Citrus Sinensis ID: 003488


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810------
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
cccccEEEEEcccccccEEccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccHHHHHcccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEEccccccccccccEEEccccEEEEEEccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHHcccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEcccEEEEEcccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccEEEc
cccccEEEEEEEcccccccEEccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEcccccccccccccccHHHccccccEEEEccccccccccccHHHHcccccccEEEEEEEcccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEccccHHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHHHcccccHHEEEcccccccccccccccccEEEEEccccccccccccccccEEEEEccccccccccHHHcccccEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHcccccEEEEEcccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHEccccccccccccccccccccEEEccccccHHcccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccHHHEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEc
MVTGQVIGLDLScswlhgsipsnsslfllpyletlnlgsndfnsslissgfGRLISLThlnlsnsyfsgqipSEISQLSKMLsldlskndevrieSPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLtgcnligpipaslanlpqltslslsynhfsghiPSFLSHLKQLYYLNLeqnnlvggipdsfvnltqlsFLDLSwnqltgrlpscLKGLRNLVTLRlsgnslngtipswlftvlpylevihlrdnrftgsipsTIFELVNLTSIrlssnnlsGHIELCMFARLKNLQYLYLSQnrlsvntkldanstfPKLLKLGlsacnisefpdflrSQDRLEWLQLSEnkiygripnwfwdigkdtlynlnlsdnfltdveqvplknlrfldlrsnllqgsvmvlpprliffsisnnkltgeipcsfctaapiefidlsnnslsgpipeclvDSITLIWLDLHlnsfngsipqisangsgLVNLIlndnqfegplpqslancsrLQVLNVAnnriddtfphWLAQLPELLVLILRSNkfygligntdarvifpklrildlsrneftgvlptRYFQNLKammrgsntsTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIdfssnrfegqipeVVGKLNLLKMLNFShnhltgripsslrnltvlesldlssnrlvgqiptqltsLNFLSKLNLshnqlegpipqgpqfntfqsdsyignlglcgfplsdkcsniddaqepaprdtwswfDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRIldlsrneftgVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGrprwlvrmverkrirrqstrifls
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDysltnlssslsylhltGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHlkqlyylnleqnnlVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
****QVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEI*****MLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQL********QFNTFQSDSYIGNLGLCGFPLSDKCSNIDD*****PRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRI**********
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMR********VQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGF**************************KVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
**TGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKC***************SWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIRRQSTRIFLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query816 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.909 0.876 0.357 1e-107
Q9FL28 1173 LRR receptor-like serine/ no no 0.816 0.567 0.318 3e-69
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.835 0.544 0.314 2e-67
C0LGQ5 1249 LRR receptor-like serine/ no no 0.883 0.577 0.319 1e-65
Q9LP24 1120 Probable leucine-rich rep no no 0.802 0.584 0.323 7e-65
Q8VZG8 1045 Probable LRR receptor-lik no no 0.649 0.507 0.327 2e-62
Q9ZWC8 1166 Serine/threonine-protein no no 0.844 0.590 0.292 2e-59
Q9LVP0 1102 Probable leucine-rich rep no no 0.799 0.591 0.320 3e-59
Q9FZ59 1088 Leucine-rich repeat recep no no 0.776 0.582 0.307 3e-58
O82318 960 Probably inactive leucine no no 0.726 0.617 0.305 1e-57
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  390 bits (1002), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 293/819 (35%), Positives = 422/819 (51%), Gaps = 77/819 (9%)

Query: 3   TGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLNL 62
           +GQVI LD+  ++L+  + +NSSLF L YL  L+L + +     I S  G L  LT +NL
Sbjct: 83  SGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGE-IPSSLGNLSHLTLVNL 141

Query: 63  SNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMSTI 122
             + F G+IP+ I  L+++  L L+ N+ +  E P   G   NL++L  L L    +   
Sbjct: 142 YFNKFVGEIPASIGNLNQLRHLILA-NNVLTGEIPSSLG---NLSRLVNLELFSNRLVGK 197

Query: 123 VLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQ 182
           + D S+ +L   L  L L   NLIG IP+SL NL  L  L L++N   G +P+ + +L +
Sbjct: 198 IPD-SIGDLKQ-LRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIE 255

Query: 183 LYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLN 242
           L  ++ E N+L G IP SF NLT+LS   LS N  T   P  +    NL    +S NS +
Sbjct: 256 LRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFS 315

Query: 243 GTIPSWLFTVLPYLEVIHLRDNRFTGSIP-STIFELVNLTSIRLSSNNLSGHIELCMFAR 301
           G  P  L  ++P LE I+L++N+FTG I  +       L  + L  N L G I   + +R
Sbjct: 316 GPFPKSLL-LIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESI-SR 373

Query: 302 LKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSEN 361
           L NL+ L +S N  +                 G     IS+  + L        L LS+N
Sbjct: 374 LLNLEELDISHNNFT-----------------GAIPPTISKLVNLLH-------LDLSKN 409

Query: 362 KIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRL 421
            + G +P   W +    L + + S    T  E+  ++ L   DL SN  QG         
Sbjct: 410 NLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEEL---DLNSNSFQGP-------- 458

Query: 422 IFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVD-SITLIWLDLHLNSFN 480
                        IP   C  + + F+DLSNN  SG IP C+ + S ++  L+L  N+F+
Sbjct: 459 -------------IPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFS 505

Query: 481 GSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPE 540
           G++P I +  + LV+L ++ NQ EG  P+SL NC  L+++NV +N+I D FP WL  LP 
Sbjct: 506 GTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPS 565

Query: 541 LLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTST 600
           L VL LRSNKFYG + +  A + F  LRI+D+S N F+G LP  YF N K M   +  + 
Sbjct: 566 LHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDM---TTLTE 622

Query: 601 VQVQYMHRFGRYYSAFF-----TLKGIDVEMN-ILSIFLVIDFSSNRFEGQIPEVVGKLN 654
              QYM  F RY  +++       KG+D+    I   F  IDFS N+  G IPE +G L 
Sbjct: 623 EMDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLK 682

Query: 655 LLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQL 714
            L++LN S N  T  IP  L NLT LE+LD+S N+L GQIP  L +L+FLS +N SHN L
Sbjct: 683 ELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLL 742

Query: 715 EGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNID--DAQEPAPRD----TWSWFDWK 768
           +GP+P+G QF   +  S++ N GL G  L D C +    +     P D      + F+W 
Sbjct: 743 QGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEENMFNWV 800

Query: 769 VAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVERKRIR 807
            A + Y  G++ G  IG+  + +    W      RK+ +
Sbjct: 801 AAAIAYGPGVLCGLVIGHF-YTSHNHEWFTEKFGRKQHK 838




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query816
225462116 1001 PREDICTED: receptor-like protein 12-like 0.960 0.783 0.454 0.0
359485824 973 PREDICTED: receptor-like protein 12-like 0.985 0.826 0.453 0.0
359493544 978 PREDICTED: receptor-like protein 12-like 0.954 0.796 0.443 1e-178
359493479814 PREDICTED: receptor-like protein 12-like 0.909 0.911 0.468 1e-177
225455498 980 PREDICTED: receptor-like protein 12-like 0.950 0.791 0.435 1e-177
224116970 921 predicted protein [Populus trichocarpa] 0.828 0.733 0.515 1e-174
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.990 0.804 0.432 1e-173
255568090 1014 serine/threonine-protein kinase bri1, pu 0.980 0.788 0.435 1e-172
225459979 979 PREDICTED: receptor-like protein 12-like 0.957 0.797 0.434 1e-171
147793123 951 hypothetical protein VITISV_032542 [Viti 0.927 0.796 0.436 1e-170
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/926 (45%), Positives = 542/926 (58%), Gaps = 142/926 (15%)

Query: 2   VTGQVIGLDLSCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLN 61
           VTG +IGLDLSCS L+G+I SNSSLFLLP+L  LNL  NDFN S IS+ FG+   +THLN
Sbjct: 83  VTGLIIGLDLSCSGLYGTIDSNSSLFLLPHLRRLNLAFNDFNKSSISAKFGQFRRMTHLN 142

Query: 62  LSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMST 121
           LS S FSG I  EIS LS ++SLDLS    + +E+  +  L  NLTKL++L L  +++S+
Sbjct: 143 LSFSGFSGVIAPEISHLSNLVSLDLSIYSGLGLETSSFIALARNLTKLQKLHLRGINVSS 202

Query: 122 IVL--------------------------DYSLTNL--------------------SSSL 135
           I+                           D  L NL                    S+S+
Sbjct: 203 ILPISLLNLSSLRSMDLSSCQLYGRFPDDDLQLPNLKVLKLKGNHDLSGNFPKFNESNSM 262

Query: 136 SYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNLEQNNLVG 195
             L L+  N  G +P+S+  L  L SL LS   FSG +PS +  LK L  L+L   N  G
Sbjct: 263 LLLDLSSTNFSGELPSSIGILKSLESLDLSSTKFSGELPSSIGSLKSLESLDLSHCNFSG 322

Query: 196 GIPD------------------------------------------------SFVNLTQL 207
            IP                                                 S  NLT+L
Sbjct: 323 SIPSVLGNLTQITHLDLSRNQFDGEISNVFNKIRKLIVLDLSSNSFRGQFIASLDNLTEL 382

Query: 208 SFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTV--------------- 252
           SFLDLS N L G +PS +K L +L  + LS N LNGTIPSWLF++               
Sbjct: 383 SFLDLSNNNLEGIIPSHVKELSSLSDIHLSNNLLNGTIPSWLFSLPSLIRLDLSHNKLNG 442

Query: 253 ------LPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQ 306
                  P LE I L  N   G +PS+IFELVNLT ++LSSNNL G +E  MF  L+NL 
Sbjct: 443 HIDEFQSPSLESIDLSSNELDGPVPSSIFELVNLTYLQLSSNNLGGIVETDMFMNLENLV 502

Query: 307 YLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGR 366
           YL LS N L+++    +N   P L  L LS+CNISEFP FL SQ+ LE+L LS NKIYG+
Sbjct: 503 YLDLSYNILTLSNYSHSNCALPFLETLLLSSCNISEFPRFLCSQEVLEFLDLSNNKIYGQ 562

Query: 367 IPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSI 426
           +P W W++G +TL   NLS N LT  E+ P KN+ FLDL SNLLQG +    P LI    
Sbjct: 563 LPKWAWNMGTETLSYFNLSQNLLTRFERFPWKNMLFLDLHSNLLQGPL----PSLI---- 614

Query: 427 SNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVD-SITLIWLDLHLNSFNGSIPQ 485
                        C  + I  +D SNN+LSG IP+CL + S +L  LDL +N  +G+IP+
Sbjct: 615 -------------CEMSYISVLDFSNNNLSGLIPQCLGNFSESLSVLDLRMNQLHGNIPE 661

Query: 486 ISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLI 545
             + G+ + NL  N NQ EGPLP+SL NC RLQVL++ NNRI+DTFP+WL  LPEL VLI
Sbjct: 662 TFSKGNFIRNLGFNGNQLEGPLPRSLINCRRLQVLDLGNNRINDTFPYWLETLPELQVLI 721

Query: 546 LRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTSTVQVQY 605
           LRSN+F+G I  ++ +  FPKLRI+DLSRN+F+G LP  Y +N KAMM  +    ++++Y
Sbjct: 722 LRSNRFHGHISGSNFQFPFPKLRIMDLSRNDFSGSLPEMYLKNFKAMMNVTE-DKMKLKY 780

Query: 606 MHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNH 665
           M  +    S   T+KG D E  ILS F  ID SSNRF+G+I + +G L+ L+ LN SHN+
Sbjct: 781 MGEYYYRDSIMGTIKGFDFEFVILSTFTTIDLSSNRFQGEILDFIGSLSSLRELNLSHNN 840

Query: 666 LTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFN 725
           LTG IPSSL NL VLESLDLSSN+L G+IP +LTSL FL  LNLS N L G IP+G QF+
Sbjct: 841 LTGHIPSSLGNLMVLESLDLSSNKLSGRIPRELTSLTFLEVLNLSKNHLTGVIPRGNQFD 900

Query: 726 TFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPR---DTWSWFDWKVAMMGYASGLVIGF 782
           TF ++SY GN+GLCG PLS KC  +D+A +P      ++ + FDWKV +MGY  GLV+G 
Sbjct: 901 TFANNSYSGNIGLCGLPLSKKCV-VDEAPQPPKEEEVESDTGFDWKVILMGYGCGLVVGL 959

Query: 783 SIGYMAFATGRPRWLVRMVERKRIRR 808
            +G + F T +P+W V M+E  R ++
Sbjct: 960 FMGCLVFLTRKPKWFVTMIEGDRHKK 985




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query816
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.969 0.888 0.374 4.6e-121
TAIR|locus:2829370915 RLP40 "receptor like protein 4 0.965 0.861 0.377 1.2e-120
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.962 0.882 0.378 1.1e-119
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.971 0.778 0.368 9.8e-119
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.963 0.889 0.382 9.8e-119
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.963 0.892 0.370 9.8e-119
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.973 0.798 0.374 2e-118
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.808 0.816 0.399 1.4e-112
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.941 0.888 0.365 5.9e-112
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.943 0.816 0.362 1.6e-111
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1191 (424.3 bits), Expect = 4.6e-121, P = 4.6e-121
 Identities = 312/834 (37%), Positives = 445/834 (53%)

Query:     3 TGQVIGLDL-SCSWLHGSIPSNSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLN 61
             TG V  L L  C  L G++ SNSSLF    L  ++L +N+  SS + SGFG L  L  L 
Sbjct:    72 TGAVAVLQLRKC--LSGTLKSNSSLFGFHQLRYVDLQNNNLTSSSLPSGFGNLKRLEGLF 129

Query:    62 LSNSYFSGQIPSEISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDMST 121
             LS++ F GQ+PS  S L+ +  LDLS N ++    P    L+  L KL  L LS    S 
Sbjct:   130 LSSNGFLGQVPSSFSNLTMLAQLDLSYN-KLTGSFP----LVRGLRKLIVLDLSYNHFSG 184

Query:   122 IVLDXXXXXXXXXXXXXXXXGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHXX 181
              +                    N    +P+   NL +L +L LS N FSG +PS +S+  
Sbjct:   185 TLNPNSSLFELHQLRYLNLAFNNFSSSLPSKFGNLHRLENLILSSNGFSGQVPSTISNLT 244

Query:   182 XXXXXXXXXXXXVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSL 241
                             P    NLT L  LDLS+N+  G +PS L  L  L  L L  N+L
Sbjct:   245 RLTKLYLDQNKLTSSFP-LVQNLTNLYELDLSYNKFFGVIPSSLLTLPFLAHLALRENNL 303

Query:   242 NGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFAR 301
              G++     +    LE+++L  N F G I   I +L+NL  + LS  N S  I+L +F+ 
Sbjct:   304 AGSVEVSNSSTSSRLEIMYLGSNHFEGQILEPISKLINLKHLDLSFLNTSYPIDLKLFSS 363

Query:   302 LKNLQYLYLSQNRLSVNTKLDANSTFPKLLK-LGLSACNISEFPDFLRSQDRLEWLQLSE 360
             LK+L+ L LS N +S +  L ++S  P  L+ L L  C+I+EFP+ L++   L ++ +S 
Sbjct:   364 LKSLRSLDLSGNSIS-SASLSSDSYIPLTLEMLTLRHCDINEFPNILKTLKELVYIDISN 422

Query:   361 NKIYGRIPNWFWDIGKDTLYNLNLSDNFLT----DVEQVPLKNLRFLDLRSNLLQGSVMV 416
             N++ G+IP W W +    L ++ L +N+ T      E +   ++  L L SN  +G++  
Sbjct:   423 NRMKGKIPEWLWSL--PLLQSVTLGNNYFTGFQGSAEILVNSSVLLLYLDSNNFEGALPD 480

Query:   417 LPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHL 476
             LP  +  F +++N  T EIP S C  + +  IDLS N+ +GPIP CL  ++ L++L    
Sbjct:   481 LPLSIKGFGVASNSFTSEIPLSICNRSSLAAIDLSYNNFTGPIPPCL-RNLELVYL--RN 537

Query:   477 NSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLA 536
             N+  GSIP    +G+ L  L ++ N+  G LP+S  NCS L+ L+V NNRI+DTFP WL 
Sbjct:   538 NNLEGSIPDALCDGASLRTLDVSHNRLTGKLPRSFVNCSSLKFLSVINNRIEDTFPFWLK 597

Query:   537 QLPELLVLILRSNKFYGLIGNTDARVI-FPKLRILDLSRNEFTGVLPTRYFQNLKAMMRG 595
              LP L VL LRSN+FYG I       + FP+LRI ++S N+FTG LP  YF N KA  R 
Sbjct:   598 ALPNLQVLTLRSNRFYGPISPPHQGPLGFPELRIFEISDNKFTGSLPPNYFVNWKASSRT 657

Query:   596 SNTST-VQVQYMHRF---GRY-YSAFFTL--KGIDVEM-NILSIFLVIDFSSNRFEGQIP 647
              N    + + Y  +    G Y Y+    L  KG+ +E    L+ +  IDFS NR EGQIP
Sbjct:   658 MNQDGGLYMVYEEKLFDEGGYGYTDALDLQYKGLHMEQAKALTSYAAIDFSGNRLEGQIP 717

Query:   648 EVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKL 707
             E +G L  L  +N S+N  TG IP S+ NL  LESLD+S N+L G IP  L S++FL+ +
Sbjct:   718 ESIGLLKALIAVNISNNAFTGHIPLSMANLENLESLDMSRNQLSGTIPNGLGSISFLAYI 777

Query:   708 NLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKCSNID------------DAQE 755
             N+SHNQL G IPQG Q       S+ GN GLCG PL + C                + +E
Sbjct:   778 NVSHNQLTGEIPQGTQITGQSKSSFEGNAGLCGLPLKESCFGTGAPPMYHQKQEDKEEEE 837

Query:   756 PAPRDTWSWFDWKVAMMGYASGLVIGFSIGYMAFATGRPRWLVRMVE-RKRIRR 808
                 +     + +   +GY SGL++G +I  +  A+ +P WLV+++   KR +R
Sbjct:   838 EEEEEEEEVLNGRAVAIGYGSGLLLGLAIAQV-IASYKPEWLVKIIGLNKRRKR 890




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query816
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-73
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-63
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  256 bits (656), Expect = 7e-73
 Identities = 209/682 (30%), Positives = 310/682 (45%), Gaps = 92/682 (13%)

Query: 130 NLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHL-KQLYYLNL 188
           N SS +  + L+G N+ G I +++  LP + +++LS N  SG IP  +      L YLNL
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNL 125

Query: 189 EQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSW 248
             NN  G IP   +    L  LDLS N L+G +P+ +    +L  L L GN L G IP+ 
Sbjct: 126 SNNNFTGSIPRGSIPN--LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS 183

Query: 249 LFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYL 308
           L T L  LE + L  N+  G IP  + ++ +L  I L  NNLSG I       L +L +L
Sbjct: 184 L-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY-EIGGLTSLNHL 241

Query: 309 YLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIP 368
            L  N L+                           P  L +   L++L L +NK+ G IP
Sbjct: 242 DLVYNNLT------------------------GPIPSSLGNLKNLQYLFLYQNKLSGPIP 277

Query: 369 NWFWDIGKDTLYNLNLSDNFLTDVEQVP-----LKNLRFLDLRSNLLQGSVMVLP---PR 420
              + + K  L +L+LSDN L+   ++P     L+NL  L L SN   G + V     PR
Sbjct: 278 PSIFSLQK--LISLDLSDNSLSG--EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPR 333

Query: 421 LIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFN 480
           L    + +NK +GEIP +      +  +DLS N+L+G IPE L  S  L  L L  NS  
Sbjct: 334 LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLE 393

Query: 481 GSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPHWLAQLPE 540
           G IP+       L  + L DN F G LP        +  L+++NN +          +P 
Sbjct: 394 GEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS 453

Query: 541 LLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTST 600
           L +L L  NKF+G + ++       +L  LDLSRN+F+G +P +   +L  +M+      
Sbjct: 454 LQMLSLARNKFFGGLPDSFGS---KRLENLDLSRNQFSGAVPRK-LGSLSELMQ------ 503

Query: 601 VQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLN 660
                                             +  S N+  G+IP+ +     L  L+
Sbjct: 504 ----------------------------------LKLSENKLSGEIPDELSSCKKLVSLD 529

Query: 661 FSHNHLTGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQ 720
            SHN L+G+IP+S   + VL  LDLS N+L G+IP  L ++  L ++N+SHN L G +P 
Sbjct: 530 LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS 589

Query: 721 GPQFNTFQSDSYIGNLGLCGFPLSDKCSNIDDAQEPAPRDTWSWFDWKVAMMGYASGLVI 780
              F    + +  GN+ LCG    D  S +   +      +W WF     +  +    ++
Sbjct: 590 TGAFLAINASAVAGNIDLCG---GDTTSGLPPCKRVRKTPSW-WFYITCTLGAFLVLALV 645

Query: 781 GFSIGYMAFATGRPRWLVRMVE 802
            F      F  GR    ++ VE
Sbjct: 646 AFGF---VFIRGRNNLELKRVE 664


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 816
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
PLN03150623 hypothetical protein; Provisional 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.45
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.21
KOG4341483 consensus F-box protein containing LRR [General fu 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.38
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.68
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.46
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.76
KOG4308478 consensus LRR-containing protein [Function unknown 94.93
KOG4308478 consensus LRR-containing protein [Function unknown 92.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.63
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.87
smart0037026 LRR Leucine-rich repeats, outliers. 89.87
smart0037026 LRR Leucine-rich repeats, outliers. 86.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.67
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.91
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.8e-64  Score=608.74  Aligned_cols=543  Identities=35%  Similarity=0.555  Sum_probs=385.0

Q ss_pred             CCCCCEEeCCCCCCCCCCCCccccCCCCCCEEECCCCCCCccCchhhh-cCCCCCEEeCCCCCCccccCCcHHHHhhcCC
Q 003488           29 LPYLETLNLGSNDFNSSLISSGFGRLISLTHLNLSNSYFSGQIPSEIS-QLSKMLSLDLSKNDEVRIESPVWKGLIENLT  107 (816)
Q Consensus        29 l~~L~~L~Ls~~~~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~l~-~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~l~  107 (816)
                      ..+++.|+|+++.+++. ++..|..+++|++|+|++|.+++.+|..+. .+++|++|++++|.+.....           
T Consensus        68 ~~~v~~L~L~~~~i~~~-~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p-----------  135 (968)
T PLN00113         68 SSRVVSIDLSGKNISGK-ISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP-----------  135 (968)
T ss_pred             CCcEEEEEecCCCcccc-CChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccC-----------
Confidence            45789999999988876 678899999999999999999888887665 78888888888875542111           


Q ss_pred             CCCEEeCCCccCCCccchhhhhccCCCCcEEEccCCcCCCCCCccCCCCCCCCEEEccCCCCCCCchhhhcCCCCCCEEE
Q 003488          108 KLKELVLSEVDMSTIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLN  187 (816)
Q Consensus       108 ~L~~L~l~~~~~~~~~~~~~~~~l~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~  187 (816)
                                       .   ..+ ++|++|++++|.+.+.+|..++++++|++|++++|.+.+..|..+.++++|++|+
T Consensus       136 -----------------~---~~l-~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  194 (968)
T PLN00113        136 -----------------R---GSI-PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLT  194 (968)
T ss_pred             -----------------c---ccc-CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeee
Confidence                             0   112 5566666666666666666666666677777766666666666666666677777


Q ss_pred             ccCCcCCCCCCccccCCCCccEEEcccCCCCcCCcccCCCCCCCcEEECcCCCCCcccchhhhhCCCCccEEEccCCcCC
Q 003488          188 LEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSWLFTVLPYLEVIHLRDNRFT  267 (816)
Q Consensus       188 L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~  267 (816)
                      +++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+.. +++|++|++++|.+.
T Consensus       195 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~  273 (968)
T PLN00113        195 LASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGN-LKNLQYLFLYQNKLS  273 (968)
T ss_pred             ccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhC-CCCCCEEECcCCeee
Confidence            7666666666666666666666666666666666666666666666666666666555555443 666666666666666


Q ss_pred             ccCchhhhcCCCCCEEEcccCCCcCccccccccCCCccceeeCCCccccccccCCCCCCCcCccEEeccCCCCCCCCccc
Q 003488          268 GSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFL  347 (816)
Q Consensus       268 ~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~~~~L~~L~l~~~~l~~lp~~l  347 (816)
                      +.+|..+..+++|++|++++|.+.+.++ ..+.++++|+.|++++|.+.                        ..+|..+
T Consensus       274 ~~~p~~l~~l~~L~~L~Ls~n~l~~~~p-~~~~~l~~L~~L~l~~n~~~------------------------~~~~~~~  328 (968)
T PLN00113        274 GPIPPSIFSLQKLISLDLSDNSLSGEIP-ELVIQLQNLEILHLFSNNFT------------------------GKIPVAL  328 (968)
T ss_pred             ccCchhHhhccCcCEEECcCCeeccCCC-hhHcCCCCCcEEECCCCccC------------------------CcCChhH
Confidence            6666666666666666666665554443 22333333443333333221                        0122333


Q ss_pred             cCCcccceeecccccccCCCCchhhccCCCccceEEcCCCcCCCCCCCCCCCCCEEecCCCcCCCcCCCCCCCccEEEcc
Q 003488          348 RSQDRLEWLQLSENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSVMVLPPRLIFFSIS  427 (816)
Q Consensus       348 ~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~  427 (816)
                      ..+++|+.|++++|.+.+.                                                             
T Consensus       329 ~~l~~L~~L~L~~n~l~~~-------------------------------------------------------------  347 (968)
T PLN00113        329 TSLPRLQVLQLWSNKFSGE-------------------------------------------------------------  347 (968)
T ss_pred             hcCCCCCEEECcCCCCcCc-------------------------------------------------------------
Confidence            3344444444444444433                                                             


Q ss_pred             CCcccccccccccCCCCCCeEeCCCCCCCCCCCchhhccCCCCEEEccCCcCccCCCccccCCCCccEEEccCCcccCCC
Q 003488          428 NNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPL  507 (816)
Q Consensus       428 ~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~  507 (816)
                             +|..+..+++|+.|++++|++.+.+|..+..+.+|+.|++++|.+.+.+|..+..+++|+.|++++|.+++..
T Consensus       348 -------~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~  420 (968)
T PLN00113        348 -------IPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL  420 (968)
T ss_pred             -------CChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeEC
Confidence                   3344444455556666666665555655555566666666666666666666666666666666666666666


Q ss_pred             CcccCCCCCCcEEECcCCcCCCCCcccccCCCCCcEEEccCcccccccCCCcccccCCCCceeeCCCCcccccCchHHHh
Q 003488          508 PQSLANCSRLQVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQ  587 (816)
Q Consensus       508 ~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~  587 (816)
                      |..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|++.+..|..   ...++|+.||+++|++++.+|..+. 
T Consensus       421 p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~---~~~~~L~~L~ls~n~l~~~~~~~~~-  496 (968)
T PLN00113        421 PSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS---FGSKRLENLDLSRNQFSGAVPRKLG-  496 (968)
T ss_pred             ChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcc---cccccceEEECcCCccCCccChhhh-
Confidence            666777777777777777777777766667777777777777776665422   2357889999999999988875431 


Q ss_pred             hhhhhhccCCCcccceeeccccccceeeEEEeecceecccccccceEEEccCCcccccCchhhhCCCCCcEEEccCCcCc
Q 003488          588 NLKAMMRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLT  667 (816)
Q Consensus       588 ~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~  667 (816)
                                                              .++.|+.|+|++|++++.+|..++++++|++|+|++|.++
T Consensus       497 ----------------------------------------~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  536 (968)
T PLN00113        497 ----------------------------------------SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLS  536 (968)
T ss_pred             ----------------------------------------hhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCccc
Confidence                                                    4667889999999999999999999999999999999999


Q ss_pred             ccCCccccccCCCCeEeCCCCcccccCccccCCcCcCCeEeCccCccccCCCCCCCCCccccccccCccCCCCCC
Q 003488          668 GRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFP  742 (816)
Q Consensus       668 ~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lcg~~  742 (816)
                      |.+|..++++++|+.|||++|+++|.+|..+..+++|+.|++++|+++|.+|..+++.++...+|.||+.+||.+
T Consensus       537 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        537 GQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query816
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-48
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-15
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-48
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-15
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-06
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 8e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-05
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 4e-05
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 5e-05
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 7e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 3e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 3e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 6e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 6e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 7e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 7e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 8e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 8e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 9e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 9e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 9e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 189 bits (481), Expect = 4e-48, Method: Compositional matrix adjust. Identities = 201/677 (29%), Positives = 293/677 (43%), Gaps = 123/677 (18%) Query: 158 QLTSLSLSYNHFSGHIPSFLSHXXXXXXXXXXXXXXVGGIPDSFVNLTQLSFLDLSWNQL 217 LTSL LS N SG + + S + + L FL++S N L Sbjct: 101 SLTSLDLSRNSLSGPVTTLTS----------------------LGSCSGLKFLNVSSNTL 138 Query: 218 T--GRLPSCLKGLRNLVTLRLSGNSLNGT-IPSWLFT-VLPYLEVIHLRDNRFTGSIPST 273 G++ LK L +L L LS NS++G + W+ + L+ + + N+ +G + Sbjct: 139 DFPGKVSGGLK-LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--D 195 Query: 274 IFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKL 333 + VNL + +SSNN S I LQ+L +S N+LS + A ST +L L Sbjct: 196 VSRCVNLEFLDVSSNNFSTGIPF--LGDCSALQHLDISGNKLSGDFS-RAISTCTELKLL 252 Query: 334 GLSACNI-----------------------SEFPDFLRSQ-DRLEWLQLSENKIYGRIPN 369 +S+ E PDFL D L L LS N YG +P Sbjct: 253 NISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP 312 Query: 370 WFW-----------------DIGKDTLYN------LNLSDNFLTDVEQVPLKNLRF---- 402 +F ++ DTL L+LS N + L NL Sbjct: 313 FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 372 Query: 403 LDLRSNLLQGSVM---VLPPR--LIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSG 457 LDL SN G ++ P+ L + NN TG+IP + + + + LS N LSG Sbjct: 373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 432 Query: 458 PIPECLVDSITLIWLDLHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRL 517 IP L L L L LN G IPQ L LIL+ N G +P L+NC+ L Sbjct: 433 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 492 Query: 518 QVLNVANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNT--DARVIFPKLRILDLSRN 575 ++++NNR+ P W+ +L L +L L +N F G I D R L LDL+ N Sbjct: 493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCR----SLIWLDLNTN 548 Query: 576 EFTGVLPTRYFQNLKAM----MRGSNTSTVQVQYMHRFGRYYSAFFTLKGIDVE-MNILS 630 F G +P F+ + + G ++ M + +GI E +N LS Sbjct: 549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 608 Query: 631 I------------------------FLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHL 666 + +D S N G IP+ +G + L +LN HN + Sbjct: 609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI 668 Query: 667 TGRIPSSLRNLTVLESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNT 726 +G IP + +L L LDLSSN+L G+IP +++L L++++LS+N L GPIP+ QF T Sbjct: 669 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFET 728 Query: 727 FQSDSYIGNLGLCGFPL 743 F ++ N GLCG+PL Sbjct: 729 FPPAKFLNNPGLCGYPL 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query816
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-102
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-83
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-78
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-38
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-71
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-64
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-64
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-57
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-52
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-43
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-37
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-38
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-40
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-38
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-34
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-34
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-32
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-29
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-32
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-18
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-18
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  569 bits (1470), Expect = 0.0
 Identities = 217/790 (27%), Positives = 326/790 (41%), Gaps = 120/790 (15%)

Query: 3   TGQVIGLDLSCSWLHGSIPS-NSSLFLLPYLETLNLGSNDFNSSLISSGFGRLISLTHLN 61
             +V  +DLS   L+    + +SSL  L  LE+L L ++  N S+  SGF    SLT L+
Sbjct: 49  DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSV--SGFKCSASLTSLD 106

Query: 62  LSNSYFSGQIPS--EISQLSKMLSLDLSKNDEVRIESPVWKGLIENLTKLKELVLSEVDM 119
           LS +  SG + +   +   S +  L++S N    ++ P        L  L+ L LS   +
Sbjct: 107 LSRNSLSGPVTTLTSLGSCSGLKFLNVSSNT---LDFPGKVSGGLKLNSLEVLDLSANSI 163

Query: 120 S-TIVLDYSLTNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLS 178
           S   V+ + L++    L +L ++G  + G +   ++    L  L +S N+FS  IP  L 
Sbjct: 164 SGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LG 220

Query: 179 HLKQLYYLNLEQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSG 238
               L +L++  N L G    +    T+L  L++S NQ  G +P     L++L  L L+ 
Sbjct: 221 DCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAE 278

Query: 239 NSLNGTIPSWLFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCM 298
           N   G IP +L      L  + L  N F G++P        L S+ LSSNN SG + +  
Sbjct: 279 NKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDT 338

Query: 299 FARLKNLQYLYLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQL 358
             +++ L+ L LS N  S                                          
Sbjct: 339 LLKMRGLKVLDLSFNEFS------------------------------------------ 356

Query: 359 SENKIYGRIPNWFWDIGKDTLYNLNLSDNFLTDVEQVPLKNLRFLDLRSNLLQGSV---- 414
                 G +P              NLS             +L  LDL SN   G +    
Sbjct: 357 ------GELPESLT----------NLS------------ASLLTLDLSSNNFSGPILPNL 388

Query: 415 -MVLPPRLIFFSISNNKLTGEIPCSFCTAAPIEFIDLSNNSLSGPIPECLVDSITLIWLD 473
                  L    + NN  TG+IP +    + +  + LS N LSG IP  L     L  L 
Sbjct: 389 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 448

Query: 474 LHLNSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLNVANNRIDDTFPH 533
           L LN   G IPQ       L  LIL+ N   G +P  L+NC+ L  ++++NNR+    P 
Sbjct: 449 LWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK 508

Query: 534 WLAQLPELLVLILRSNKFYGLIGNTDARVIFPKLRILDLSRNEFTGVLPTRYFQNLKAMM 593
           W+ +L  L +L L +N F G I           L  LDL+ N F G +P   F+    + 
Sbjct: 509 WIGRLENLAILKLSNNSFSGNIPAELGD--CRSLIWLDLNTNLFNGTIPAAMFKQSGKIA 566

Query: 594 RGSNTSTVQVQ---------------YMHRFGRYYSAFFTLKG--------------IDV 624
                    V                 +   G        L                   
Sbjct: 567 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP 626

Query: 625 EMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVLESLD 684
             +     + +D S N   G IP+ +G +  L +LN  HN ++G IP  + +L  L  LD
Sbjct: 627 TFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILD 686

Query: 685 LSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLS 744
           LSSN+L G+IP  +++L  L++++LS+N L GPIP+  QF TF    ++ N GLCG+PL 
Sbjct: 687 LSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP 746

Query: 745 DKCSNIDDAQ 754
               +  D  
Sbjct: 747 RCDPSNADGY 756


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 816
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 58/285 (20%), Positives = 100/285 (35%), Gaps = 12/285 (4%)

Query: 129 TNLSSSLSYLHLTGCNLIGPIPASLANLPQLTSLSLSYNHFSGHIPSFLSHLKQLYYLNL 188
            +L    + L L    +         NL  L +L L  N  S   P   + L +L  L L
Sbjct: 27  KDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYL 86

Query: 189 EQNNLVGGIPDSFVNLTQLSFLDLSWNQLTGRLPSCLKGLRNLVTLRLSGNSLNGTIPSW 248
            +N L          L +L   +    ++   + + L     +V L  +    +G     
Sbjct: 87  SKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLN-QMIVVELGTNPLKSSGIENGA 145

Query: 249 LFTVLPYLEVIHLRDNRFTGSIPSTIFELVNLTSIRLSSNNLSGHIELCMFARLKNLQYL 308
            F  +  L  I + D   T +IP  +    +LT + L  N ++          L NL  L
Sbjct: 146 -FQGMKKLSYIRIADTNIT-TIPQGLPP--SLTELHLDGNKITKVDA-ASLKGLNNLAKL 200

Query: 309 YLSQNRLSVNTKLDANSTFPKLLKLGLSACNISEFPDFLRSQDRLEWLQLSENKIYGRIP 368
            LS           + +  P L +L L+   + + P  L     ++ + L  N I     
Sbjct: 201 GLS-FNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGS 259

Query: 369 NWFWDIGKDT----LYNLNLSDNFLTDVEQVPLKNLRFLDLRSNL 409
           N F   G +T       ++L  N +   E +     R + +R+ +
Sbjct: 260 NDFCPPGYNTKKASYSGVSLFSNPVQYWE-IQPSTFRCVYVRAAV 303


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query816
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.98
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.96
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.96
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.94
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.93
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.93
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.92
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.89
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.8
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.79
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.75
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.74
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.51
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=241.65  Aligned_cols=257  Identities=32%  Similarity=0.518  Sum_probs=164.3

Q ss_pred             CCEEECCCCCCCC--CCCCHHHCCCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             8947488997999--9980011358887998558-848557783555998964898458825577870257999996998
Q 003488          445 IEFIDLSNNSLSG--PIPECLVDSITLIWLDLHL-NSFNGSIPQISANGSGLVNLILNDNQFEGPLPQSLANCSRLQVLN  521 (816)
Q Consensus       445 L~~L~ls~n~l~~--~~p~~~~~~~~L~~L~l~~-n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~  521 (816)
                      ++.|+++++.+.+  .+|..+.++++|++|++++ |.+.|.+|..+.++++|++|++++|++.+..+..+..+..|+.++
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~  131 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD  131 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE
T ss_pred             EEEEECCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCC
T ss_conf             88998989988888879847846753352020265433300243114542001102035643443322222011100111


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC-CCEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             768967889851114899984998667314223589954236787-8556178873555684688764545331678864
Q 003488          522 VANNRIDDTFPHWLAQLPELLVLILRSNKFYGLIGNTDARVIFPK-LRILDLSRNEFTGVLPTRYFQNLKAMMRGSNTST  600 (816)
Q Consensus       522 l~~n~l~~~~~~~~~~l~~L~~L~L~~N~~~~~~~~~~~~~~l~~-L~~L~Ls~N~l~~~~p~~~~~~l~~l~~~~~~~~  600 (816)
                      ++.|.+.+.+|..+.+++.++++++++|.+.+.+|  ..+..+.. ++.+++++|++++..|..+ .             
T Consensus       132 l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip--~~~~~l~~l~~~l~~~~n~l~~~~~~~~-~-------------  195 (313)
T d1ogqa_         132 FSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP--DSYGSFSKLFTSMTISRNRLTGKIPPTF-A-------------  195 (313)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECC--GGGGCCCTTCCEEECCSSEEEEECCGGG-G-------------
T ss_pred             CCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-------------
T ss_conf             12245555685122067400000023553356203--1214431123231022464353324332-2-------------


Q ss_pred             CCEEECCCCCCCEEEEEEEECCEECCCCCCCCEEEECCCCCCCCCCCHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             20110023443101279750440012122332089836883544584432177889689735785866688241166877
Q 003488          601 VQVQYMHRFGRYYSAFFTLKGIDVEMNILSIFLVIDFSSNRFEGQIPEVVGKLNLLKMLNFSHNHLTGRIPSSLRNLTVL  680 (816)
Q Consensus       601 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~LdLs~n~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~ip~~l~~l~~L  680 (816)
                                                 .+ ....++++++...+.+|..++.++.++.+++++|.+.+.+| .++.+++|
T Consensus       196 ---------------------------~l-~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L  246 (313)
T d1ogqa_         196 ---------------------------NL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNL  246 (313)
T ss_dssp             ---------------------------GC-CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTC
T ss_pred             ---------------------------CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC
T ss_conf             ---------------------------22-22233333343322222222222221112222222222222-22245544


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9574888725355864667867679385746856037999997886564533575699899999999
Q 003488          681 ESLDLSSNRLVGQIPTQLTSLNFLSKLNLSHNQLEGPIPQGPQFNTFQSDSYIGNLGLCGFPLSDKC  747 (816)
Q Consensus       681 ~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lcg~~~~~~c  747 (816)
                      +.|+|++|+++|.+|..+.++++|++|++++|+++|.+|...++..++...+.||+.+||.|+. .|
T Consensus       247 ~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         247 NGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             CEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             CCCCCCCCEECCCCCHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCC-CC
T ss_conf             4444765706660876884799999897958835166898666799897886889500198988-98



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure