Citrus Sinensis ID: 003520

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810---

MELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHDRRGRDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLSDNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS

ccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHccccccEEEcccccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHccccccccccccHHHHHHHHHHHcccccccHHcHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

cccccHEEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHcccEEEEEEEcccccccccccEEEccccHHHHHHHHHHHccccccccEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHcccccHHHccHHcccccccccccccccHHcccccccccccccccccccccccccccccccHHccccccHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHcccccccccccHHHHcHHcccccHHHHHHHHHHHHHHccccHHHHHcccccHHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc

MELFPRLLLVICSagdschacGAISIMLLmcglprypapypsmvrpafpprppgpvgvlpsvarppvpgipgvrpimppvvrpvplptvtpaekpqtkvyvgkiaptadsDFVLSVLKVCGTvkswkraqypsngtpkgfgfcefESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKEtqdagagkedesvqsvekneptkspenlkdnetgnkeshdptnfgvvteeDRKADQEALEKLTCMVEerlktnplpppppqttadgsgisnselpakardgdsdvDMIRNDiaedklddettsdtkasdhdrpetsspdrsrvhdrrgrdkerDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEilydeeededdsRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLsdnavngslaeesaveskgmdvehdyhddsirenhmagdpssqngngdestnvpiaasdmrqsgnvparklgfglvgsgkrtavpsvfhveddddadkdkkmrplvpidysteelqaaqphvsganppnLAAAAEFAKRISnvnskeeksdAERERSRrlhdrssqrekdrsdednnrtrdeHKEKILdrdrdrehgldkvktpdnkklldAKQLIDMIPKTKEELFSYEINWAvydkhelhermrpwISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS

MELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPtvtpaekpqtkvYVGKiaptadsdfVLSVLKVCGTVKswkraqypsngtpkgFGFCEFESAEGVLRALRLLNKFnidgqelmlkVDQATREYLERyvdkktentkklketqdagagkedesvqsvekneptkspenlkdnetgnkeshdptnfgvvteEDRKADQEALEKLTCMVEErlktnplpppppqttadgsgisnselpakardgdsdVDMIRNDiaedklddettsdtkasdhdrpetsspdrsrvhdrrgrdkerdlkrekereidryereaerervrkereqrrkieeaereyerclkdweyrererekerqyekekekererkrkkeilydeeededdsrkrwrrsvleekrrkrirekeedladevreeEEIAVAKRRAEEEQLQQQQRDALKLLSDNAVNGSLAeesaveskgMDVEHDYHDDSIRENHMagdpssqngngdESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPsvfhveddddadkdkkMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRisnvnskeeksdaerersrrlhdrssqrekdrsdednnrtrdehkekildrdrdrehgldkvktpdnkklldakqlIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKkvetglalrsks

MELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYpsmvrpafpprppgpvgvlpsvaRppvpgipgvrpimppvvrpvplptvtpAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDkktentkklketQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNplpppppQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHdrrgrdkerdlkrekereidryereaerervrkereqrrkieeaereYERCLKDWeyrererekerqyekekekererkrkkeILYdeeededdSRKRWRRSVLeekrrkrirekeedladevreeeeiavakrraeeeqlqqqqrdalklLSDNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEddddadkdkkMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS

**LFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYP**********************************IM*PVVRPV************TKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYV*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************GFGLV***************************************************************************************************************************************AKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGL******

**LFPRLLL*****************************************************************************************VYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQ*P*NGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATRE**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************ELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVK**QMLELLQTILDDEAEMFVLKMWRMLIFEIKKVE**L******

MELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKL*****************************LKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKL********************************************EIDRY************************EYERCLKDWEYR*********************RKKEILY************WRRSVLEEKRRKRIRE************EEIAVAK*************DALKLLSDNAVNGS*************VEHDYHDDSIRENHM************ESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISN*****************************************KEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS

*ELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPP**************KPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTE*****************ESVQSVEKNEPTKSPENLKDNETGNKESHDPTNF*********A***A**KLTCMVEERLKT*******************************************************************************************************RKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLSDNA***************************************************************************************************************************************************************************************LDRDRDREHG*****TPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVET********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MELFPRLLLVICSAGDSCHACGAISIMLLMCGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHDRRGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDSRKRWRRSVLEEKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		813	2.2.26 [Sep-21-2011]
P49756		843	RNA-binding protein 25 OS	yes	no	0.099	0.096	0.451	7e-24
B2RY56		838	RNA-binding protein 25 OS	yes	no	0.099	0.096	0.451	8e-24
Q8IDX6		3130	Reticulocyte-binding prot	no	no	0.153	0.039	0.280	1e-05

>sp\|P49756\|RBM25_HUMAN RNA-binding protein 25 OS=Homo sapiens GN=RBM25 PE=1 SV=3	Back alignment and function desciption

 Score =  113 bits (282), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 72/104 (69%)

Query: 705 KQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSST 764
           K LI+ IP  K ELF+Y ++W++ D   +  R+RPWI+KKI E++GEEE TLVD++ S  
Sbjct: 739 KSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKV 798

Query: 765 QDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLA 808
             H     +L+ +  +LD+EAE+F++KMWR+LI+E +  + GL 
Sbjct: 799 MAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLV 842

RNA-binding protein that acts as a regulator of alternative pre-mRNA splicing. Involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression. Modulates the ratio of proapoptotic BCL2L1 isoform S to antiapoptotic BCL2L1 isoform L mRNA expression. When overexpressed, stimulates proapoptotic BCL2L1 isoform S 5'-splice site (5'-ss) selection, whereas its depletion caused the accumulation of antiapoptotic BCL2L1 isoform L. Promotes BCL2L1 isoform S 5'-ss usage through the 5'-CGGGCA-3' RNA sequence. Its association with LUC7L3 promotes U1 snRNP binding to a weak 5' ss in a 5'-CGGGCA-3'-dependent manner. Binds to the exonic splicing enhancer 5'-CGGGCA-3' RNA sequence located within exon 2 of the BCL2L1 pre-mRNA.
Homo sapiens (taxid: 9606)

>sp\|B2RY56\|RBM25_MOUSE RNA-binding protein 25 OS=Mus musculus GN=Rbm25 PE=1 SV=2	Back alignment and function description

>sp\|Q8IDX6\|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		813
225424679		958	PREDICTED: uncharacterized protein LOC10	0.947	0.803	0.677	0.0
255568764		948	conserved hypothetical protein [Ricinus	0.942	0.808	0.734	0.0
296086551		828	unnamed protein product [Vitis vinifera]	0.949	0.932	0.680	0.0
224111298		894	predicted protein [Populus trichocarpa]	0.944	0.859	0.697	0.0
357485911		771	RNA-binding protein [Medicago truncatula	0.934	0.985	0.645	0.0
356497763		927	PREDICTED: uncharacterized protein LOC10	0.947	0.830	0.678	0.0
356501735		765	PREDICTED: uncharacterized protein LOC10	0.928	0.986	0.667	0.0
449513686		968	PREDICTED: uncharacterized LOC101214372	0.953	0.800	0.670	0.0
449434915		770	PREDICTED: uncharacterized protein LOC10	0.937	0.989	0.673	0.0
307135981		770	RNA binding motif protein [Cucumis melo	0.921	0.972	0.676	0.0

>gi\|225424679\|ref\|XP_002264457.1\| PREDICTED: uncharacterized protein LOC100263874 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/799 (67%), Positives = 643/799 (80%), Gaps = 29/799 (3%)

Query: 32  GLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTP 91
           G+PRYP+PY +MVRPAFPPRPPG +G+LP+++RPPVPG+PGVRPIMPPVVRP  +P   P
Sbjct: 172 GVPRYPSPYATMVRPAFPPRPPGAIGMLPALSRPPVPGMPGVRPIMPPVVRPAIVPVAAP 231

Query: 92  AEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGV 151
            EKPQT VYVGKIA T ++DF+LS+L+VCG VKSWK AQYP +GTP+G GFCEFES EGV
Sbjct: 232 TEKPQTTVYVGKIASTVENDFILSLLQVCGPVKSWKHAQYPIDGTPRGLGFCEFESPEGV 291

Query: 152 LRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQS 211
           LRALRLL KFN+DGQEL+L V+QATREYLERYV+KKTEN+KK +E+   G+ KE ESV  
Sbjct: 292 LRALRLLTKFNVDGQELVLNVNQATREYLERYVEKKTENSKKPQESDIEGSEKEQESVPG 351

Query: 212 VEKNEPTKSPENLKD-----NETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERL 266
           VE+NE  K   +L+D     NE  NKE+ D  +FG+VT+EDR+AD+EALEKLT M+EER+
Sbjct: 352 VEQNEILKP--SLEDSKKDGNELVNKENQDNASFGIVTDEDREADREALEKLTSMMEERI 409

Query: 267 KTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKA-SD 325
           KT PLPPPP Q  ADGS  +NSELP K+R  DSDVD++RND AE   DDETTS+ K  SD
Sbjct: 410 KTKPLPPPPAQGAADGSENTNSELPTKSR--DSDVDVMRNDAAE---DDETTSENKPKSD 464

Query: 326 HDRPETSSP--DRSRVHDRRGRDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEE 383
            +R E SSP   R      R RD++R+LKREKERE DR ERE ERERVR+E+E+  KIE 
Sbjct: 465 QERLERSSPDRSRRYDRRSRERDRDRELKREKEREFDRLERERERERVRREKEREIKIER 524

Query: 384 AEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEILYDEEED--EDDSRKRWRR 441
           AE  Y   +K+WEYRERE+E +RQ+EKE+EKERER+R++EI   E ++  +D  ++R R 
Sbjct: 525 AENLYRERVKEWEYREREKEYQRQHEKEREKERERERRREISNQERDNDEDDSRKRRRRS 584

Query: 442 SVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAE---EEQLQQQQRDALKLLSDNAVN 498
           S +EEKR+KR REKEEDLAD ++E EEIA   RRA    ++Q Q+QQ +A+KLL+ +A  
Sbjct: 585 SEVEEKRKKRQREKEEDLADRLKEVEEIAETNRRASEEEQQQQQEQQNNAVKLLALHATT 644

Query: 499 GS----LAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQ 554
           GS    L +E+  ++K   VE  Y  DS  +NH+ GD   QNG GDES    +AASD+RQ
Sbjct: 645 GSEKEVLTDETDAQNKDKAVEQAYEGDSSHQNHI-GDGILQNGTGDESAMASLAASDVRQ 703

Query: 555 SGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHV 614
           S N+PARKLGFGLVGSGKRTAV SVFH E+DDDA K+KKMRPLVPIDYSTEELQA QP +
Sbjct: 704 SSNLPARKLGFGLVGSGKRTAVLSVFHEEEDDDAHKEKKMRPLVPIDYSTEELQAVQPTI 763

Query: 615 SGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDE 674
           SG +P NL AAAEFAKRI+NV  K++KSD E+ER+RR +DRSS R  DR+DED NR RDE
Sbjct: 764 SGPSPSNLVAAAEFAKRITNV--KDDKSDIEKERNRRAYDRSSHR--DRNDEDINRARDE 819

Query: 675 HKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELH 734
           ++EK LDRDRDREHG +K++TPDNKKLLDAKQLIDMIPKTKEELFSYEINW VYDKHELH
Sbjct: 820 NREKFLDRDRDREHGPEKLRTPDNKKLLDAKQLIDMIPKTKEELFSYEINWGVYDKHELH 879

Query: 735 ERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWR 794
           ERMRPWISKKITEFLGEEE TLVDYIVSSTQ+HVKASQMLELLQ+ILDDEAEMFVLKMWR
Sbjct: 880 ERMRPWISKKITEFLGEEEATLVDYIVSSTQEHVKASQMLELLQSILDDEAEMFVLKMWR 939

Query: 795 MLIFEIKKVETGLALRSKS 813
           MLIFEIKKVETGL+LRSK+
Sbjct: 940 MLIFEIKKVETGLSLRSKT 958

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255568764\|ref\|XP_002525353.1\| conserved hypothetical protein [Ricinus communis] gi\|223535316\|gb\|EEF36991.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|296086551\|emb\|CBI32140.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224111298\|ref\|XP_002315807.1\| predicted protein [Populus trichocarpa] gi\|222864847\|gb\|EEF01978.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357485911\|ref\|XP_003613243.1\| RNA-binding protein [Medicago truncatula] gi\|355514578\|gb\|AES96201.1\| RNA-binding protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356497763\|ref\|XP_003517728.1\| PREDICTED: uncharacterized protein LOC100809428 [Glycine max]	Back alignment and taxonomy information

>gi\|356501735\|ref\|XP_003519679.1\| PREDICTED: uncharacterized protein LOC100803051 [Glycine max]	Back alignment and taxonomy information

>gi\|449513686\|ref\|XP_004164394.1\| PREDICTED: uncharacterized LOC101214372 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449434915\|ref\|XP_004135241.1\| PREDICTED: uncharacterized protein LOC101214372 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|307135981\|gb\|ADN33840.1\| RNA binding motif protein [Cucumis melo subsp. melo]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		813
TAIR\|locus:2195568		899	AT1G60200 [Arabidopsis thalian	0.350	0.317	0.591	4.5e-139
MGI\|MGI:1914289		838	Rbm25 "RNA binding motif prote	0.173	0.168	0.395	1.2e-38
UNIPROTKB\|E1BSR5		782	RBM25 "Uncharacterized protein	0.173	0.180	0.402	2.8e-38
UNIPROTKB\|E1BHM5		843	RBM25 "Uncharacterized protein	0.173	0.167	0.395	3.1e-38
UNIPROTKB\|P49756		843	RBM25 "RNA-binding protein 25"	0.173	0.167	0.395	3.1e-38
ZFIN\|ZDB-GENE-030131-5547		833	rbm25 "RNA binding motif prote	0.274	0.267	0.297	1.5e-35
WB\|WBGene00012245		707	W04D2.6 [Caenorhabditis elegan	0.161	0.185	0.364	2.3e-35
FB\|FBgn0028474		998	CG4119 [Drosophila melanogaste	0.206	0.168	0.352	1.2e-31
RGD\|1308755		354	Rbm25 "RNA binding motif prote	0.173	0.398	0.395	3.1e-29
DICTYBASE\|DDB_G0269926		724	DDB_G0269926 "splicing factor	0.204	0.229	0.335	1.5e-26

TAIR\|locus:2195568 AT1G60200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 837 (299.7 bits), Expect = 4.5e-139, Sum P(4) = 4.5e-139
 Identities = 175/296 (59%), Positives = 216/296 (72%)

Query:   521 DSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVF 580
             +S  E+H A D   +NG+G+ES  +    ++     + P++KLGFGLVGSGKRT+VPSVF
Sbjct:   612 ESANEHH-AAD-FEENGSGNESMAID---NNSGSEAHAPSKKLGFGLVGSGKRTSVPSVF 666

Query:   581 HVEXXXXXXXXXXMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEE 640
             + E          M+PLVPIDYSTEE +A     SG  PP+LA AAEFAKRIS+ N KEE
Sbjct:   667 YEEDEDEARKAKKMKPLVPIDYSTEEQEAVAHGGSGNTPPHLALAAEFAKRISSTNPKEE 726

Query:   641 KSDAERERSRRLHDRSSQREKDRS---DEDNNRTRDEHKEKILDRDRDREHGLDKVKTPD 697
               + E++RSRR HD++S R+++R    D D +R RD            +E G  K K  D
Sbjct:   727 TIETEKQRSRRSHDKASHRDRERERERDRDRDRVRDRGDGHSGPTKDAKESG--KAKIID 784

Query:   698 NKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLV 757
              K  LDAKQLID IPKTKE+LFSYEINWA+YDKH++HERMRPWISKKI EFLGEEE TLV
Sbjct:   785 TK-FLDAKQLIDTIPKTKEDLFSYEINWAMYDKHQVHERMRPWISKKIMEFLGEEEATLV 843

Query:   758 DYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS 813
             D+IVS+TQ HV+ASQMLELLQ+ILD+EAEMFVLKMWRMLIFEIK+VE G+ ++SK+
Sbjct:   844 DFIVSNTQQHVQASQMLELLQSILDEEAEMFVLKMWRMLIFEIKRVEAGVPVKSKA 899

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=ISM

GO:0006397 "mRNA processing" evidence=IEA

MGI\|MGI:1914289 Rbm25 "RNA binding motif protein 25" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BSR5 RBM25 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BHM5 RBM25 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P49756 RBM25 "RNA-binding protein 25" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5547 rbm25 "RNA binding motif protein 25" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00012245 W04D2.6 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

FB\|FBgn0028474 CG4119 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

RGD\|1308755 Rbm25 "RNA binding motif protein 25" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0269926 DDB_G0269926 "splicing factor PWI domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_X0863	hypothetical protein (894 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		813
cd12446		84	cd12446, RRM_RBM25, RNA recognition motif in eukar	4e-35
smart00311		74	smart00311, PWI, PWI, domain in splicing factors	7e-23
pfam01480		74	pfam01480, PWI, PWI domain	1e-14
smart00360		73	smart00360, RRM, RNA recognition motif	5e-12
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	1e-09
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	2e-09
cd12398		75	cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot	2e-09
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	4e-09
cd12671		75	cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i	6e-08
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	7e-08
cd12371		77	cd12371, RRM2_PUF60, RNA recognition motif 2 in (U	1e-07
cd12290		80	cd12290, RRM1_LARP7, RNA recognition motif 1 in La	2e-07
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	7e-07
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	9e-07
pfam00076		70	pfam00076, RRM_1, RNA recognition motif	1e-06
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	1e-06
TIGR01622		457	TIGR01622, SF-CC1, splicing factor, CC1-like famil	2e-06
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	5e-06
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	6e-06
PRK12678		672	PRK12678, PRK12678, transcription termination fact	7e-06
pfam14259		69	pfam14259, RRM_6, RNA recognition motif (a	7e-06
TIGR01645		612	TIGR01645, half-pint, poly-U binding splicing fact	8e-06
TIGR03319		514	TIGR03319, RNase_Y, ribonuclease Y	9e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-05
cd12344		81	cd12344, RRM1_SECp43_like, RNA recognition motif 1	1e-05
PRK12705		508	PRK12705, PRK12705, hypothetical protein; Provisio	1e-05
cd12243		71	cd12243, RRM1_MSSP, RNA recognition motif 1 in the	1e-05
cd12365		73	cd12365, RRM_RNPS1, RNA recognition motif in RNA-b	2e-05
cd12448		73	cd12448, RRM2_gar2, RNA recognition motif 2 in yea	2e-05
TIGR01642		509	TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la	2e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	3e-05
pfam09756		189	pfam09756, DDRGK, DDRGK domain	3e-05
cd12450		77	cd12450, RRM1_NUCLs, RNA recognition motif 1 found	3e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-05
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	4e-05
cd12352		72	cd12352, RRM1_TIA1_like, RNA recognition motif 1 i	4e-05
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	5e-05
pfam13904		261	pfam13904, DUF4207, Domain of unknown function (DU	5e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	6e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	6e-05
COG3064		387	COG3064, TolA, Membrane protein involved in colici	6e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	6e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	9e-05
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	1e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-04
TIGR01642		509	TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la	1e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-04
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	1e-04
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	2e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
TIGR02794		346	TIGR02794, tolA_full, TolA protein	2e-04
pfam05557		722	pfam05557, MAD, Mitotic checkpoint protein	2e-04
PRK10811		1068	PRK10811, rne, ribonuclease E; Reviewed	2e-04
COG1390		194	COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su	2e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-04
PRK10811		1068	PRK10811, rne, ribonuclease E; Reviewed	3e-04
cd12399		78	cd12399, RRM_HP0827_like, RNA recognition motif in	3e-04
COG0724		306	COG0724, COG0724, RNA-binding proteins (RRM domain	3e-04
COG2268		548	COG2268, COG2268, Uncharacterized protein conserve	3e-04
cd12306		73	cd12306, RRM_II_PABPs, RNA recognition motif in ty	3e-04
pfam08648		158	pfam08648, DUF1777, Protein of unknown function (D	3e-04
cd12384		76	cd12384, RRM_RBM24_RBM38_like, RNA recognition mot	3e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-04
PTZ00266		1021	PTZ00266, PTZ00266, NIMA-related protein kinase; P	4e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	5e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	5e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	5e-04
PRK12585		197	PRK12585, PRK12585, putative monovalent cation/H+	5e-04
cd12355		80	cd12355, RRM_RBM18, RNA recognition motif in eukar	5e-04
PRK07735		430	PRK07735, PRK07735, NADH dehydrogenase subunit C;	6e-04
cd12649		81	cd12649, RRM1_SXL, RNA recognition motif 1 in Dros	6e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	7e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-04
cd12370		76	cd12370, RRM1_PUF60, RNA recognition motif 1 in (U	8e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
pfam09756		189	pfam09756, DDRGK, DDRGK domain	0.001
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	0.001
cd12318		82	cd12318, RRM5_RBM19_like, RNA recognition motif 5	0.001
cd12382		80	cd12382, RRM_RBMX_like, RNA recognition motif in h	0.001
PRK00247		429	PRK00247, PRK00247, putative inner membrane protei	0.001
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	0.001
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.002
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	0.002
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	0.002
TIGR01622		457	TIGR01622, SF-CC1, splicing factor, CC1-like famil	0.002
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.002
PRK12705		508	PRK12705, PRK12705, hypothetical protein; Provisio	0.002
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.002
cd12336		75	cd12336, RRM_RBM7_like, RNA recognition motif in R	0.002
cd12447		76	cd12447, RRM1_gar2, RNA recognition motif 1 in yea	0.002
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	0.002
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.003
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.003
PTZ00266		1021	PTZ00266, PTZ00266, NIMA-related protein kinase; P	0.003
PRK09510		387	PRK09510, tolA, cell envelope integrity inner memb	0.003
PRK09510		387	PRK09510, tolA, cell envelope integrity inner memb	0.003
cd12271		72	cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar	0.003
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	0.003
cd12273		71	cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve	0.003
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.003
cd12240		78	cd12240, RRM_NCBP2, RNA recognition motif found in	0.003
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.004
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.004
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	0.004
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.004
cd12390		92	cd12390, RRM3_RAVER, RNA recognition motif 3 in ri	0.004
pfam10243		506	pfam10243, MIP-T3, Microtubule-binding protein MIP	0.004

>gnl\|CDD\|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins	Back alignment and domain information

 Score =  127 bits (322), Expect = 4e-35
 Identities = 44/84 (52%), Positives = 55/84 (65%)

Query: 97  TKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALR 156
           T V+VG I      DF+  +L+ CG V SWKR + PS G  K FGFCEFE  EG LRALR
Sbjct: 1   TTVFVGNIPEGVSDDFIRKLLEKCGKVLSWKRVKDPSTGKLKAFGFCEFEDPEGALRALR 60

Query: 157 LLNKFNIDGQELMLKVDQATREYL 180
           LLN   + G++L++KVD  TR+ L
Sbjct: 61  LLNGLELGGKKLLVKVDAKTRKLL 84

This subfamily corresponds to the RRM of RBM25, also termed Arg/Glu/Asp-rich protein of 120 kDa (RED120), or protein S164, or RNA-binding region-containing protein 7, an evolutionary-conserved splicing coactivator SRm160 (SR-related nuclear matrix protein of 160 kDa, )-interacting protein. RBM25 belongs to a family of RNA-binding proteins containing a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), at the N-terminus, a RE/RD-rich (ER) central region, and a C-terminal proline-tryptophan-isoleucine (PWI) motif. It localizes to the nuclear speckles and associates with multiple splicing components, including splicing cofactors SRm160/300, U snRNAs, assembled splicing complexes, and spliced mRNAs. It may play an important role in pre-mRNA processing by coupling splicing with mRNA 3'-end formation. Additional research indicates that RBM25 is one of the RNA-binding regulators that direct the alternative splicing of apoptotic factors. It can activate proapoptotic Bcl-xS 5'ss by binding to the exonic splicing enhancer, CGGGCA, and stabilize the pre-mRNA-U1 snRNP through interaction with hLuc7A, a U1 snRNP-associated factor. . Length = 84

>gnl\|CDD\|214609 smart00311, PWI, PWI, domain in splicing factors	Back alignment and domain information

>gnl\|CDD\|216523 pfam01480, PWI, PWI domain	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|215696 pfam00076, RRM_1, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional	Back alignment and domain information

>gnl\|CDD\|222631 pfam14259, RRM_6, RNA recognition motif (a	Back alignment and domain information

>gnl\|CDD\|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family	Back alignment and domain information

>gnl\|CDD\|188306 TIGR03319, RNase_Y, ribonuclease Y	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins	Back alignment and domain information

>gnl\|CDD\|237178 PRK12705, PRK12705, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family	Back alignment and domain information

>gnl\|CDD\|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|220383 pfam09756, DDRGK, DDRGK domain	Back alignment and domain information

>gnl\|CDD\|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207)	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|218636 pfam05557, MAD, Mitotic checkpoint protein	Back alignment and domain information

>gnl\|CDD\|236766 PRK10811, rne, ribonuclease E; Reviewed	Back alignment and domain information

>gnl\|CDD\|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|236766 PRK10811, rne, ribonuclease E; Reviewed	Back alignment and domain information

>gnl\|CDD\|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins	Back alignment and domain information

>gnl\|CDD\|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777)	Back alignment and domain information

>gnl\|CDD\|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed	Back alignment and domain information

>gnl\|CDD\|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins	Back alignment and domain information

>gnl\|CDD\|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated	Back alignment and domain information

>gnl\|CDD\|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|220383 pfam09756, DDRGK, DDRGK domain	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins	Back alignment and domain information

>gnl\|CDD\|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|237178 PRK12705, PRK12705, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional	Back alignment and domain information

>gnl\|CDD\|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional	Back alignment and domain information

>gnl\|CDD\|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		813
KOG2253		668	consensus U1 snRNP complex, subunit SNU71 and rela	100.0
PF01480		77	PWI: PWI domain; InterPro: IPR002483 The PWI domai	99.74
smart00311		74	PWI PWI, domain in splicing factors.	99.72
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	99.71
KOG2146		354	consensus Splicing coactivator SRm160/300, subunit	99.67
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.57
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.56
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.49
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	99.49
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.42
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.42
KOG0122		270	consensus Translation initiation factor 3, subunit	99.41
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	99.41
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	99.37
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	99.35
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	99.32
PLN03213		759	repressor of silencing 3; Provisional	99.3
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.29
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.29
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.28
PLN03120		260	nucleic acid binding protein; Provisional	99.27
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.27
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.26
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	99.26
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.25
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.22
smart00362		72	RRM_2 RNA recognition motif.	99.21
KOG4207		256	consensus Predicted splicing factor, SR protein su	99.21
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	99.2
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	99.2
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.19
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.18
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.17
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.17
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.16
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.15
PLN03121		243	nucleic acid binding protein; Provisional	99.15
smart00360		71	RRM RNA recognition motif.	99.15
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.14
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.14
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.14
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.13
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	99.12
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	99.1
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	99.09
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	99.08
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.06
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	99.02
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.01
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	99.01
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.0
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.95
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	98.93
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.92
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	98.91
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.91
smart00361		70	RRM_1 RNA recognition motif.	98.9
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.89
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.87
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	98.86
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.86
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.81
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	98.76
KOG0226		290	consensus RNA-binding proteins [General function p	98.73
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	98.73
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.7
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.69
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.65
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.64
KOG1457		284	consensus RNA binding protein (contains RRM repeat	98.6
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.6
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	98.55
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.53
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	98.49
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.45
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	98.44
KOG0151		877	consensus Predicted splicing regulator, contains R	98.42
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.38
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.37
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.36
KOG1548		382	consensus Transcription elongation factor TAT-SF1	98.34
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	98.27
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	98.24
KOG0533		243	consensus RRM motif-containing protein [RNA proces	98.22
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	98.17
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	98.12
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.08
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	97.97
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	97.97
KOG4660		549	consensus Protein Mei2, essential for commitment t	97.91
KOG2253		668	consensus U1 snRNP complex, subunit SNU71 and rela	97.78
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	97.74
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.7
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	97.58
KOG1995		351	consensus Conserved Zn-finger protein [General fun	97.52
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.5
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	97.47
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	97.38
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	97.21
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	97.21
KOG4210		285	consensus Nuclear localization sequence binding pr	97.09
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	96.94
KOG4676		479	consensus Splicing factor, arginine/serine-rich [R	96.88
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	96.88
KOG3152		278	consensus TBP-binding protein, activator of basal	96.88
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	96.88
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	96.88
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	96.86
KOG2314		698	consensus Translation initiation factor 3, subunit	96.83
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	96.5
KOG1855		484	consensus Predicted RNA-binding protein [General f	96.34
COG5175		480	MOT2 Transcriptional repressor [Transcription]	96.32
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	96.05
PF08952		146	DUF1866: Domain of unknown function (DUF1866) ; In	96.0
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	95.94
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	95.67
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	95.38
KOG1548		382	consensus Transcription elongation factor TAT-SF1	95.32
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	95.16
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	94.85
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	94.72
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	94.6
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	94.49
KOG4676		479	consensus Splicing factor, arginine/serine-rich [R	93.98
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	93.96
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	93.64
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	93.57
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	93.39
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	93.37
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	93.18
KOG4285		350	consensus Mitotic phosphoprotein [Cell cycle contr	92.79
KOG0115		275	consensus RNA-binding protein p54nrb (RRM superfam	92.23
KOG1996		378	consensus mRNA splicing factor [RNA processing and	92.08
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	91.99
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	91.7
PTZ00266		1021	NIMA-related protein kinase; Provisional	90.2
PTZ00121		2084	MAEBL; Provisional	88.78
PF15023		166	DUF4523: Protein of unknown function (DUF4523)	88.74
KOG4574		1007	consensus RNA-binding protein (contains RRM and Pu	87.52
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	86.91
KOG2068		327	consensus MOT2 transcription factor [Transcription	86.71
KOG2591		684	consensus c-Mpl binding protein, contains La domai	85.47
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	84.94
KOG2891		445	consensus Surface glycoprotein [General function p	84.9
PF04847		184	Calcipressin: Calcipressin; InterPro: IPR006931 Ca	84.73
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	84.04
KOG4660		549	consensus Protein Mei2, essential for commitment t	82.49
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	81.96
KOG4210		285	consensus Nuclear localization sequence binding pr	80.05

>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=7.1e-68  Score=593.00  Aligned_cols=609  Identities=31%  Similarity=0.480  Sum_probs=364.1

Q ss_pred             CCceEEEccCCCCCCHHHHHHHHhcCCceeEEEEeccCCCCCCcceEEEEeCCHHHHHHHHHHhCCceeCCeEEEEEeec
Q 003520           95 PQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQ  174 (813)
Q Consensus        95 ~~~tLfVgNLp~~vte~~L~~lF~~~G~V~~vki~~d~~tGk~kGfgFVeF~~~e~A~~Al~~Lng~~i~Gr~L~V~~a~  174 (813)
                      +..+||||||.+.|....+..++..||.|.+|+++.         ||||.|.++..+.+|+..|+-..++|..|.++++.
T Consensus        39 ~~~~vfv~~~~~~~s~~~~~~il~~~g~v~s~kr~~---------fgf~~f~~~~~~~ra~r~~t~~~~~~~kl~~~~d~  109 (668)
T KOG2253|consen   39 PRDTVFVGNISYLVSQEFWKSILAKSGFVPSWKRDK---------FGFCEFLKHIGDLRASRLLTELNIDDQKLIENVDE  109 (668)
T ss_pred             CCceeEecchhhhhhHHHHHHHHhhCCcchhhhhhh---------hcccchhhHHHHHHHHHHhcccCCCcchhhccchh
Confidence            467899999999999999999999999999998754         99999999999999999999999999999998872


Q ss_pred             hhHHHHHHHHHhhhhhhhhhhhhccccCCcccccccccccCCCCCCCc---------ccccCCCCCCCCCCCCCCCCcch
Q 003520          175 ATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPE---------NLKDNETGNKESHDPTNFGVVTE  245 (813)
Q Consensus       175 ~~kk~le~~k~kk~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~e---------~~~d~d~~~~~~~ev~~~~~~~e  245 (813)
                      .+   +.        +.+.++..            .......|-|+.+         ....++.....++.+.+...++.
T Consensus       110 q~---~~--------n~~k~~~~------------~~~~~~~f~p~~srr~e~i~~k~~~l~~~~~~~~~~is~s~~s~~  166 (668)
T KOG2253|consen  110 QT---IE--------NADKEKSI------------ANKESHKFVPSSSRRQESIQNKPLSLDEQIHKKSLQISSSAASRR  166 (668)
T ss_pred             hh---hc--------Cccccccc------------hhhhhcccCCchhHHHHHhhccccchhHHHHHHHHhccchhhhhh
Confidence            22   10        11110000            0111112222111         00011101122233333333443


Q ss_pred             hhhhhhHHHHHHHHHHHHHhhhCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCcccccccchhhhcccccccccccccc
Q 003520          246 EDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASD  325 (813)
Q Consensus       246 ed~~~D~~~~ekie~~~eer~~~~~~~~~~~~~~~~g~~~~~~~~~~~~r~~~~~~~~~~~~~~e~~~~~~~~~~~~~re  325 (813)
                      ....+|...++.+...+++....    +..+.+..+ +.....++....+.                    +++.-.  +
T Consensus       167 ~~~e~d~h~~e~~~~~~~s~~~~----~~~~~~~~~-~~e~~~~s~~~~s~--------------------tds~~~--~  219 (668)
T KOG2253|consen  167 QIAEADDHCLELEKTETESNSAL----SKEAESKKS-PFEDTKDSKRSFSS--------------------TDSGSE--S  219 (668)
T ss_pred             hhHHHHHHHHHHHHhhccccccc----CcccccccC-chhhhchhhhhhcc--------------------cCcccc--c
Confidence            44444544444444443332221    111111000 00000000000000                    000000  0


Q ss_pred             CCCCCCCCCCcccccc-ccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhHHHHHHHHHHH
Q 003520          326 HDRPETSSPDRSRVHD-RRGRDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREK  404 (813)
Q Consensus       326 ~dr~~~~~~~rsr~r~-rr~r~r~r~~~r~~~re~~r~~r~rerer~r~~R~~~~r~~e~E~~y~er~r~we~RER~r~~  404 (813)
                      .++.   .  +|+++. .+++.+...+.|...+.+++.+.....+..+++|...++..++|.||+.||+.|+.||+.+++
T Consensus       220 d~~~---~--~s~~~n~~rd~sr~~~r~R~~~r~Re~~e~~ed~~~~re~r~~~~~~~~~E~Ayq~rl~~we~Rer~~~K  294 (668)
T KOG2253|consen  220 DSAE---V--NSSSLNYCRDRSRFDRRSRNDRRIRERLEKNEDSDEYREDRAATIKSVDPEKAYQTRLVFWEIREQTKEK  294 (668)
T ss_pred             hhhh---h--cccccccchhhccchhhhHHHHHHHHHhhhccchHHHHHhhhhhhhccChhHHHHHHHHHHHHHHHHHHH
Confidence            0000   0  011111 111111122222222222222211223456677888999999999999999999999999955


Q ss_pred             HHHHHHHHHHHHH------HHHHHHhhhcccchhhhhhhhhhhhHHHHHHHHhhhhhhhcHHHHHHHHHHHHHHHHHHHH
Q 003520          405 ERQYEKEKEKERE------RKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEE  478 (813)
Q Consensus       405 ~re~ekerere~e------r~r~~e~~~d~dddr~d~rk~~r~~~~~~R~~~r~rE~e~D~~dr~~E~eE~~e~~~~~~e  478 (813)
                      .+++++.+++.+.      .+++++|++||||+++| .+||++++|+.|++++.+|+|+|.+||.+|++|++++|++..+
T Consensus       295 e~eke~~ke~~r~~~~~ke~kr~k~~~ed~DD~rdd-~~y~r~s~l~~r~r~~~re~Ead~~dR~qeqee~~E~Kr~~~~  373 (668)
T KOG2253|consen  295 EREKERLKEKSRQYKREKEAKRLKEFLEDYDDERDD-PKYYRGSALQERLRDREREAEADRRDRHQEQEELEEIKRRHSE  373 (668)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhhhcchhhhh-HHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHhh
Confidence            5554444444432      35788999999999877 6999999999999999999999999999999999999999877


Q ss_pred             HHHHHHhHHHhhhccccccCCCcc----ccccccccCCcccccCCCCCccccCCCCCCCCCCCCCCCCCCCccccccccc
Q 003520          479 EQLQQQQRDALKLLSDNAVNGSLA----EESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQ  554 (813)
Q Consensus       479 ~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~  554 (813)
                      +..+.....+...+.+......+.    ....++.........+.+.+++..|+....  .+..+-++    ..+-....
T Consensus       374 ~~~~~~~~e~~r~~~~~~~~~~~~~~~a~~ke~e~~~~~~~~q~~~e~a~~~~~~~ee--e~~s~r~~----~~~d~~~~  447 (668)
T KOG2253|consen  374 EEAEDPSAEEERNMEEEEALDEEEDDEAVRKEPEERDLEESHQRLGESANQEHSNDEE--EIKSQRDD----YKPDENDH  447 (668)
T ss_pred             hcccccchHHHHHHhhhhhhcchhhHHHHhhCcccccCccccchHHhhhhhccccchh--hcccchhh----hhhhhhhh
Confidence            654443333333333222222111    112222222222333444444444421110  00000000    00000112


Q ss_pred             CCCCCccccCCCcCCCCCccccCCcCCCCCCcchhcccCCCCcccCCCChHHHhhhcCCCCCCCCCchHHHHHHHHHhhc
Q 003520          555 SGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISN  634 (813)
Q Consensus       555 ~~~~~~~k~~~~~~~~~kr~~v~~vf~~~dde~~~~~~~kr~Lvpl~y~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  634 (813)
                      -..+|...+.+|+++++.+..+..+|-.-+...++....+...+||.|+.....+     .|+.++.+..++.   -+-.
T Consensus       448 i~~~ps~~~~s~~~~~n~~~~~~~~~~~~~e~~~~es~n~~~n~p~~~~~~~q~~-----~g~sa~~~~i~~k---k~~~  519 (668)
T KOG2253|consen  448 ISHAPSASLASGLVDANDRDSSPRGFKERHEREDDESLNKKINRPILASIQNQDE-----IGPSASPIPIAKK---KLPE  519 (668)
T ss_pred             hhcCchhhhhhhccCCCCCCcccccccccccCcchhhhccccccccccccccccc-----ccCCCCccccccc---cCCC
Confidence            3456777888899988888889988876544444566667889999987733222     2222222111111   0111


Q ss_pred             cCcchhhchHHHHhhhhhccccchhhccccccccchhhh-hhhhhhcccccccccccccccCchhhhhhHHHhhhhcCCC
Q 003520          635 VNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRD-EHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPK  713 (813)
Q Consensus       635 ~~~~ee~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ip~  713 (813)
                      |+.                    .+.+  .++|.+-..+ ++.+.--++.+++.|+..   +.+ -|..++++||.+||+
T Consensus       520 ~~v--------------------~~~~--~d~Dk~v~~~kk~vp~dyd~n~~~~~~~~---~nd-eK~~~~ksLI~tIP~  573 (668)
T KOG2253|consen  520 TGV--------------------FRED--DDEDKNVHEKKKLVPLDYDRNQARAHSGE---SND-EKRKRIKSLIETIPT  573 (668)
T ss_pred             ccc--------------------cccc--CCcccccchhhhcccccCChhhcccccCC---cch-hHHHHHHhhcccCCc
Confidence            100                    0000  1122111111 222222222233333332   223 233479999999999


Q ss_pred             CccchhcccccccccchhhHhhhhhhhHHHHHHhhcCCchhHHHHHHHHhhhcCCCHHHHHHHHHHhhhHHHHHHHHHHH
Q 003520          714 TKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMW  793 (813)
Q Consensus       714 ~k~~lf~~~i~w~~~~~~~~~~~l~pwi~kki~e~lG~ee~~lv~~i~~~l~~~~~p~~l~~~l~~~ld~~a~~fv~~lw  793 (813)
                      +|++||+|+|+|+.||..+|+++|+|||+|||+||||++|++||||||++|+.|.+||+||.+|.+|||++|++||+|||
T Consensus       574 ~keeLf~~pidw~~ld~~lm~~rirpwV~KKIiEflGeeE~tLVdFI~s~i~~h~~~q~iL~dl~~ilDEdAE~FV~KmW  653 (668)
T KOG2253|consen  574 EKEELFAYPIDWDELDSILMNERIRPWVNKKIIEFLGEEEDTLVDFICSNIRQHSSPQQILDDLAMILDEDAEVFVVKMW  653 (668)
T ss_pred             chHHHhhCcccHHHHhhHHHHHHHHHHHHHHHHHHhCCcchhHHHHHHHHHHhcCCHHHHHHHHHHHHhcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhccc
Q 003520          794 RMLIFEIKKVETGLA  808 (813)
Q Consensus       794 rllife~~~~~~g~~  808 (813)
                      ||||||+.+++.||+
T Consensus       654 RlLiyel~ar~~g~~  668 (668)
T KOG2253|consen  654 RLLIYELGARKLGLT  668 (668)
T ss_pred             HHHHHHhhhhhccCC
Confidence            999999999999985

>PF01480 PWI: PWI domain; InterPro: IPR002483 The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing []	Back alignment and domain information

>smart00311 PWI PWI, domain in splicing factors	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG2146 consensus Splicing coactivator SRm160/300, subunit SRm160 (contains PWI domain) [RNA processing and modification; General function prediction only]	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification]	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification]	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>PF15023 DUF4523: Protein of unknown function (DUF4523)	Back alignment and domain information

>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only]	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms]	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG2891 consensus Surface glycoprotein [General function prediction only]	Back alignment and domain information

>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

Homologous Structure Templates