1409404 consensus Uncharacterized conserved protein, conta 98.81
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.81
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.8
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.79
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.74
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.72
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.71
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.67
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.67
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.63
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.61
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.58
KOG2695425 consensus WD40 repeat protein [General function pr 98.57
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.57
KOG2695425 consensus WD40 repeat protein [General function pr 98.56
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.56
KOG2314698 consensus Translation initiation factor 3, subunit 98.53
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.49
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.49
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.48
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.46
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.41
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.39
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.38
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.36
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.36
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.3
PRK02888635 nitrous-oxide reductase; Validated 98.29
PRK02888635 nitrous-oxide reductase; Validated 98.26
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.26
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.24
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.23
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.17
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.16
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.1
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.08
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.08
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.07
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.06
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.05
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.04
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.0
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.99
COG3391381 Uncharacterized conserved protein [Function unknow 97.97
KOG1008783 consensus Uncharacterized conserved protein, conta 97.95
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.95
COG3391381 Uncharacterized conserved protein [Function unknow 97.95
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.94
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.87
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.83
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.82
KOG3621726 consensus WD40 repeat-containing protein [General 97.82
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.8
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.77
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.75
KOG3621726 consensus WD40 repeat-containing protein [General 97.75
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.73
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.73
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.7
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.64
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.61
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.61
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.57
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.55
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.48
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.48
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.48
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.4
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.39
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.38
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.33
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.29
KOG1008783 consensus Uncharacterized conserved protein, conta 97.26
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.23
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.1
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.04
KOG2395644 consensus Protein involved in vacuole import and d 97.04
PRK13616591 lipoprotein LpqB; Provisional 96.98
PHA02713557 hypothetical protein; Provisional 96.97
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.95
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.94
PRK13616591 lipoprotein LpqB; Provisional 96.94
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.93
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.86
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.85
KOG2395644 consensus Protein involved in vacuole import and d 96.83
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.8
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.8
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.8
PHA02713557 hypothetical protein; Provisional 96.77
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.76
PRK10115686 protease 2; Provisional 96.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.7
KOG18971096 consensus Damage-specific DNA binding complex, sub 96.67
KOG2444238 consensus WD40 repeat protein [General function pr 96.66
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.64
PRK10115686 protease 2; Provisional 96.64
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.63
PRK13684334 Ycf48-like protein; Provisional 96.6
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.58
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.56
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.37
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.35
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.31
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.24
PHA03098534 kelch-like protein; Provisional 96.22
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.97
PRK13684334 Ycf48-like protein; Provisional 95.74
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.73
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.68
PHA03098534 kelch-like protein; Provisional 95.62
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.58
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.56
PHA02790480 Kelch-like protein; Provisional 95.52
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.38
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 95.3
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.17
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.09
COG1520370 FOG: WD40-like repeat [Function unknown] 95.08
PHA02790480 Kelch-like protein; Provisional 94.93
COG1520370 FOG: WD40-like repeat [Function unknown] 94.9
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.85
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 94.84
PF15390671 DUF4613: Domain of unknown function (DUF4613) 94.76
KOG2444238 consensus WD40 repeat protein [General function pr 94.74
PF14727418 PHTB1_N: PTHB1 N-terminus 94.43
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.4
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 94.11
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 94.01
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.01
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.86
PLN00033398 photosystem II stability/assembly factor; Provisio 93.58
PLN00033398 photosystem II stability/assembly factor; Provisio 93.49
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.44
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.42
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 93.32
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.24
COG5276370 Uncharacterized conserved protein [Function unknow 92.99
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 92.7
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.69
KOG18971096 consensus Damage-specific DNA binding complex, sub 92.57
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.49
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.43
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 92.4
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 92.39
COG5167776 VID27 Protein involved in vacuole import and degra 92.27
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 92.16
PLN02193470 nitrile-specifier protein 91.27
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.25
COG5167776 VID27 Protein involved in vacuole import and degra 91.08
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 91.07
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 90.82
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 90.76
COG4590733 ABC-type uncharacterized transport system, permeas 90.18
PLN02153341 epithiospecifier protein 90.18
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.14
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.07
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 89.95
PLN02153341 epithiospecifier protein 89.86
COG3292671 Predicted periplasmic ligand-binding sensor domain 89.83
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 89.34
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 89.2
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 89.16
COG5276370 Uncharacterized conserved protein [Function unknow 89.04
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 88.87
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.61
PF13449326 Phytase-like: Esterase-like activity of phytase 88.6
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 88.3
PF13449326 Phytase-like: Esterase-like activity of phytase 88.11
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.9
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 87.87
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 87.79
PF08801422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 87.65
KOG2247615 consensus WD40 repeat-containing protein [General 87.61
PLN02193470 nitrile-specifier protein 87.29
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 86.75
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 86.72
PF14727418 PHTB1_N: PTHB1 N-terminus 86.53
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 86.46
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.4
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 86.04
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 85.81
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 85.53
KOG2247615 consensus WD40 repeat-containing protein [General 85.47
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 85.08
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.9
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 84.83
PRK05560805 DNA gyrase subunit A; Validated 84.39
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 84.32
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 84.31
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 84.04
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 83.03
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 82.31
KOG2377657 consensus Uncharacterized conserved protein [Funct 82.01
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 81.34
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 81.26
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 80.82
PF12768281 Rax2: Cortical protein marker for cell polarity 80.66
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 80.53
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=6.8e-89  Score=751.68  Aligned_cols=774  Identities=47%  Similarity=0.667  Sum_probs=588.6

Q ss_pred             CCcccceeE-----EEEecCCCCEEEEEEeeCCCcEEEEEeCCCeEEEEECCCCceEEEecCCCCCeEEEEEcCCCCEEE
Q 003459            1 MTTKRAYKL-----QEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVA   75 (818)
Q Consensus         1 m~t~r~~kl-----~~~~~H~~~V~~lafsp~~~~lLatgs~Dg~V~lWdl~~~~~i~~l~~h~~~V~~l~fspdg~~La   75 (818)
                      |.+++.+++     +++.+|...|.|+.. ....+.+++|+.|..+.+|.+.+...+..+.+|..+|.++.|++++.+|+
T Consensus         8 m~~~~~t~Lr~~~~~~~~~hsaav~~lk~-~~s~r~~~~Gg~~~k~~L~~i~kp~~i~S~~~hespIeSl~f~~~E~Lla   86 (825)
T KOG0267|consen    8 MKTKRATKLRVWDTREFVAHSAAVGCLKI-RKSSRSLVTGGEDEKVNLWAIGKPNAITSLTGHESPIESLTFDTSERLLA   86 (825)
T ss_pred             ceeeeeeccccccchhhhhhhhhhceeee-eccceeeccCCCceeeccccccCCchhheeeccCCcceeeecCcchhhhc
Confidence            678888888     699999999999998 45889999999999999999999999999999999999999999999999


Q ss_pred             EEECCCeEEEEECCCCeEEEEEcCCCCCeEEEEEeCCCCEEEEEECCCcEEEEECCCCeEEEEEecCCCCeEEEEEcCCC
Q 003459           76 AGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDG  155 (818)
Q Consensus        76 sgs~DG~I~IWDl~t~~~v~~l~~h~~~V~sv~fspdg~~Lasgs~Dg~I~IwDl~~~~~i~~l~~h~~~V~~l~fspdg  155 (818)
                      +|+.+|+|++||++.++.++++.+|...+.++.|+|.+.|++.|+.|+.+++||++...|.+.+++|...+.++.|+|+|
T Consensus        87 agsasgtiK~wDleeAk~vrtLtgh~~~~~sv~f~P~~~~~a~gStdtd~~iwD~Rk~Gc~~~~~s~~~vv~~l~lsP~G  166 (825)
T KOG0267|consen   87 AGSASGTIKVWDLEEAKIVRTLTGHLLNITSVDFHPYGEFFASGSTDTDLKIWDIRKKGCSHTYKSHTRVVDVLRLSPDG  166 (825)
T ss_pred             ccccCCceeeeehhhhhhhhhhhccccCcceeeeccceEEeccccccccceehhhhccCceeeecCCcceeEEEeecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEECCCeEEEEECCCCeEEEEEecCCCCEEEEEEeCCCCEEEEEeCCCeEEEEECCCCeEEEEeCCCCCCeeEEEE
Q 003459          156 RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235 (818)
Q Consensus       156 ~~L~sgs~Dg~I~IwDl~t~~~i~~~~~h~~~I~sv~fspdg~~Lasgs~Dg~I~IwDl~t~~~i~~~~~~~~~I~sl~f  235 (818)
                      +|++.|++|..++|||+..|+.+.+|+.|++.+..+.|+|...+++.|+.|++|++||+++++.+....+...+|.++.|
T Consensus       167 r~v~~g~ed~tvki~d~~agk~~~ef~~~e~~v~sle~hp~e~Lla~Gs~d~tv~f~dletfe~I~s~~~~~~~v~~~~f  246 (825)
T KOG0267|consen  167 RWVASGGEDNTVKIWDLTAGKLSKEFKSHEGKVQSLEFHPLEVLLAPGSSDRTVRFWDLETFEVISSGKPETDGVRSLAF  246 (825)
T ss_pred             ceeeccCCcceeeeecccccccccccccccccccccccCchhhhhccCCCCceeeeeccceeEEeeccCCccCCceeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCEEEEEECCCEE------------EEEecCCceeccccccccceeeeeecCCCEE--EEEEcCCeEEEEEecCCCc
Q 003459          236 NPDGRTLLCGLHESLK------------VFSWEPIRCHDAVDVGWSRLSDLNVHEGKLL--GCSYNQSCVGVWVVDISRI  301 (818)
Q Consensus       236 spdg~~Lasgs~d~I~------------Vwd~~~~~~~~~~~~~~~~v~~l~~~~g~lL--atg~~Dg~V~IWdvd~~~~  301 (818)
                      +|+|+.+++|....+.            ++.|++..+..++...+.....+......+.  +.+..+..-++.+...   
T Consensus       247 n~~~~~~~~G~q~sl~~~~~a~ah~~~~~~~~Ep~~~~~~vqs~~~~ek~v~v~~d~~~ln~~~s~~~~~kl~~~~~---  323 (825)
T KOG0267|consen  247 NPDGKIVLSGEQISLSESRTASAHVRKTLARWEPEMDGAVVQSNSHKEKVVAVGRDPQDLNAFSSKVNLSKLEDSTY---  323 (825)
T ss_pred             cCCceeeecCchhhhhhhhcccceeeccccccccccccceeeecCCcccccccccCccccccccccccccccccccc---
Confidence            9999999999777655            3444444443333333332222221111000  0000000000000000   


Q ss_pred             eeeeecccceeccccccccCCCCCcccccccccccccCCCccc-CCCccccccccccCcccccCCCCccccccccccccc
Q 003459          302 EPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVS-QNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLS  380 (818)
Q Consensus       302 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  380 (818)
                                              .++   ...-..++++.++ +..++..+.++.-++-+.+++++....+.+..+...
T Consensus       324 ------------------------~p~---l~~t~~l~rl~~S~q~dep~~~~~k~~~~s~t~~~s~~~~~~s~P~~r~~  376 (825)
T KOG0267|consen  324 ------------------------VPL---LKETKSLGRLSVSYQTDEPLDKSTKPHRRSSTSQNSDRSEVESKPLTRES  376 (825)
T ss_pred             ------------------------cce---eccccchhccccccccCCCcccCCCCcccccccccccccccccCcccccc
Confidence                                    000   0001123333333 333333333332333345555554444444443333


Q ss_pred             ccCCCCccccccccccCCCCCCCCcccccCCCCCc-ccccc---ccccccccccccccCCCCCccCCCCCcccccCCCCC
Q 003459          381 VSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKT-SVVNS---TAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNT  456 (818)
Q Consensus       381 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~-~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  456 (818)
                      .....++.+...-+.+.+.++..|.|....+.++. +++++   .++.++.....++++.+... ...|..||+.+ ..+
T Consensus       377 s~~~~di~~~s~~lss~e~~~~~P~r~s~tn~~k~~sgvSs~~~rs~ts~~~~~k~n~ka~~~~-~e~~~~~v~~~-~~p  454 (825)
T KOG0267|consen  377 SNLSPDIPKESRTLSSTESNSEYPHRVSPTNPVKIVSGVSSSVTRSPTSPVNPGKANPKAEIAS-VEQDNNPVIQD-PLP  454 (825)
T ss_pred             CCCCcccccccccccccccCCCCCCcccccCccccccccccccccCCCCCCCccccCccccccc-cccccccccCC-Ccc
Confidence            33333333344555666777888889888776666 66654   44555555566666555432 25677888887 556


Q ss_pred             cccccccccccccccccccccccCccccccccccCCCCCCCCcccccccccCCCCccccccccccc--ccccccCccccc
Q 003459          457 RFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRN--TFAAIKGSIQGV  534 (818)
Q Consensus       457 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~  534 (818)
                      ..+.+.......+...|++|.++++.+.+.|  ++++.....++ +...+.+++....+.-...++  +++....+.+. 
T Consensus       455 ~~~q~~Esp~~~~~~arttP~s~~P~~~~~r--~~~rs~~~~~~-st~~~rtssspvmpv~lp~~s~~ty~~~~v~a~~-  530 (825)
T KOG0267|consen  455 TIEQATESPVPSTRIARTTPASVQPIALNSR--SNSRSDPPPPT-STVPERTSSSPVMPVILPQASMSTYPEPPVGASS-  530 (825)
T ss_pred             cccccccCccccccccccCCccccccccccc--ccCCCCCCCcc-cccccccccCCccccccCCCcccccCCCCccccC-
Confidence            6667777778888888889998888777777  45555554333 333455666666666555555  67766665432 


Q ss_pred             cccccCCcccceeccCCCCCCCCCCCCCCccccccccCCCCCCCCCCcccccccCccccccccccccCCCCCCCCCCCCC
Q 003459          535 SVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSI  614 (818)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  614 (818)
                       .+........+-.|++.+.++.++.+...+..++.+..--..  .+..-.+.-++-.|...+.++.....+...|...+
T Consensus       531 -~a~~s~~r~~~~~~~~a~~~~~~~~~~~l~r~r~~~pa~~~~--tk~~~~~~~t~~~s~iasr~r~s~t~~~~tPa~~~  607 (825)
T KOG0267|consen  531 -TARTSSARILPVTFNQANNISSEEAPVTLRRQRRNSPARVMP--TKLNQSVNMTSDTSHIASRHRVSPTQMLATPAVID  607 (825)
T ss_pred             -cccccccccccccccccccccCcCCccccccccCCCcccccc--cccchhhcccccccchhhhhccCccccccccceec
Confidence             244444445566777777776666666544433331110000  00111122244455555666655555566666666


Q ss_pred             CCCcccccCCCCccccccCCCCCcccccCCCCChHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhhhcCCHHHHHHHHHh
Q 003459          615 SSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQK  694 (818)
Q Consensus       615 ~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~d~~~~~~~~~~h~~~~~~l~~r~~~l~~~~~~w~~~~~~~~~~~~~~  694 (818)
                      .+.-.+..+-+|.++.++++.... |+...+.+|+++.++||..|++|++.|++|++|||+||+||+++|||++|.+++|
T Consensus       608 ~~~~mt~~et~~t~~~~q~~n~~~-ee~~~s~~eedI~e~im~~Hde~lstlqSRl~kLqiVR~~Wer~DiK~sI~s~~k  686 (825)
T KOG0267|consen  608 QVGDMTADETRPTNMQPQRDNLVQ-EEPIISDREEDIVEDIMGTHNEFLSTLQSRLTKLQIVRHFWERSDIKGSIGSLRK  686 (825)
T ss_pred             cccccccccccccccccccccccc-cccccCcchhhhhhhhhhcchHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHH
Confidence            666666666678888888877766 7766678999999999999999999999999999999999999999999999999


Q ss_pred             cCCceeehhhHHhhhcccceeeehhhhhhhhhHHhhhccccchhHHHHHHHHHHHHHHhhhhHHhhhcCCCcccccccHH
Q 003459          695 MADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAE  774 (818)
Q Consensus       695 ~~d~~v~~d~l~~~~~~~~~~~l~~c~~~lp~~~~ll~s~~e~~~~~~~~~l~~~~~~f~~~i~~~~~~~~~~gvd~~~e  774 (818)
                      |.|++|.||+|+||++|.++|+||+|+.|||+|+.||.|+||+|+.|+|+||++||+.||++|+++++||+.|||||+||
T Consensus       687 l~D~sV~ADvL~Iltek~eiLtLDl~t~l~P~lt~LLgS~~e~~v~vsld~Llklv~~fgt~I~stlsAp~~VGVDi~ae  766 (825)
T KOG0267|consen  687 LADNSVQADVLNILTEKIEILTLDLCTQLLPVLTALLGSKTERPVNVSLDMLLKLVAVFGTVIYSTLSAPRSVGVDIHAE  766 (825)
T ss_pred             hhhhhHHHHHHHHHhhhhhHhhHHHHHHHHHHHHHHhcccchhhhhhHHHHHHHHHHHhhhhhhhhhhCCcccccccchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhcccccc-CcchhhhHHHHHhhcc
Q 003459          775 QRIERCNRCFIELEKVKCCLPTLMR-GGSVAKSAQELNLALQ  815 (818)
Q Consensus       775 ~r~~~c~~c~~~l~~i~~~l~~~~~-~g~~~~~~~el~~~~~  815 (818)
                      ||.++|..||.+|.||...|+.+.+ +|..++.+++|+.+..
T Consensus       767 er~~~~~lc~~~l~kl~~~~~s~s~~s~s~~~~~~s~~~~~~  808 (825)
T KOG0267|consen  767 ERKERYSLCFVELPKLFCGLASLSKNSSSFIKKRRSLNKKGS  808 (825)
T ss_pred             HHHhhhhhhhhhcchhhccccccccccccchhhhhhhccccc
Confidence            9999999999999999999999999 9999999999998653

>PF13925 Katanin_con80: con80 domain of Katanin Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query818
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-31
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-30
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-11
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 7e-27
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-17
2gnq_A336 Structure Of Wdr5 Length = 336 3e-25
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-25
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-25
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 7e-25
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-25
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 7e-25
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 7e-25
2h9l_A329 Wdr5delta23 Length = 329 7e-25
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 8e-25
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 8e-25
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 9e-25
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 9e-25
2g99_A308 Structural Basis For The Specific Recognition Of Me 9e-25
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-24
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-24
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 3e-24
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 4e-24
3zey_7318 High-resolution Cryo-electron Microscopy Structure 4e-22
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 6e-21
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-08
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 2e-20
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 4e-20
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 6e-10
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 5e-20
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 5e-20
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-20
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 7e-20
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-19
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 5e-19
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 5e-19
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-19
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 9e-12
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-18
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-18
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-18
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 1e-18
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-18
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 6e-18
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-10
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 6e-18
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-10
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 1e-17
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 6e-11
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-17
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-10
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 6e-17
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 6e-17
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 7e-17
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 1e-16
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-16
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-16
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-16
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-16
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-13
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-16
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-16
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-15
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-09
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 3e-15
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-15
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 4e-15
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 6e-09
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-14
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-12
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-08
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 6e-13
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 3e-12
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 3e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 7e-12
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 2e-04
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-11
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-04
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-10
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-07
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 3e-10
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-09
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 3e-09
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 9e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-08
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-08
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 1e-08
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 6e-06
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 2e-07
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 2e-07
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 3e-07
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 1e-06
3mmy_A368 Structural And Functional Analysis Of The Interacti 2e-06
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 3e-06
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 3e-06
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 3e-06
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 8e-06
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 1e-05
1pgu_A615 Yeast Actin Interacting Protein 1 (aip1), Se-met Pr 1e-04
1pi6_A615 Yeast Actin Interacting Protein 1 (Aip1), Orthorhom 2e-04
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 2e-04
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 7e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 128/235 (54%), Gaps = 8/235 (3%)
Query: 9   LQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAIL-SLSGHTSGIDSVSF 67
           LQ    HSS+VN +   R   + + +  +D  V LW   +   +L +L+GH+S +  V+F
Sbjct: 255 LQTLTGHSSSVNGVAF-RPDGQTIASASDDKTVKLW--NRNGQLLQTLTGHSSSVWGVAF 311
Query: 68  DSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKI 127
                 +A+ +   T+KLW+    + ++TLTGH S+   V F P G+  AS S D  +K+
Sbjct: 312 SPDGQTIASASDDKTVKLWN-RNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKL 370
Query: 128 WDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQ 187
           W+ R    + T  GH+  V  + F+PDG+ + S  +D TVKLW+   G+LL     H   
Sbjct: 371 WN-RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRN-GQLLQTLTGHSSS 428
Query: 188 IQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTL 242
           +  + F P +  +A+ S D+TVK W+    +L+ +    +S VR + F+PDG+T+
Sbjct: 429 VWGVAFSPDDQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAFSPDGQTI 482
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure
>pdb|1PGU|A Chain A, Yeast Actin Interacting Protein 1 (aip1), Se-met Protein, Monoclinic Crystal Form Length = 615 Back     alignment and structure
>pdb|1PI6|A Chain A, Yeast Actin Interacting Protein 1 (Aip1), Orthorhombic Crystal Form Length = 615 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query818
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.98
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.98
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
3jro_A753 Fusion protein of protein transport protein SEC13 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3jro_A753 Fusion protein of protein transport protein SEC13 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.92
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.9
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.88
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.88
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.87
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.86
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.85
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.85
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.85
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.85
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.83
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.82
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.82
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.81
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.81
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.78
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.78
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.74
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.74
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.73
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.73
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.73
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.72
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.69
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.69
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.68
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.67
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.67
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.66
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.66
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.65
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.64
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.63
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.63
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.62
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.62
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.61
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.61
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.6
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.58
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.56
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.55
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.53
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.53
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.53
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.52
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.52
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.49
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.46
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.46
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.45
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.45
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.44
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.44
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.42
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.42
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.42
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.4
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.39
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.33
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.31
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.31
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.3
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.29
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.28
2qe8_A343 Uncharacterized protein; structural genomics, join 99.27
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.26
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.25
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.25
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.24
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.23
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.22
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.22
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.19
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.19
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.14
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.13
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.11
2ece_A462 462AA long hypothetical selenium-binding protein; 99.09
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.05
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.04
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.02
2qe8_A343 Uncharacterized protein; structural genomics, join 99.01
2ece_A462 462AA long hypothetical selenium-binding protein; 98.98
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.95
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.94
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.94
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.92
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.91
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.9
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.89
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.87
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.86
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.82
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.8
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.78
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.77
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.71
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.69
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.69
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.68
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.66
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.66
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.63
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.61
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.58
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.58
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.55
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.53
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.48
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.47
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.46
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.43
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.42
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.41
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.41
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.39
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.38
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.36
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.35
3v65_B386 Low-density lipoprotein receptor-related protein; 98.32
3v65_B386 Low-density lipoprotein receptor-related protein; 98.32
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.31
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.28
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.27
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.25
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.22
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.16
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.09
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.98
3kya_A496 Putative phosphatase; structural genomics, joint c 97.97
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.95
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.93
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.93
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.9
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.86
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.83
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.83
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.83
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.79
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.78
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.74
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.68
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.67
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.65
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.61
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.6
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.6
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.6
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.59
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.59
3ott_A758 Two-component system sensor histidine kinase; beta 97.54
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.51
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.46
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.46
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.45
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.39
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.37
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.3
3kya_A496 Putative phosphatase; structural genomics, joint c 97.25
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.24
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.18
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.14
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.1
3ott_A758 Two-component system sensor histidine kinase; beta 97.1
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.09
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.04
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.02
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.0
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.89
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.82
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.82
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.75
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.69
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.45
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.39
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.36
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.27
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.13
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.02
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.0
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.95
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 95.78
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.67
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.62
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.44
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.32
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.04
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.62
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.58
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.55
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.3
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.24
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 93.8
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 92.55
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 90.95
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 90.25
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 89.89
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 89.72
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 86.76
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 80.3
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 80.27
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=1.9e-41  Score=381.74  Aligned_cols=287  Identities=27%  Similarity=0.502  Sum_probs=272.2

Q ss_pred             EEEEecCCCCEEEEEEeeCCCcEEEEEeCCCeEEEEECCCCceEEEecCCCCCeEEEEEcCCCCEEEEEECCCeEEEEEC
Q 003459            9 LQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDL   88 (818)
Q Consensus         9 l~~~~~H~~~V~~lafsp~~~~lLatgs~Dg~V~lWdl~~~~~i~~l~~h~~~V~~l~fspdg~~Lasgs~DG~I~IWDl   88 (818)
                      ...+.+|.+.|++++|+| ++.+|++|+.||+|++||+.+++....+.+|...|.+++|+|++++|++|+.||+|++||+
T Consensus       101 ~~~l~gh~~~V~~~~~~p-~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~~l~sgs~D~~i~iwd~  179 (410)
T 1vyh_C          101 KYALSGHRSPVTRVIFHP-VFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDF  179 (410)
T ss_dssp             SCEEECCSSCEEEEEECS-SSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEET
T ss_pred             eEeecccCCcEEEEEEcC-CCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCCEEEEEeCCCeEEEEeC
Confidence            346789999999999999 6678999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeEEEEEcCCCCCeEEEEEeCCCCEEEEEECCCcEEEEECCCCeEEEEEecCCCCeEEEEEcCCCCEEEEEECCCeEE
Q 003459           89 EEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVK  168 (818)
Q Consensus        89 ~t~~~v~~l~~h~~~V~sv~fspdg~~Lasgs~Dg~I~IwDl~~~~~i~~l~~h~~~V~~l~fspdg~~L~sgs~Dg~I~  168 (818)
                      .+++.+..+.+|...|.+++|+|++.+|++|+.|+.|++||++++.++..+.+|...|.++.|+|+|.+|++|+.||.|+
T Consensus       180 ~~~~~~~~~~~h~~~V~~v~~~p~~~~l~s~s~D~~i~~wd~~~~~~~~~~~~h~~~v~~~~~~~~g~~l~s~s~D~~v~  259 (410)
T 1vyh_C          180 QGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVR  259 (410)
T ss_dssp             TSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEE
T ss_pred             CCCceeEEEcCCCCCEEEEEEeCCCCEEEEEeCCCeEEEEECCCCcEEEEEeCCCccEEEEEECCCCCEEEEEcCCCeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCCCeEEEEEecCCCCEEEEEEeCC--------------------CCEEEEEeCCCeEEEEECCCCeEEEEeCCCCC
Q 003459          169 LWDLTAGKLLHDFKCHEGQIQCIDFHPH--------------------EFLLATGSADRTVKFWDLETFELIGSAGPETS  228 (818)
Q Consensus       169 IwDl~t~~~i~~~~~h~~~I~sv~fspd--------------------g~~Lasgs~Dg~I~IwDl~t~~~i~~~~~~~~  228 (818)
                      +||+++++....+..|...|.+++|+|+                    +.+|++|+.|+.|++||+++++++..+.+|..
T Consensus       260 vwd~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~sgs~D~~i~iwd~~~~~~~~~~~~h~~  339 (410)
T 1vyh_C          260 VWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDN  339 (410)
T ss_dssp             EEETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEEECCSS
T ss_pred             EEECCCCceeeEecCCCceEEEEEEcCcccccchhhhccccccccCCCCCEEEEEeCCCeEEEEECCCCceEEEEECCCC
Confidence            9999999999999999999999999996                    67899999999999999999999999999999


Q ss_pred             CeeEEEEeCCCCEEEEEECCC-EEEEEecCCceeccccccccceeeeee-cCCCEEEEEEcCCeEEEEEe
Q 003459          229 GVRCLTFNPDGRTLLCGLHES-LKVFSWEPIRCHDAVDVGWSRLSDLNV-HEGKLLGCSYNQSCVGVWVV  296 (818)
Q Consensus       229 ~I~sl~fspdg~~Lasgs~d~-I~Vwd~~~~~~~~~~~~~~~~v~~l~~-~~g~lLatg~~Dg~V~IWdv  296 (818)
                      .|++++|+|+|++|++|+.++ |++||+...++...+..+...+..+.+ +++.+|++|+.||.|++|++
T Consensus       340 ~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~~~~~~~~h~~~v~~l~~~~~~~~l~sgs~D~~i~vW~~  409 (410)
T 1vyh_C          340 WVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWEC  409 (410)
T ss_dssp             CEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSSCEEEEETTSEEEEEC-
T ss_pred             cEEEEEEcCCCCEEEEEeCCCeEEEEECCCCceEEEEcCCCCcEEEEEEcCCCCEEEEEeCCCcEEEEeC
Confidence            999999999999999998775 999999999988888888888888876 67899999999999999986
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 818
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-39
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-33
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-27
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-35
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-31
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-26
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-29
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-27
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-21
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-27
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-27
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-23
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 9e-21
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 9e-21
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-18
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-23
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-22
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-21
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-20
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-21
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-18
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-19
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-16
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-14
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-18
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-17
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-16
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-16
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-16
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-16
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-14
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-11
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-16
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-15
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-15
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-13
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-15
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-11
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-11
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-12
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-10
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-12
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-11
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-10
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-13
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-13
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 4e-12
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 1e-11
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-07
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-11
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-10
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-09
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-09
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 5e-11
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 4e-08
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 7e-08
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-07
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 9e-07
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 9e-04
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 4e-06
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 6e-06
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 3e-05
d2p4oa1302 b.68.6.3 (A:4-305) Hypothetical protein All0351 ho 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  146 bits (368), Expect = 2e-39
 Identities = 47/206 (22%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 28  SSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWD 87
           +   +V+   D  + +W +     + + +GH   +  V  +    L+A+ +   T+++W 
Sbjct: 112 NGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWV 171

Query: 88  LEEAKIVRTLTGHRSNCISVDFH--------------------PFGEFFASGSLDTNLKI 127
           +   +    L  HR     + +                       G F  SGS D  +K+
Sbjct: 172 VATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKM 231

Query: 128 WDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQ 187
           WD+    C+ T  GH   V  + F   G++++S  +D T+++WD    + +     HE  
Sbjct: 232 WDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHF 291

Query: 188 IQCIDFHPHEFLLATGSADRTVKFWD 213
           +  +DFH     + TGS D+TVK W+
Sbjct: 292 VTSLDFHKTAPYVVTGSVDQTVKVWE 317
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query818
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.85
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.79
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.74
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.72
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.69
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.67
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.57
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.54
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.3
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.27
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.13
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.12
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.1
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.06
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.95
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.95
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.93
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.91
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.88
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.88
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.87
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.84
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.73
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.71
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.59
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.47
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.39
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.34
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.29
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.22
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.83
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.78
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.76
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.73
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.63
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.6
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.59
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.58
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.51
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.25
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.23
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.2
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.19
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.07
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.06
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.95
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.87
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.68
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.63
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.58
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.57
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 95.22
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 95.05
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.72
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.54
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.28
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.0
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.4
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 87.36
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 87.25
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 80.89
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=5.8e-37  Score=319.71  Aligned_cols=285  Identities=27%  Similarity=0.511  Sum_probs=269.4

Q ss_pred             EEEecCCCCEEEEEEeeCCCcEEEEEeCCCeEEEEECCCCceEEEecCCCCCeEEEEEcCCCCEEEEEECCCeEEEEECC
Q 003459           10 QEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLE   89 (818)
Q Consensus        10 ~~~~~H~~~V~~lafsp~~~~lLatgs~Dg~V~lWdl~~~~~i~~l~~h~~~V~~l~fspdg~~Lasgs~DG~I~IWDl~   89 (818)
                      ..|.||.+.|++|+|+| ++++|++|+.||+|+|||+.+++.+..+.+|...|.+++|++++.++++++.++.+.+|+..
T Consensus        11 ~~L~GH~~~I~~l~~sp-~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (317)
T d1vyhc1          11 YALSGHRSPVTRVIFHP-VFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ   89 (317)
T ss_dssp             CEEECCSSCEEEEEECS-SSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETT
T ss_pred             EEEcCCCCCeEEEEEcC-CCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeeccccccccccccccccccccc
Confidence            46899999999999999 67799999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEEcCCCCCeEEEEEeCCCCEEEEEECCCcEEEEECCCCeEEEEEecCCCCeEEEEEcCCCCEEEEEECCCeEEE
Q 003459           90 EAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKL  169 (818)
Q Consensus        90 t~~~v~~l~~h~~~V~sv~fspdg~~Lasgs~Dg~I~IwDl~~~~~i~~l~~h~~~V~~l~fspdg~~L~sgs~Dg~I~I  169 (818)
                      ..+....+.+|...+.++.|++++.++++++.|+.+++||+++++.+..+.+|...+.+++|++++.+|++++.|+.|++
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~~v~~  169 (317)
T d1vyhc1          90 GFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRV  169 (317)
T ss_dssp             SSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEE
T ss_pred             ccccccccccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccCCCcceeeecccCCCEEEEEeCCCeEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EECCCCeEEEEEecCCCCEEEEEEeCCC--------------------CEEEEEeCCCeEEEEECCCCeEEEEeCCCCCC
Q 003459          170 WDLTAGKLLHDFKCHEGQIQCIDFHPHE--------------------FLLATGSADRTVKFWDLETFELIGSAGPETSG  229 (818)
Q Consensus       170 wDl~t~~~i~~~~~h~~~I~sv~fspdg--------------------~~Lasgs~Dg~I~IwDl~t~~~i~~~~~~~~~  229 (818)
                      |++.+++.+..+..|...+.++.|+|++                    .++++++.|+.|++||+++++++..+..|...
T Consensus       170 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~~  249 (317)
T d1vyhc1         170 WVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNW  249 (317)
T ss_dssp             EETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEEECCSSC
T ss_pred             EeeccceeeEEEecCCCCceEEEEeeccccceeeccccceeeeeccCCceeEeccCCCEEEEEECCCCcEEEEEeCCCCC
Confidence            9999999999999999999999998753                    47899999999999999999999999999999


Q ss_pred             eeEEEEeCCCCEEEEEECC-CEEEEEecCCceeccccccccceeeeee-cCCCEEEEEEcCCeEEEEE
Q 003459          230 VRCLTFNPDGRTLLCGLHE-SLKVFSWEPIRCHDAVDVGWSRLSDLNV-HEGKLLGCSYNQSCVGVWV  295 (818)
Q Consensus       230 I~sl~fspdg~~Lasgs~d-~I~Vwd~~~~~~~~~~~~~~~~v~~l~~-~~g~lLatg~~Dg~V~IWd  295 (818)
                      |.+++|+|+|++|++|+.+ .|+|||+...+....+..+...+..+.+ +++++|++|+.||.|+|||
T Consensus       250 v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         250 VRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             EEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSSCEEEEETTSEEEEEC
T ss_pred             EEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCCCCEEEEEeCCCeEEEeC
Confidence            9999999999999998876 5999999999998888888888888876 6889999999999999996
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure