Citrus Sinensis ID: 003487


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810------
MASAQVLPTSRKQEHLEAGKRKLEEFRKKKAAERAKKASSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANENISFRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRRTSKLL
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHccHHHHHHHHHcHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccc
ccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccHHcccHEEEccccccccccccccEcccccccccccccccEEccccccccccEEccccccccccccccccccccccccccccEccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHcccHHHcccccccccHcccccHHHHccHHHccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHcccccccccccHHHHHHHHHHHHHcccccccccccccc
masaqvlptsrkqEHLEAGKRKLEEFRKKKAAERAkkassvsqpqasdfslhdqhhleadrvrvtdldgagtsdgpdkavvslplvmhnddnKALKLAQQSQqvslsdkrinsncfendlnssSAYLAQTYsnnqetsgsagpvnvsnsqetkdvnndFVIYssgqgrlrdgimsnqflsllpeasqdydssnssksgfqgieesqskgndsfpkvptlvnsgpshdfvtkispqnsvstlfqskpsnaialgnghsfhsssegtahlttstggsasevglntpsttnfsdpvsfntgegkpsnsasglaslqstpfkrseysgynfdagnsfnhvpvssatnkftlgkSRASfldslnvprassgtlfeqteperdsfmsssslnsmdvlgsspaqnpsmekettgafsktttsnipsafdylgnptvstsdrgdirrlgsnessienqhgfystkhnEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAenssltdsynQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRkasgsgksidfgktaastvnaststedlaitdttldnsnqdthddaslpridasgstllpesgrLALEGlavniphdqmRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNManenisfrqpdsasthdhtayadegDEVVERVLGWIMKlfpggpsrrrtskll
masaqvlptsrkqehleagkrKLEEFRKKKAAerakkassvsqpqasdfslHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSnsqetkdvnnDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESqskgndsfpkVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFldslnvprassgtlfeqteperDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAaenssltdsynqQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASevigleekalrlrsnelklerqlensqseisSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRkasgsgksidfgktaastvnaststedLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANENISFRQPDSASTHDHTAYADEGDEVVERVLGWImklfpggpsrrrtskll
MASAQVLPTSRKQEHLEAGkrkleefrkkkaaerakkaSSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEAsqdydssnssksGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERdsfmsssslnsmdvlgssPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQrsleasralseslaaensslTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENsqseissykkkisslekeRQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKtaastvnaststEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANENISFRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRRTSKLL
*************************************************************************************************************************************************************DFVIYSS************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEE***************************************************************************************************************************LALEGLAVNIPHDQMRMIHNINALISELALEK*******************************************************************GDEVVERVLGWIMKLF*************
**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VVERVLGWIM****************
******************GKRKLEEF*************************HDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKL***********KRINSNCFENDLNSSSAYLAQTYS**************SNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEA**************************SFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFN*****************STPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFE**************LNSM**********************KTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLE****************************STIEALQEE****************SIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANENISFR***********AYADEGDEVVERVLGWIMKLFPGG**********
******************GKRKLEEFRKKKAAER*************************DRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEAS*************************SFPKVPTLVNSGPSHDFVTKIS************PSNAIALGNG**F**SSEGTAHLTTSTGGSASE*****PS*TNFSDPVSFNTGE***********************************************************************************************************************************TSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSG************************************************************L**LAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMA*E******************ADEGDEVVERVLGWIMKLFPG***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAQVLPTSRKQEHxxxxxxxxxxxxxxxxxxxxxKASSVSQPQASDFSLHDQHHLEADRVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDLNSSSAYLAQTYSNNQETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMSNQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEGKPSNSASGLASLQSTPFKRSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERDSFMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEASRALSESLAAENSSLTDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKILASEVIGLEEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSIDFGKTAASTVNASTSTEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQxxxxxxxxxxxxxxxxxxxxxxxxxxxxNMANENISFRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRRTSKLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query816
225433351804 PREDICTED: uncharacterized protein LOC10 0.969 0.983 0.546 0.0
356533381784 PREDICTED: uncharacterized protein LOC10 0.944 0.983 0.506 0.0
255554298713 conserved hypothetical protein [Ricinus 0.870 0.995 0.477 1e-156
145338880714 protein BLISTER [Arabidopsis thaliana] g 0.867 0.991 0.437 1e-144
297831252728 hypothetical protein ARALYDRAFT_898989 [ 0.609 0.682 0.554 1e-143
125528809760 hypothetical protein OsI_04881 [Oryza sa 0.594 0.638 0.477 1e-109
115441767760 Os01g0911800 [Oryza sativa Japonica Grou 0.594 0.638 0.477 1e-109
242055353770 hypothetical protein SORBIDRAFT_03g04350 0.540 0.572 0.487 1e-109
414879058748 TPA: hypothetical protein ZEAMMB73_30879 0.558 0.609 0.482 1e-108
147843847443 hypothetical protein VITISV_004427 [Viti 0.359 0.661 0.679 1e-104
>gi|225433351|ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251145 [Vitis vinifera] gi|297741880|emb|CBI33315.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/829 (54%), Positives = 566/829 (68%), Gaps = 38/829 (4%)

Query: 1   MASAQVLPTSRKQEHLEAGKRKLEEFRKKKAAERAKKASSVSQPQASDFSLHDQHHLEAD 60
           MASAQVL   RKQEHLEAGKR+LEEFRKKKAA+RAKK +S+SQ Q++D SL  Q  LE +
Sbjct: 1   MASAQVL---RKQEHLEAGKRRLEEFRKKKAADRAKKVASISQLQSADVSLCVQP-LENE 56

Query: 61  RVRVTDLDGAGTSDGPDKAVVSLPLVMHNDDNKALKLAQQSQQVSLSDKRINSNCFENDL 120
           +VRV D DGAG SDG  +AV  +     N+DNK +++ Q S+  S SD          D 
Sbjct: 57  QVRVMDSDGAGISDGVGEAVTKVI----NNDNKKIEIFQNSEPCS-SDIYAKPPFSTKDY 111

Query: 121 NSSSAYLAQTYSNNQ-----ETSGSAGPVNVSNSQETKDVNNDFVIYSSGQGRLRDGIMS 175
            + SA   QT  N+Q     + SG  G V     Q  K+ N+D  I++  +G   + I+S
Sbjct: 112 KAFSADSVQTQVNDQGFNRYDASGFLGLVG----QLAKEKNDDGGIHAGAEGSAYE-IVS 166

Query: 176 NQFLSLLPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQ 235
           +Q ++  P+A +D DSS SS+S F  +EE+Q K + S  K  T+++ G S   +   S +
Sbjct: 167 DQSIAF-PQAIRDTDSS-SSQSNFHRMEETQQKDHKSSLKSFTVIDPGISQVPLANASSE 224

Query: 236 NSVSTLFQSKPSNAIALGN-GHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVS 294
           NS          NAI   N G++   SS  + H  T+   SA  VG + P + +F+  + 
Sbjct: 225 NS---------GNAILPNNYGYANMKSSADSVHPITTAKQSAFGVGQDVPGSVDFNVHML 275

Query: 295 FNTGEGKPSNSASGLASLQ-STPFK-RSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRA 352
            N  + K S+S   L S   ++P    S  + + FD   S NH+P+ S T +    +SR 
Sbjct: 276 SNKEDKKLSSSFGYLPSTHGASPLASESSSTSFAFDVRGSSNHLPLYSVTPETNARRSRP 335

Query: 353 SFLDSLNVPRASSGTLFEQTEPERDS--FMSSSSLNSMDVLGSSPAQNPSMEKETTGAFS 410
           SFLDS+NVPR  S +    TEP +    F SSS +NSMDVLGSS +     E E    FS
Sbjct: 336 SFLDSINVPRVPSASHLPLTEPGKAEPFFSSSSKVNSMDVLGSSASTKSLAESENFEPFS 395

Query: 411 KTTTSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIE 470
           K   SN PS FD+  N +VS  +R ++ R G +++S+E +  F+S K NEDFAALEQHIE
Sbjct: 396 KAGNSNGPSLFDHSINSSVSVGNRVEMLRHGLDQNSLERKFEFHSQKQNEDFAALEQHIE 455

Query: 471 DLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLV 530
           DLTQEKF+LQR+LEASRAL+ESLAAENSSLTDSYNQQ SVVNQLKS+MEKLQEEIK QLV
Sbjct: 456 DLTQEKFSLQRALEASRALAESLAAENSSLTDSYNQQGSVVNQLKSDMEKLQEEIKAQLV 515

Query: 531 ELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISS 590
           +LESF+ EYAN +LECNAADERAK+LASEVIGLEEKALRLRS+ELKLERQLENS +EISS
Sbjct: 516 DLESFKIEYANAQLECNAADERAKLLASEVIGLEEKALRLRSSELKLERQLENSNAEISS 575

Query: 591 YKKKISSLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTE 650
           +KKK+SSLEKERQD Q TI+ALQEEKK++Q K+RKAS +GKSID  K+     + STST+
Sbjct: 576 FKKKVSSLEKERQDLQLTIDALQEEKKLLQKKVRKASANGKSIDASKSPTDRKDVSTSTD 635

Query: 651 DLAITDTTL---DNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIH 707
           DL   D      + S+ +  + AS+   + S   LLP+ G++  E  +VNIP DQMRMI 
Sbjct: 636 DLVNEDNACMIPETSSLEMLNSASVQANELSSFPLLPDGGQMNFEVSSVNIPADQMRMIQ 695

Query: 708 NINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANEN 767
           NINALISELALEKEEL+QAL +E +QSSKLKDLN ELSRKLE QTQRLELLT+Q+MANE 
Sbjct: 696 NINALISELALEKEELMQALVTESSQSSKLKDLNKELSRKLEVQTQRLELLTSQSMANEV 755

Query: 768 ISFRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRRTSKLL 816
           I  RQPDS   HD+ AYADEGDEVVERVLGWIM+LFPGGP++RRTSKLL
Sbjct: 756 IQARQPDSRIMHDNAAYADEGDEVVERVLGWIMRLFPGGPAKRRTSKLL 804




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356533381|ref|XP_003535243.1| PREDICTED: uncharacterized protein LOC100817279 [Glycine max] Back     alignment and taxonomy information
>gi|255554298|ref|XP_002518189.1| conserved hypothetical protein [Ricinus communis] gi|223542785|gb|EEF44322.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|145338880|ref|NP_189040.3| protein BLISTER [Arabidopsis thaliana] gi|9294667|dbj|BAB03016.1| unnamed protein product [Arabidopsis thaliana] gi|332643320|gb|AEE76841.1| protein BLISTER [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831252|ref|XP_002883508.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] gi|297329348|gb|EFH59767.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|125528809|gb|EAY76923.1| hypothetical protein OsI_04881 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115441767|ref|NP_001045163.1| Os01g0911800 [Oryza sativa Japonica Group] gi|20161363|dbj|BAB90287.1| heavy meromyosin-like [Oryza sativa Japonica Group] gi|113534694|dbj|BAF07077.1| Os01g0911800 [Oryza sativa Japonica Group] gi|125573067|gb|EAZ14582.1| hypothetical protein OsJ_04505 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242055353|ref|XP_002456822.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] gi|241928797|gb|EES01942.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|414879058|tpg|DAA56189.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879059|tpg|DAA56190.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879060|tpg|DAA56191.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] Back     alignment and taxonomy information
>gi|147843847|emb|CAN79450.1| hypothetical protein VITISV_004427 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query816
TAIR|locus:2076071714 BLI "BLISTER" [Arabidopsis tha 0.707 0.808 0.437 3.4e-113
DICTYBASE|DDB_G0271670374 DDB_G0271670 [Dictyostelium di 0.395 0.863 0.172 6.7e-06
ZFIN|ZDB-GENE-080618-2538 prdm1b "PR domain containing 1 0.414 0.628 0.212 0.00025
POMBASE|SPBC215.13534 SPBC215.13 "sequence orphan" [ 0.334 0.511 0.226 0.00032
UNIPROTKB|O18515534 O18515 "Nucleoporin p62" [Hydr 0.247 0.378 0.221 0.00049
UNIPROTKB|I3LRD3 2501 CENPE "Uncharacterized protein 0.332 0.108 0.224 0.00098
CGD|CAL0006203768 orf19.4906 [Candida albicans ( 0.296 0.315 0.247 0.00098
UNIPROTKB|Q5APQ2768 CaO19.4906 "Putative uncharact 0.296 0.315 0.247 0.00098
TAIR|locus:2076071 BLI "BLISTER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1088 (388.1 bits), Expect = 3.4e-113, Sum P(2) = 3.4e-113
 Identities = 266/608 (43%), Positives = 359/608 (59%)

Query:   220 VNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEV 279
             VN+ P     + I  Q+S S    S      +L +G S     +G  H +  T      +
Sbjct:   127 VNTRPEVVPYSNIDKQSSESFDRASTLRETASLFSGTSMQM--DGFIHGSGLTSSRKDSL 184

Query:   280 GLNTPSTTNFSDPVSFNTGEG--------KPSNSASGLASLQSTPFKRSEYSGYNFDAGN 331
                T    +F +      G G        KP+ S+S L +   T  + SE S ++ +  +
Sbjct:   185 QPTTRMAGSFDEVAKNQQGSGELGGSIVQKPTLSSSYLFNSPDTSSRPSEPSDFSVNITS 244

Query:   332 SFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERXXXXXXXXXXXXXXX 391
             S    P++SA ++ T+ +SR SFLDSLN+ RA   T ++   PE                
Sbjct:   245 SS---PLNSAKSEATVKRSRPSFLDSLNISRAPE-TQYQH--PEIQADLVTSSGSQLSGS 298

Query:   392 XXXPAQNPSMEKETTGAFSKTT-TSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQ 450
                     S  +++ G  S T+  S+ P+ F+   +     ++ G +   G  + S+  Q
Sbjct:   299 DGFGPSYISGRRDSNGPSSLTSGASDYPNPFEKFRSSLYPAAN-GVMP--GFTDFSMPKQ 355

Query:   451 HGFYSTKHNEDFAALEQHIEDLTQEKFALQXXXXXXXXXXXXXXXXXXXXTDSYNQQRSV 510
                     N+DF ALEQHIEDLTQEKF+LQ                    TD+YNQQR +
Sbjct:   356 --------NDDFTALEQHIEDLTQEKFSLQRDLDASRALAESLASENSSMTDTYNQQRGL 407

Query:   511 VNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRL 570
             VNQLK +ME+L ++I+ Q+ ELES R EYAN +LECNAADER++ILASEVI LE+KALRL
Sbjct:   408 VNQLKDDMERLYQQIQAQMGELESVRVEYANAQLECNAADERSQILASEVISLEDKALRL 467

Query:   571 RSNELKLERQLENXXXXXXXXXXXXXXXXXXRQDFQSTIEALQEEKKMMQSKLRKASGSG 630
             RSNELKLER+LE                   RQD QSTI+ALQEEKK++Q+ ++KAS  G
Sbjct:   468 RSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEKKVLQTMVQKASSGG 527

Query:   631 KSIDFGKXXXXXXXXXXXXEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLA 690
             KS D  K            E LAI+DTT ++SNQ+T D  +L   D+S + ++PE+ +L 
Sbjct:   528 KSTDLSKNSTSRKNVSTSTEGLAISDTTPESSNQET-DSTTLLESDSSNTAIIPETRQLT 586

Query:   691 LEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEH 750
             LEG ++++P DQMR+IHNIN LI+ELA+EKEELVQALSSEL++S+ +++LN ELSRKLE 
Sbjct:   587 LEGFSLSVPADQMRVIHNINTLIAELAIEKEELVQALSSELSRSAHVQELNKELSRKLEA 646

Query:   751 QTQRLELLTAQNMANENIS--FRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPS 808
             QTQRLEL+TAQ MA +N+S   +QPD+    + T  ADEGDEVVERVLGWIMK+FPGGPS
Sbjct:   647 QTQRLELVTAQKMAIDNVSPEKQQPDTHVVQERTPIADEGDEVVERVLGWIMKMFPGGPS 706

Query:   809 RRRTSKLL 816
             +RRTSKLL
Sbjct:   707 KRRTSKLL 714


GO:0005794 "Golgi apparatus" evidence=ISM
GO:0005634 "nucleus" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0009908 "flower development" evidence=IMP
GO:0009965 "leaf morphogenesis" evidence=IGI
GO:0010091 "trichome branching" evidence=IMP
GO:0048316 "seed development" evidence=IMP
GO:0048826 "cotyledon morphogenesis" evidence=IMP
GO:0051781 "positive regulation of cell division" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080618-2 prdm1b "PR domain containing 1b, with ZNF domain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC215.13 SPBC215.13 "sequence orphan" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|O18515 O18515 "Nucleoporin p62" [Hydra vulgaris (taxid:6087)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRD3 CENPE "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
CGD|CAL0006203 orf19.4906 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5APQ2 CaO19.4906 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query816
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-09
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-07
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-07
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-07
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 6e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
pfam09726680 pfam09726, Macoilin, Transmembrane protein 4e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 1e-05
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-05
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 3e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane 4e-05
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 7e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-05
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 1e-04
pfam04156186 pfam04156, IncA, IncA protein 1e-04
COG3096 1480 COG3096, MukB, Uncharacterized protein involved in 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 5e-04
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 9e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.001
pfam13166713 pfam13166, AAA_13, AAA domain 0.001
PRK10929 1109 PRK10929, PRK10929, putative mechanosensitive chan 0.002
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
COG4717984 COG4717, COG4717, Uncharacterized conserved protei 0.003
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 65.9 bits (161), Expect = 7e-11
 Identities = 48/196 (24%), Positives = 93/196 (47%), Gaps = 3/196 (1%)

Query: 434 RGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQ---HIEDLTQEKFALQRSLEASRALS 490
              +  L      +E Q      +       LEQ    +E+L +E   L+  LE  +   
Sbjct: 701 EDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERL 760

Query: 491 ESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAAD 550
           E L  E  SL ++  + +  + +L+ + + LQEE++    ELE        +  E  + +
Sbjct: 761 EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820

Query: 551 ERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIE 610
           +R + L  E+  LEE+   L     +LE +LE  + E+   K+++  LE E+++ +  ++
Sbjct: 821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELK 880

Query: 611 ALQEEKKMMQSKLRKA 626
            L+EEK+ ++ +LR+ 
Sbjct: 881 ELEEEKEELEEELREL 896


Length = 1163

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|236798 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 816
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.15
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.04
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.97
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.88
PRK02224 880 chromosome segregation protein; Provisional 97.85
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.61
PRK02224880 chromosome segregation protein; Provisional 97.49
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.49
PRK11637428 AmiB activator; Provisional 97.43
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.32
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.32
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.23
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.11
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.09
PRK11637428 AmiB activator; Provisional 97.03
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.99
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.98
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.96
PHA02562562 46 endonuclease subunit; Provisional 96.95
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.82
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.79
PHA02562562 46 endonuclease subunit; Provisional 96.78
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.71
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.65
PRK09039343 hypothetical protein; Validated 96.59
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 96.56
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.48
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.43
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.43
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.42
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 96.39
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.37
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.32
PRK03918880 chromosome segregation protein; Provisional 96.28
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 96.2
PRK03918 880 chromosome segregation protein; Provisional 96.18
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.15
PRK04778569 septation ring formation regulator EzrA; Provision 96.12
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 96.09
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.09
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.03
PF00038312 Filament: Intermediate filament protein; InterPro: 95.94
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.89
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.87
PRK04863 1486 mukB cell division protein MukB; Provisional 95.79
PRK09039343 hypothetical protein; Validated 95.68
PRK10361475 DNA recombination protein RmuC; Provisional 95.66
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 95.62
PRK04778569 septation ring formation regulator EzrA; Provision 95.61
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.56
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.56
PRK04863 1486 mukB cell division protein MukB; Provisional 95.48
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.39
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.37
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.33
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.29
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 95.28
PF00038312 Filament: Intermediate filament protein; InterPro: 95.15
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 95.13
KOG09331174 consensus Structural maintenance of chromosome pro 95.02
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.88
PF10186302 Atg14: UV radiation resistance protein and autopha 94.85
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.81
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 94.75
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 94.74
KOG09331174 consensus Structural maintenance of chromosome pro 94.73
COG4372 499 Uncharacterized protein conserved in bacteria with 94.67
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 94.61
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 94.59
KOG0979 1072 consensus Structural maintenance of chromosome pro 94.58
PF13166712 AAA_13: AAA domain 94.54
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.5
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.49
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.46
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.39
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.3
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 94.26
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.12
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.05
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 93.92
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 93.87
COG4942420 Membrane-bound metallopeptidase [Cell division and 93.83
PF10186302 Atg14: UV radiation resistance protein and autopha 93.78
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.72
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 93.68
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.67
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 93.64
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 93.62
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 93.57
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.55
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.32
PF13514 1111 AAA_27: AAA domain 93.31
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 93.3
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 93.27
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.23
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 93.23
KOG1103 561 consensus Predicted coiled-coil protein [Function 93.22
KOG0971 1243 consensus Microtubule-associated protein dynactin 93.17
PRK11281 1113 hypothetical protein; Provisional 93.01
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 92.95
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.78
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 92.76
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.72
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 92.67
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 92.66
KOG4673 961 consensus Transcription factor TMF, TATA element m 92.63
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 92.56
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 92.55
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 92.53
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 92.49
PRK10476346 multidrug resistance protein MdtN; Provisional 92.44
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 92.41
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 92.4
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 92.31
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 92.25
PF135141111 AAA_27: AAA domain 92.09
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 92.05
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 92.04
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 91.77
PRK11281 1113 hypothetical protein; Provisional 91.66
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 91.6
KOG4673961 consensus Transcription factor TMF, TATA element m 91.54
PRK01156895 chromosome segregation protein; Provisional 91.54
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 91.48
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 91.2
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 91.19
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 91.11
PLN031881320 kinesin-12 family protein; Provisional 91.02
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 91.0
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 90.6
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 90.56
KOG0964 1200 consensus Structural maintenance of chromosome pro 90.55
PRK1542279 septal ring assembly protein ZapB; Provisional 90.44
PRK11519 719 tyrosine kinase; Provisional 90.36
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 90.26
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 90.24
KOG0996 1293 consensus Structural maintenance of chromosome pro 90.21
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 90.12
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 90.09
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 90.01
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 89.88
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 89.86
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 89.84
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.68
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 89.62
PF14662193 CCDC155: Coiled-coil region of CCDC155 89.6
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 89.59
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.49
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 89.49
PF05701522 WEMBL: Weak chloroplast movement under blue light; 89.47
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 89.12
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 89.03
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.97
COG4942420 Membrane-bound metallopeptidase [Cell division and 88.79
PF09731582 Mitofilin: Mitochondrial inner membrane protein; I 88.74
KOG0288 459 consensus WD40 repeat protein TipD [General functi 88.56
KOG0249 916 consensus LAR-interacting protein and related prot 88.56
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 88.45
PRK10246 1047 exonuclease subunit SbcC; Provisional 88.45
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 88.22
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 88.14
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 88.07
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 88.03
PRK10929 1109 putative mechanosensitive channel protein; Provisi 87.97
PRK10884206 SH3 domain-containing protein; Provisional 87.85
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 87.79
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 87.31
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 87.3
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 87.29
COG307479 Uncharacterized protein conserved in bacteria [Fun 87.16
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 87.1
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 87.01
TIGR02977219 phageshock_pspA phage shock protein A. Members of 86.99
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 86.96
PF05546207 She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 86.94
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.84
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 86.8
PRK102461047 exonuclease subunit SbcC; Provisional 86.7
PRK10361475 DNA recombination protein RmuC; Provisional 86.64
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 86.46
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 86.15
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 86.13
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 86.11
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 86.05
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 86.03
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 85.94
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 85.48
KOG1962216 consensus B-cell receptor-associated protein and r 85.25
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.95
PRK03598331 putative efflux pump membrane fusion protein; Prov 84.92
PRK10884206 SH3 domain-containing protein; Provisional 84.77
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 84.75
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 84.54
cd07675252 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ 84.47
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 84.46
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 84.42
PF13166712 AAA_13: AAA domain 84.27
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.26
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 83.9
PF06548488 Kinesin-related: Kinesin-related; InterPro: IPR010 83.32
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 83.25
COG2433652 Uncharacterized conserved protein [Function unknow 83.24
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 83.19
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 83.09
cd07649233 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am 82.93
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 82.7
KOG0964 1200 consensus Structural maintenance of chromosome pro 82.57
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 82.54
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 82.49
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.42
TIGR02231 525 conserved hypothetical protein. This family consis 82.37
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 82.24
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 81.91
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 81.9
cd07658239 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin 81.6
PF13815118 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro 81.2
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 81.07
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 81.04
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 80.48
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 80.45
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
Probab=98.15  E-value=0.0027  Score=73.27  Aligned_cols=165  Identities=18%  Similarity=0.318  Sum_probs=75.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHH
Q 003487          460 EDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEY  539 (816)
Q Consensus       460 ~~faaLqqhIeDLT~EKfaLqR~L~~s~~l~EsLA~ENsaLTd~yNqQ~~~v~qLk~dmEqLq~Ei~aQ~~~le~l~aEr  539 (816)
                      .+...|++.++++..+--.+...+.....-.+++..+-..+..........+..++.++++++.++......++.+..+.
T Consensus       677 ~e~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~e~~~~~~~~  756 (1179)
T TIGR02168       677 REIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKEL  756 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34555555555555555555555555555444555444444444444444444555555555554444444444444444


Q ss_pred             HHHhhhhhhHHHHHHHHHHHHHhHHHHHHHHhhhhhhhHHHHhhhHHHHHHHHHHhhhHHHhhhhhHHHHHHHHHHHHHH
Q 003487          540 ANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMM  619 (816)
Q Consensus       540 daArle~~aA~ERak~LAaEVV~LEEk~l~LRS~ELKlerele~l~~E~~s~~rqlsslekeR~~lqsti~ALQEEKklL  619 (816)
                      .....+.....++...+-.++-.|++++..++...-.++.+++.+..++..++.++..+..+...++..+..++.+.+.+
T Consensus       757 ~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~l  836 (1179)
T TIGR02168       757 TELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAAT  836 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444444444444444444444444443333322223334444444444444444444444444444444444444444


Q ss_pred             HHHHH
Q 003487          620 QSKLR  624 (816)
Q Consensus       620 qskLR  624 (816)
                      +.++.
T Consensus       837 ~~~~~  841 (1179)
T TIGR02168       837 ERRLE  841 (1179)
T ss_pred             HHHHH
Confidence            43333



SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) Back     alignment and domain information
>PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query816
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 4e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 9e-08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 3e-07
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 9e-05
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 1e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 1e-04
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 1e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 78.4 bits (192), Expect = 7e-15
 Identities = 67/528 (12%), Positives = 142/528 (26%), Gaps = 156/528 (29%)

Query: 401 MEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRL-----GSNESSIENQHGFYS 455
           ++       SK    +I      + +    +       RL        E  ++    F  
Sbjct: 38  VQDMPKSILSKEEIDHI------IMSKDAVSG----TLRLFWTLLSKQEEMVQK---FVE 84

Query: 456 TKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQR-SVVNQL 514
                ++  L   I+   ++   + R     R   + L  +N      YN  R     +L
Sbjct: 85  EVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR---DRLYNDNQVFAK-YNVSRLQPYLKL 140

Query: 515 KSEMEKLQEEIKV----------QLVELESFRNE-----------YANVRLECNAADERA 553
           +  + +L+    V            V L+   +            + N++  CN+ +   
Sbjct: 141 RQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK-NCNSPETVL 199

Query: 554 KILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQ---------- 603
           ++L      L     ++  N         N +  I S + ++  L K +           
Sbjct: 200 EMLQK----L---LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252

Query: 604 ----------DFQSTI----------EAL--QEEKKMMQSKLRKASGSGKSID-FGKTAA 640
                     +    I          + L       +            +      K   
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLK--- 309

Query: 641 STVNASTSTEDL-----------------AITD--TTLDNSNQDTHDDASLPR-IDASGS 680
                    +DL                 +I D   T DN      D   L   I++S +
Sbjct: 310 ---YLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDK--LTTIIESSLN 364

Query: 681 TLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALE------KEELVQALSSELAQS 734
            L P   R   + L+V  P           A I  + L        +  V  + ++L + 
Sbjct: 365 VLEPAEYRKMFDRLSV-FPPS---------AHIPTILLSLIWFDVIKSDVMVVVNKLHKY 414

Query: 735 SKLKDLNNELSRKLEHQTQRLELLTAQNMA--NENI--SFRQPDSASTHD---------- 780
           S ++    E +  +         +  +N    + +I   +  P +  + D          
Sbjct: 415 SLVEKQPKESTISI-PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYF 473

Query: 781 --HTAY----ADEGDEVVE--RV---LGWI-MKLFPGGPSRRRTSKLL 816
             H  +     +  + +     V     ++  K+     +   +  +L
Sbjct: 474 YSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSIL 521


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00