Citrus Sinensis ID: 003563


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810
MFVVIYMLILQFSQLNKKRGRRKGSKNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
cHHHHHHHHHHHcHHHHHHHcHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHcHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcc
cccEEEEEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccHHccccccHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccc
MFVVIYMLILQFSQLNkkrgrrkgsknklspgvtkmlGEASLQYAYGNFEQAISLLKEVVrlspnlpetyNTLGLAHSalgnhksaFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKlfpdnvdatKTGAQLFLKCGQTARSIGILEEYLkvhpsdadlSVIDLLVAILMENNAYEKTLQHIEHAQIVrfsgkelplkLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLetnagtdngYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAItllsppkdldsldmnsdksnpwwlNEKIIMKLCHIYrakgmpedfvdAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIynnlptdsilcgirpaapkSELLVAARARKKIQKKEALKEEKKALAKAAgvewhsddtddesqqeafrepplpnllkneenQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAkmaydstdpnhgfdcakyilqlhpyslsAWNCYYKVLSRmgkinskhskHSKFIRYLRAkykdcvppiiisghqftmaSHHQDAARCYLEAYkllpenplinlcvgSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKekdypipkhndkrpdlmesgesgycdLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
MFVVIYMLILQFsqlnkkrgrrkgsknklspgvtkMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIraepkdisLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVrfsgkelplkLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAitllsppkdldsldmNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALrqkvkvkrrltkgilqqrtkiynnlptdsiLCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKaagvewhsddtddESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMgkinskhskHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAikekdypipkhndkrpdlmesGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
MFVVIYMLILQFSQlnkkrgrrkgsknklsPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDarltlasllleeakeeeaitllsppkdldsldMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVAARARKKIQkkealkeekkalakaaGVEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
*FVVIYMLILQFSQ*********************MLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEE***************************PWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAA****LLV*******************************************************ENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDY******************GYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYC**
MFVVIYMLI*************************KMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
MFVVIYMLILQFSQL**************SPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVAARARKKIQKK********************************REPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
MFVVIYMLILQFSQLNKKRGR*KGSKNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVVIYMLILQFSQLNKKRGRRKGSKNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILCGIRPAAPKSELLVxxxxxxxxxxxxxxxxxxxxxxxxAGVEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query810 2.2.26 [Sep-21-2011]
Q9Y5Q9886 General transcription fac yes no 0.909 0.831 0.217 2e-47
O744581006 Transcription factor tau yes no 0.195 0.157 0.355 2e-15
P19737387 TPR repeat-containing pro yes no 0.265 0.555 0.234 8e-11
P333391025 Transcription factor tau yes no 0.140 0.111 0.309 3e-10
Q3UV71942 Transmembrane and TPR rep no no 0.219 0.188 0.255 1e-07
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.187 0.155 0.230 8e-07
Q13099833 Intraflagellar transport no no 0.101 0.098 0.260 1e-06
Q61371824 Intraflagellar transport no no 0.106 0.104 0.241 2e-06
Q04737248 TPR repeat-containing pro N/A no 0.135 0.443 0.282 5e-06
Q8IUR5882 Transmembrane and TPR rep no no 0.219 0.201 0.238 5e-06
>sp|Q9Y5Q9|TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens GN=GTF3C3 PE=1 SV=1 Back     alignment and function desciption
 Score =  191 bits (485), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 182/835 (21%), Positives = 360/835 (43%), Gaps = 98/835 (11%)

Query: 5   IYMLILQFSQLNKKRGRRKGSKNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSP 64
           +++L +  ++  KK  + K  ++KL   +  ++GEA++++A G  E+AI +  E++R +P
Sbjct: 121 VFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAP 180

Query: 65  NLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYI 124
              E ++TL + +   G+ + +  F +IAAHL+P D+  W +L   ++++ +  QA++  
Sbjct: 181 LAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCY 240

Query: 125 RQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDN-----VDATKTGAQLF 179
            +A++ EP ++      +S Y ++GD++ A + Y +I  L   +     +   +  A+ +
Sbjct: 241 TKALKYEPTNVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARDMAKSY 300

Query: 180 LKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGK 239
            +      +I I++E    H     +  +++   + + N  Y+K L+ I     +    K
Sbjct: 301 YEANDVTSAINIIDEAFSKHQGLVSMEDVNIAAELYISNKQYDKALEIITDFSGIVLEKK 360

Query: 240 E----------------------LPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAIDH 277
                                  +P+ + VK  +C + L  +E    L   L  +N  D 
Sbjct: 361 TSEEGTSEENKAPENVTCTIPDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDM 420

Query: 278 ADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFY 337
            D                                   LYL +AE +L + E   A+    
Sbjct: 421 GD-----------------------------------LYLDVAEAFLDVGEYNSALPLLS 445

Query: 338 KALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIM 397
             +         R  LA + L  A+  +A+  +   +  +S     D + P  L+ +I  
Sbjct: 446 ALV------CSERYNLAVVWLRHAECLKALGYME--RAAESYGKVVDLA-PLHLDARI-- 494

Query: 398 KLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTD 457
            L  + +  G PE  ++A+ P+       + L Q     ++  K +L + T +++     
Sbjct: 495 SLSTLQQQLGQPEKALEALEPMYDP----DTLAQDANAAQQELKLLLHRSTLLFSQGKMY 550

Query: 458 SILCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHSDDTDDESQQEAF 517
             +  +         +   RA+  +       E    L K +  +  SD  D ES     
Sbjct: 551 GYVDTLLTMLAMLLKVAMNRAQVCLISSSKSGERHLYLIKVSR-DKISDSNDQESANCDA 609

Query: 518 RE--PPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELR 575
           +     L ++L  ++   L++    +L  L R++EA  +++ S+         +K++EL 
Sbjct: 610 KAIFAVLTSVLTKDDWWNLLLKAIYSLCDLSRFQEAELLVDSSLEYYSFYDDRQKRKELE 669

Query: 576 SLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRY 635
             G   A    +    ++  + ++  +      WN + +V      ++S+  +H +F   
Sbjct: 670 YFGLSAAILDKNFRKAYNYIRIMVMENVNKPQLWNIFNQV-----TMHSQDVRHHRFCLR 724

Query: 636 LRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGF 695
           L  K  +     +++GH   ++   + A   Y++A++  P+ PL + C+G   I++A   
Sbjct: 725 LMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYSFCIGLTFIHMASQK 784

Query: 696 RLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKD 755
            +  +H  + QGF+FL   L L    QE+ YN+ R  H +GL+ LA  YY+K L +    
Sbjct: 785 YVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALELP--- 841

Query: 756 YPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF 810
                     P ++E  E    DL+R+ AYNL LIY++SG   +A+ LL  YC+ 
Sbjct: 842 ----------PLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTYCSI 886




Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters.
Homo sapiens (taxid: 9606)
>sp|O74458|SFC4_SCHPO Transcription factor tau subunit sfc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfc4 PE=1 SV=1 Back     alignment and function description
>sp|P19737|Y425_SYNP2 TPR repeat-containing protein SYNPCC7002_A0425 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0425 PE=4 SV=2 Back     alignment and function description
>sp|P33339|TFC4_YEAST Transcription factor tau 131 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC4 PE=1 SV=1 Back     alignment and function description
>sp|Q3UV71|TMTC1_MOUSE Transmembrane and TPR repeat-containing protein 1 OS=Mus musculus GN=Tmtc1 PE=2 SV=2 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q13099|IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens GN=IFT88 PE=2 SV=2 Back     alignment and function description
>sp|Q61371|IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus GN=Ift88 PE=1 SV=2 Back     alignment and function description
>sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0751 PE=4 SV=1 Back     alignment and function description
>sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing protein 1 OS=Homo sapiens GN=TMTC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query810
297736093 915 unnamed protein product [Vitis vinifera] 0.964 0.853 0.613 0.0
356544401 919 PREDICTED: general transcription factor 0.953 0.840 0.590 0.0
449458227 927 PREDICTED: transcription factor tau subu 0.970 0.847 0.582 0.0
357474517 937 Transcription factor tau subunit sfc4 [M 0.962 0.832 0.574 0.0
356540992 929 PREDICTED: general transcription factor 0.925 0.807 0.573 0.0
357473897 958 Transcription factor tau subunit sfc4 [M 0.961 0.813 0.555 0.0
255556705684 o-linked n-acetylglucosamine transferase 0.833 0.986 0.602 0.0
115485047900 Os11g0266800 [Oryza sativa Japonica Grou 0.955 0.86 0.472 0.0
449476653627 PREDICTED: LOW QUALITY PROTEIN: general 0.765 0.988 0.580 0.0
357115318901 PREDICTED: general transcription factor 0.965 0.867 0.466 0.0
>gi|297736093|emb|CBI24131.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/834 (61%), Positives = 652/834 (78%), Gaps = 53/834 (6%)

Query: 26  KNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKS 85
           KNKLSP VT+ LGEA+L YA+G +E+AI +LKEVVRL+PNLP+ Y+T GL ++A G+ K 
Sbjct: 86  KNKLSPEVTRKLGEANLHYAHGRYEEAILVLKEVVRLAPNLPDAYHTFGLVYNAFGDKKR 145

Query: 86  AFDFYVIAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFY 145
           A +FY++AAHL+PKDS+LWK L+T+++++G+T QA Y + +AI A+P+DISLR H AS Y
Sbjct: 146 ALNFYMLAAHLTPKDSSLWKLLVTWSIEQGNTGQARYCLSKAITADPEDISLRFHRASLY 205

Query: 146 VEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADL 205
           VE+G+Y+KAAESYEQI +LFP+NV+A KTGA+L+ KCGQ  RS+ ILE+Y+K HP+ ADL
Sbjct: 206 VELGEYQKAAESYEQISQLFPENVEAPKTGAKLYKKCGQVERSVSILEDYIKDHPTKADL 265

Query: 206 SVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEIL 265
           S++D+L A+ MENN +++ LQHIEHAQ++  SGK+LPL L +KAGIC++ LGN+EKAE L
Sbjct: 266 SIVDMLAAVCMENNVHDRALQHIEHAQLLYCSGKDLPLHLTIKAGICHIHLGNIEKAEAL 325

Query: 266 FADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLS 325
           F+ LQ +   DHA LI+EVAD+ MSL   + ALKYY  LE N G DNG+L+LK+A+CYLS
Sbjct: 326 FSVLQ-RETCDHAGLISEVADSFMSLELYDFALKYYLMLEGNVGRDNGFLHLKIAQCYLS 384

Query: 326 LKERAHAIMFFYK----------------------------------------------A 339
           LKER  AI FFYK                                               
Sbjct: 385 LKERVQAIPFFYKENQEADRLAKRGASIPIKCSEDFFFSLGSPCKLMIVILFLVSIFFYT 444

Query: 340 LDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDS-LDMNSDKSNPWWLNEKIIMK 398
           LD  +DNIDARLTLA+LLLE AKE+EAI LLSPPK+L+S +D NSD+  PWWLN K+ +K
Sbjct: 445 LDVLQDNIDARLTLATLLLEGAKEDEAILLLSPPKNLESTVDPNSDEFQPWWLNGKVKLK 504

Query: 399 LCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKV--KVKRRLTKGILQQRTKIYNNLPT 456
           L HIYR+KGM ++FVDAIFPLV ESL VE L+QKV  +VK+RL+K +L +R K+ ++  +
Sbjct: 505 LSHIYRSKGMSDEFVDAIFPLVRESLFVETLKQKVTVRVKKRLSKSVLFERVKVLDDHHS 564

Query: 457 DSILCGIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHSDDTDDESQQEA 516
           D++  G RP A  S+L  A+RA+K +QKK   KEE+KA A AAGV+W+SD++DDES ++ 
Sbjct: 565 DNVFHGFRPMASTSDLSKASRAKKLLQKKATRKEERKAAAMAAGVDWYSDESDDESPEQK 624

Query: 517 FREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMRLAYNILPLEKKEELRS 576
            REPPLPNLLK+EE+  LI+DLCKALASL++Y EA +IINL++RLAYNI+P+EKKEELRS
Sbjct: 625 LREPPLPNLLKDEEHHHLILDLCKALASLRKYWEALDIINLTLRLAYNIMPIEKKEELRS 684

Query: 577 LGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMGKINSKHSKHSKFIRYL 636
           LGA++AY+ TDP HGFD  KYI+Q HP+SL+AWNCYYKV+SR+    +++SKHSK +  +
Sbjct: 685 LGAQIAYNITDPKHGFDYVKYIVQQHPHSLAAWNCYYKVISRL---ENRYSKHSKLLHSM 741

Query: 637 RAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLALGFR 696
           R ++KDCVPPI+I GHQFTM S HQ AA+ YLEAYKL+PENPLINLC G+ALIN+ALGFR
Sbjct: 742 RVRHKDCVPPIVIFGHQFTMISQHQIAAKEYLEAYKLMPENPLINLCAGTALINIALGFR 801

Query: 697 LQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDY 756
           LQNKHQCLAQG AFLYNNLRLCE+SQEALYNIARA HHVGLVSLA +YYEKVLA  E+DY
Sbjct: 802 LQNKHQCLAQGLAFLYNNLRLCENSQEALYNIARAYHHVGLVSLAVTYYEKVLATHERDY 861

Query: 757 PIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF 810
           PIP+   +  DL+E+ + GYCDL+REAAYNLHLIYK SGA+DLARQ+LKD+CT 
Sbjct: 862 PIPRLPYENTDLVENRKPGYCDLRREAAYNLHLIYKKSGALDLARQVLKDHCTI 915




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356544401|ref|XP_003540640.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449458227|ref|XP_004146849.1| PREDICTED: transcription factor tau subunit sfc4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357474517|ref|XP_003607543.1| Transcription factor tau subunit sfc4 [Medicago truncatula] gi|355508598|gb|AES89740.1| Transcription factor tau subunit sfc4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356540992|ref|XP_003538968.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Glycine max] Back     alignment and taxonomy information
>gi|357473897|ref|XP_003607233.1| Transcription factor tau subunit sfc4 [Medicago truncatula] gi|355508288|gb|AES89430.1| Transcription factor tau subunit sfc4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255556705|ref|XP_002519386.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223541453|gb|EEF43003.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|115485047|ref|NP_001067667.1| Os11g0266800 [Oryza sativa Japonica Group] gi|108864222|gb|ABA92586.2| TPR Domain containing protein, expressed [Oryza sativa Japonica Group] gi|113644889|dbj|BAF28030.1| Os11g0266800 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449476653|ref|XP_004154797.1| PREDICTED: LOW QUALITY PROTEIN: general transcription factor 3C polypeptide 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357115318|ref|XP_003559437.1| PREDICTED: general transcription factor 3C polypeptide 3-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query810
TAIR|locus:2007928896 AT1G17680 [Arabidopsis thalian 0.367 0.332 0.625 4e-164
DICTYBASE|DDB_G0278321997 gtf3C3 "transcription factor I 0.337 0.273 0.303 3.7e-51
UNIPROTKB|I3LAX1916 GTF3C3 "Uncharacterized protei 0.330 0.292 0.279 9.7e-47
RGD|1309185883 Gtf3c3 "general transcription 0.480 0.440 0.248 3.1e-45
UNIPROTKB|E2QYG3883 GTF3C3 "Uncharacterized protei 0.353 0.323 0.272 3.8e-44
UNIPROTKB|E1BPR9886 GTF3C3 "Uncharacterized protei 0.485 0.443 0.254 1.5e-43
UNIPROTKB|Q9Y5Q9886 GTF3C3 "General transcription 0.485 0.443 0.245 1e-42
UNIPROTKB|F1NEE6913 GTF3C3 "Uncharacterized protei 0.329 0.292 0.278 6.2e-42
POMBASE|SPCC16C4.14c1006 sfc4 "transcription factor TFI 0.195 0.157 0.366 1.5e-31
ZFIN|ZDB-GENE-040914-80334 gtf3c3 "general transcription 0.313 0.760 0.293 8.2e-28
TAIR|locus:2007928 AT1G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1019 (363.8 bits), Expect = 4.0e-164, Sum P(2) = 4.0e-164
 Identities = 194/310 (62%), Positives = 249/310 (80%)

Query:   501 VEWHSDDTDDESQQEAFREPPLPNLLKNEENQCLIIDLCKALASLQRYEEASEIINLSMR 560
             ++ H++D   ES++E         ++K+EE   L +DLCKALASLQRY EA EI+NL+ R
Sbjct:   599 IKAHNEDVCSESEEE---------VIKDEEYHRLFVDLCKALASLQRYWEALEIVNLARR 649

Query:   561 LAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQLHPYSLSAWNCYYKVLSRMG 620
             L   +LP+E K+EL+SLGAK++ D+ DP   FDC + ++Q HPY L+AWNCYY V+SR+G
Sbjct:   650 LDAKMLPVETKKELQSLGAKISCDTMDPKQWFDCVRSVIQQHPYRLNAWNCYYSVISRLG 709

Query:   621 KINSKHSKHSKFIRYLRAKYKDCVPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLI 680
             K   + S  +KF+ +LR+KY+DCVPPI+I+GH FT+ S HQDAAR YLEAYKL+PE+PLI
Sbjct:   710 K---RASTEAKFMHHLRSKYRDCVPPILIAGHHFTVTSRHQDAAREYLEAYKLMPESPLI 766

Query:   681 NLCVGSALINLALGFRLQNKHQCLAQGFAFLYNNLRLCEHSQEALYNIARACHHVGLVSL 740
             NLCVG+ALINLALGFRL+N+H+CLAQGFAFLYNNLR+C +SQEALYN+ARA  HVGLV+L
Sbjct:   767 NLCVGAALINLALGFRLKNRHECLAQGFAFLYNNLRICSNSQEALYNVARAYQHVGLVTL 826

Query:   741 AASYYEKVLAIKEKDYPIPKHNDKRPDLMESGESGYCDLQREAAYNLHLIYKNSGAVDLA 800
             AASYYEKVLAI EKDY +PK  ++ P + E  +   CDL++EAA+NLHLIYK+SGA DLA
Sbjct:   827 AASYYEKVLAIYEKDYTMPKLPNEDPIVAEERKPVNCDLRKEAAHNLHLIYKHSGAFDLA 886

Query:   801 RQLLKDYCTF 810
             RQ+LKD+CTF
Sbjct:   887 RQVLKDHCTF 896


GO:0005634 "nucleus" evidence=ISM
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0048522 "positive regulation of cellular process" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
DICTYBASE|DDB_G0278321 gtf3C3 "transcription factor IIIC-gamma subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAX1 GTF3C3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309185 Gtf3c3 "general transcription factor IIIC, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYG3 GTF3C3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPR9 GTF3C3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5Q9 GTF3C3 "General transcription factor 3C polypeptide 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEE6 GTF3C3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
POMBASE|SPCC16C4.14c sfc4 "transcription factor TFIIIC complex subunit Sfc4" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040914-80 gtf3c3 "general transcription factor IIIC, polypeptide 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00002119001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (902 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query810
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-18
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-13
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-12
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-09
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-09
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 3e-08
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-07
PRK114471157 PRK11447, PRK11447, cellulose synthase subunit Bcs 7e-07
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 3e-06
PRK11788389 PRK11788, PRK11788, tetratricopeptide repeat prote 4e-06
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-05
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 8e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 0.002
PRK114471157 PRK11447, PRK11447, cellulose synthase subunit Bcs 0.002
PRK09782987 PRK09782, PRK09782, bacteriophage N4 receptor, out 0.002
TIGR03939800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 0.004
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
 Score = 90.1 bits (224), Expect = 2e-18
 Identities = 83/365 (22%), Positives = 150/365 (41%), Gaps = 42/365 (11%)

Query: 40  ASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPK 99
           AS+Q   G  ++AI+ L   + L P+ P   + LG A+ ALG+ + A ++   A  L P+
Sbjct: 336 ASIQLRLGRVDEAIATLSPALGLDPDDPAALSLLGEAYLALGDFEKAAEYLAKATELDPE 395

Query: 100 DSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEK------ 153
           ++A   QL    + +GD ++A+  +  A + +P+     + L   Y+  G ++K      
Sbjct: 396 NAAARTQLGISKLSQGDPSEAIADLETAAQLDPELGRADLLLILSYLRSGQFDKALAAAK 455

Query: 154 ----------------------------AAESYEQIQKLFPDNVDATKTGAQLFLKCGQT 185
                                       A E++E+   + PD   A    A++ ++ G  
Sbjct: 456 KLEKKQPDNASLHNLLGAIYLGKGDLAKAREAFEKALSIEPDFFPAAANLARIDIQEGNP 515

Query: 186 ARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKL 245
             +I   E+ L + P   +L  I  L  + +     E+ +  +E A       +  P   
Sbjct: 516 DDAIQRFEKVLTIDPK--NLRAILALAGLYLRTGNEEEAVAWLEKA-AELNPQEIEPALA 572

Query: 246 KVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYYHFLE 305
             +    YL  G ++KA  +  +     A D  +    +    ++ G  N A+  +  L 
Sbjct: 573 LAQY---YLGKGQLKKALAILNEAA-DAAPDSPEAWLMLGRAQLAAGDLNKAVSSFKKLL 628

Query: 306 TNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEE 365
                D+    L LA+ Y  +K  A AI    +AL+   DN +A++ LA LLL   + E 
Sbjct: 629 ALQP-DSALALLLLADAYAVMKNYAKAITSLKRALELKPDNTEAQIGLAQLLLAAKRTES 687

Query: 366 AITLL 370
           A  + 
Sbjct: 688 AKKIA 692


This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator. Length = 899

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|236624 PRK09782, PRK09782, bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 810
KOG2076895 consensus RNA polymerase III transcription factor 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG0547606 consensus Translocase of outer mitochondrial membr 99.96
PRK14574822 hmsH outer membrane protein; Provisional 99.96
KOG2076895 consensus RNA polymerase III transcription factor 99.95
PLN03077 857 Protein ECB2; Provisional 99.95
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.94
PLN03077 857 Protein ECB2; Provisional 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.92
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.92
PRK14574 822 hmsH outer membrane protein; Provisional 99.92
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.92
PLN032181060 maturation of RBCL 1; Provisional 99.92
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.92
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.92
PLN032181060 maturation of RBCL 1; Provisional 99.91
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.91
KOG2003840 consensus TPR repeat-containing protein [General f 99.9
KOG2003840 consensus TPR repeat-containing protein [General f 99.9
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.89
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.89
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.88
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.88
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.88
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.86
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.85
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.85
PRK12370553 invasion protein regulator; Provisional 99.85
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.84
PRK11189296 lipoprotein NlpI; Provisional 99.84
KOG1129478 consensus TPR repeat-containing protein [General f 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
KOG1915677 consensus Cell cycle control protein (crooked neck 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.78
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
KOG1125579 consensus TPR repeat-containing protein [General f 99.77
KOG2376652 consensus Signal recognition particle, subunit Srp 99.77
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.76
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.76
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.73
PLN02789320 farnesyltranstransferase 99.72
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.72
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
KOG1915677 consensus Cell cycle control protein (crooked neck 99.69
PLN02789320 farnesyltranstransferase 99.69
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.65
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.64
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.63
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.6
PRK15359144 type III secretion system chaperone protein SscB; 99.59
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.59
KOG2376652 consensus Signal recognition particle, subunit Srp 99.57
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.54
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.53
PRK15359144 type III secretion system chaperone protein SscB; 99.52
PRK10370198 formate-dependent nitrite reductase complex subuni 99.52
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.51
PRK10370198 formate-dependent nitrite reductase complex subuni 99.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.48
PRK04841903 transcriptional regulator MalT; Provisional 99.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.46
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.43
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.42
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.42
PRK04841903 transcriptional regulator MalT; Provisional 99.41
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.41
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.4
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.38
KOG0553304 consensus TPR repeat-containing protein [General f 99.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.37
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.36
KOG1128777 consensus Uncharacterized conserved protein, conta 99.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.32
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.3
KOG1128777 consensus Uncharacterized conserved protein, conta 99.29
KOG0553304 consensus TPR repeat-containing protein [General f 99.25
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.23
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.23
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.22
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.13
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.12
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.11
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.1
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.07
KOG1941518 consensus Acetylcholine receptor-associated protei 99.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.02
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.02
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.01
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.01
KOG2053932 consensus Mitochondrial inheritance and actin cyto 99.01
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.97
KOG1941518 consensus Acetylcholine receptor-associated protei 98.93
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.93
PRK11906458 transcriptional regulator; Provisional 98.92
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.92
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.92
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.91
PRK15331165 chaperone protein SicA; Provisional 98.91
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.89
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.89
PRK15331165 chaperone protein SicA; Provisional 98.89
PRK11906458 transcriptional regulator; Provisional 98.88
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.87
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.87
COG3898531 Uncharacterized membrane-bound protein [Function u 98.87
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.86
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.86
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.85
PRK10803263 tol-pal system protein YbgF; Provisional 98.82
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.81
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.81
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.79
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.78
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.76
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.76
PRK10803263 tol-pal system protein YbgF; Provisional 98.74
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.73
KOG2471696 consensus TPR repeat-containing protein [General f 98.72
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.71
COG3898531 Uncharacterized membrane-bound protein [Function u 98.71
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.68
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.67
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.67
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.66
KOG4648536 consensus Uncharacterized conserved protein, conta 98.66
PF12688120 TPR_5: Tetratrico peptide repeat 98.66
KOG4234271 consensus TPR repeat-containing protein [General f 98.65
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.64
COG4700251 Uncharacterized protein conserved in bacteria cont 98.58
KOG4648536 consensus Uncharacterized conserved protein, conta 98.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.57
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.57
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.55
PF12688120 TPR_5: Tetratrico peptide repeat 98.54
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.54
PF13512142 TPR_18: Tetratricopeptide repeat 98.52
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.52
COG4700251 Uncharacterized protein conserved in bacteria cont 98.52
PF1337173 TPR_9: Tetratricopeptide repeat 98.48
PF1337173 TPR_9: Tetratricopeptide repeat 98.47
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.44
KOG2471696 consensus TPR repeat-containing protein [General f 98.44
KOG4234271 consensus TPR repeat-containing protein [General f 98.38
PF13512142 TPR_18: Tetratricopeptide repeat 98.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.31
KOG4507886 consensus Uncharacterized conserved protein, conta 98.3
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.24
KOG1586288 consensus Protein required for fusion of vesicles 98.22
KOG4555175 consensus TPR repeat-containing protein [Function 98.22
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.2
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.19
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.18
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.18
KOG1586288 consensus Protein required for fusion of vesicles 98.09
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.09
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.08
KOG1258577 consensus mRNA processing protein [RNA processing 98.07
KOG4555175 consensus TPR repeat-containing protein [Function 98.07
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.07
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.07
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.99
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.98
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.97
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.97
KOG1258577 consensus mRNA processing protein [RNA processing 97.96
PF1342844 TPR_14: Tetratricopeptide repeat 97.96
KOG1585308 consensus Protein required for fusion of vesicles 97.9
PF1342844 TPR_14: Tetratricopeptide repeat 97.9
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.86
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.81
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.81
KOG1550552 consensus Extracellular protein SEL-1 and related 97.81
KOG1585308 consensus Protein required for fusion of vesicles 97.79
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.79
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.75
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.75
PF1343134 TPR_17: Tetratricopeptide repeat 97.75
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.7
KOG20411189 consensus WD40 repeat protein [General function pr 97.69
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.69
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.69
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.67
KOG1550552 consensus Extracellular protein SEL-1 and related 97.65
KOG4507886 consensus Uncharacterized conserved protein, conta 97.62
PF1343134 TPR_17: Tetratricopeptide repeat 97.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.59
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.59
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.58
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.55
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.46
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.44
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.39
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.39
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.39
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.39
KOG20411189 consensus WD40 repeat protein [General function pr 97.37
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.36
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.36
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.32
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.28
PRK11619644 lytic murein transglycosylase; Provisional 97.24
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.22
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.22
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.18
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.18
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.18
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.16
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.15
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.11
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.11
COG4649221 Uncharacterized protein conserved in bacteria [Fun 97.04
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.03
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.94
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.94
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.94
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.84
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.82
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.82
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.78
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.76
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.66
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.62
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.6
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.57
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.51
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.5
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.45
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.43
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.42
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.41
COG5159421 RPN6 26S proteasome regulatory complex component [ 96.26
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.24
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.18
PRK11619644 lytic murein transglycosylase; Provisional 96.1
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.09
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.93
KOG1310758 consensus WD40 repeat protein [General function pr 95.78
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.76
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.74
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.72
PRK10941269 hypothetical protein; Provisional 95.72
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.67
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.65
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.58
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.57
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.52
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.52
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.49
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.44
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.41
PRK10941269 hypothetical protein; Provisional 95.22
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.07
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.96
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 94.63
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.58
KOG3364149 consensus Membrane protein involved in organellar 94.58
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.57
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.55
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.55
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.1
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 93.96
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.94
KOG3783546 consensus Uncharacterized conserved protein [Funct 93.94
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.87
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.75
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.59
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.54
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.52
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.51
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.49
KOG2422665 consensus Uncharacterized conserved protein [Funct 93.48
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 93.3
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.16
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.11
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 92.94
KOG1463411 consensus 26S proteasome regulatory complex, subun 92.93
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.39
KOG4814872 consensus Uncharacterized conserved protein [Funct 92.35
KOG3364149 consensus Membrane protein involved in organellar 92.28
COG1747711 Uncharacterized N-terminal domain of the transcrip 92.19
COG5191435 Uncharacterized conserved protein, contains HAT (H 91.98
KOG2581493 consensus 26S proteasome regulatory complex, subun 91.34
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.19
KOG1310758 consensus WD40 repeat protein [General function pr 91.04
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 90.99
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 90.91
KOG4814872 consensus Uncharacterized conserved protein [Funct 90.73
COG5159421 RPN6 26S proteasome regulatory complex component [ 90.7
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 90.67
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.51
COG5191435 Uncharacterized conserved protein, contains HAT (H 90.35
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.27
COG2912269 Uncharacterized conserved protein [Function unknow 90.25
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.03
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.92
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 89.8
PRK12798421 chemotaxis protein; Reviewed 89.38
KOG0529421 consensus Protein geranylgeranyltransferase type I 88.41
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.38
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.28
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 88.24
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.24
COG3629280 DnrI DNA-binding transcriptional activator of the 88.05
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.92
COG3629280 DnrI DNA-binding transcriptional activator of the 87.59
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.31
COG2912269 Uncharacterized conserved protein [Function unknow 86.59
COG4941415 Predicted RNA polymerase sigma factor containing a 85.06
PF1304150 PPR_2: PPR repeat family 85.05
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 84.9
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 84.28
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.14
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 84.09
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 83.51
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 83.38
KOG4014248 consensus Uncharacterized conserved protein (conta 82.88
KOG2581493 consensus 26S proteasome regulatory complex, subun 81.15
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.04
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 80.94
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 80.27
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
Probab=100.00  E-value=3.1e-89  Score=713.10  Aligned_cols=738  Identities=33%  Similarity=0.503  Sum_probs=614.5

Q ss_pred             hhccccccCCCCCCCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHcCChHHHHHHHH
Q 003563           12 FSQLNKKRGRRKGSKNKLSPGVTKMLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYV   91 (810)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~   91 (810)
                      .+.+.+++++....+..+++++..++++|+.++..|++++|..++.++|+++|.++.+|+.||.+|.++|+.++|..++.
T Consensus       118 ~s~~~~k~~~~~r~~~~l~~~l~~ll~eAN~lfarg~~eeA~~i~~EvIkqdp~~~~ay~tL~~IyEqrGd~eK~l~~~l  197 (895)
T KOG2076|consen  118 KSTGTKKRGRRSRGKSKLAPELRQLLGEANNLFARGDLEEAEEILMEVIKQDPRNPIAYYTLGEIYEQRGDIEKALNFWL  197 (895)
T ss_pred             ecccCCccCCCCCcccccCHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCccchhhHHHHHHHHHHcccHHHHHHHHH
Confidence            44556666777777889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC---
Q 003563           92 IAAHLSPKDSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDN---  168 (810)
Q Consensus        92 ~a~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~---  168 (810)
                      .|.+++|++.+.|..++....++|++++|.-||.+|++.+|.+....+..+.+|.+.|+...|.+.|.+++...|..   
T Consensus       198 lAAHL~p~d~e~W~~ladls~~~~~i~qA~~cy~rAI~~~p~n~~~~~ers~L~~~~G~~~~Am~~f~~l~~~~p~~d~e  277 (895)
T KOG2076|consen  198 LAAHLNPKDYELWKRLADLSEQLGNINQARYCYSRAIQANPSNWELIYERSSLYQKTGDLKRAMETFLQLLQLDPPVDIE  277 (895)
T ss_pred             HHHhcCCCChHHHHHHHHHHHhcccHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHhChHHHHHHHHHHHHhhCCchhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999932   


Q ss_pred             --HHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHH-------------
Q 003563          169 --VDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQI-------------  233 (810)
Q Consensus       169 --~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~-------------  233 (810)
                        .+.....+..+...++-+.|++.++.++....+......++.++.+++....++.|.........             
T Consensus       278 r~~d~i~~~~~~~~~~~~~e~a~~~le~~~s~~~~~~~~ed~ni~ael~l~~~q~d~~~~~i~~~~~r~~e~d~~e~~~~  357 (895)
T KOG2076|consen  278 RIEDLIRRVAHYFITHNERERAAKALEGALSKEKDEASLEDLNILAELFLKNKQSDKALMKIVDDRNRESEKDDSEWDTD  357 (895)
T ss_pred             HHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhccccccccHHHHHHHHHHHhHHHHHhhHHHHHHhccccCCChhhhhhh
Confidence              13344567888888888999999999998554444434688999999999999999998877655             


Q ss_pred             ---------HhcCCCC--CcHHH-HHHHHHHHHhcCCHHHHHHHHHHhhccCCchhHhHHHHHHHHHHHcCCcHHHHHHH
Q 003563          234 ---------VRFSGKE--LPLKL-KVKAGICYLRLGNMEKAEILFADLQWKNAIDHADLITEVADTLMSLGHSNSALKYY  301 (810)
Q Consensus       234 ---------~~~~~~~--~~~~~-~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~  301 (810)
                               ..+.+..  ....+ +..++.+..+.++..+++.++...-...+.+.++.++.++.++...|++.+|+.+|
T Consensus       358 ~~~~~~~~~~~~~~~~~s~~l~v~rl~icL~~L~~~e~~e~ll~~l~~~n~~~~d~~dL~~d~a~al~~~~~~~~Al~~l  437 (895)
T KOG2076|consen  358 ERRREEPNALCEVGKELSYDLRVIRLMICLVHLKERELLEALLHFLVEDNVWVSDDVDLYLDLADALTNIGKYKEALRLL  437 (895)
T ss_pred             hhccccccccccCCCCCCccchhHhHhhhhhcccccchHHHHHHHHHHhcCChhhhHHHHHHHHHHHHhcccHHHHHHHH
Confidence                     1111111  22233 44555555566666666666665444447778999999999999999999999999


Q ss_pred             HHHHhccCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHcCCHHHHHHhcCCCCCCCcccC
Q 003563          302 HFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAITLLSPPKDLDSLDM  381 (810)
Q Consensus       302 ~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~  381 (810)
                      ..+.......+..+|+.+|.||..+|.+++|+++|++++...|++.+++..|+.++.++|++++|.+.+++....++.+.
T Consensus       438 ~~i~~~~~~~~~~vw~~~a~c~~~l~e~e~A~e~y~kvl~~~p~~~D~Ri~Lasl~~~~g~~EkalEtL~~~~~~D~~~~  517 (895)
T KOG2076|consen  438 SPITNREGYQNAFVWYKLARCYMELGEYEEAIEFYEKVLILAPDNLDARITLASLYQQLGNHEKALETLEQIINPDGRNA  517 (895)
T ss_pred             HHHhcCccccchhhhHHHHHHHHHHhhHHHHHHHHHHHHhcCCCchhhhhhHHHHHHhcCCHHHHHHHHhcccCCCccch
Confidence            99997756667889999999999999999999999999999999999999999999999999999999999987666544


Q ss_pred             CCCCCChhhhHHHHHHHHHHHHHhcCCchhHHhhhhhhhhhhHHHHHHHHHhhhhhccchhhHHHHHhHhcCCCCCcccc
Q 003563          382 NSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCESLCVEALRQKVKVKRRLTKGILQQRTKIYNNLPTDSILC  461 (810)
Q Consensus       382 ~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  461 (810)
                      .   ...||++.++...+..+|...|+.++.+.+...++..........++.+++++....         .        .
T Consensus       518 e---~~a~~~e~ri~~~r~d~l~~~gk~E~fi~t~~~Lv~~~~~~~~~f~~~~k~r~~~~~---------~--------~  577 (895)
T KOG2076|consen  518 E---ACAWEPERRILAHRCDILFQVGKREEFINTASTLVDDFLKKRYIFPRNKKKRRRAIA---------G--------T  577 (895)
T ss_pred             h---hccccHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhcchHHHHHHHhhc---------c--------c
Confidence            3   567888999999999999999999999999999998877655543333222211100         0        0


Q ss_pred             CCCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCC--CCCCchhhhhccCCCCCCCCCCchhhHHHHHHHH
Q 003563          462 GIRPAAPKSELLVAARARKKIQKKEALKEEKKALAKAAGVEWHS--DDTDDESQQEAFREPPLPNLLKNEENQCLIIDLC  539 (810)
Q Consensus       462 ~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  539 (810)
                      +......+.+....  ....                  +..|..  ....++   .++.....++ ++.++|++++..+.
T Consensus       578 ~~~~~~~~~~~~~~--~~~k------------------~~~~~~~~~~l~d~---~~~~~~e~~~-Lsiddwfel~~e~i  633 (895)
T KOG2076|consen  578 TSKRYSELLKQIIR--AREK------------------ATDDNVMEKALSDG---TEFRAVELRG-LSIDDWFELFRELI  633 (895)
T ss_pred             cccccchhHHHHHH--HHhc------------------cCchHHhhhcccch---hhhhhhhhcc-CcHHHHHHHHHHHH
Confidence            00000011111100  0000                  000000  000000   1122233333 57789999999999


Q ss_pred             HHHHhhhcHHHHHHHHHHHHhhhhccCChhHHHHHHHhhhhhhccccCCchhHHHHHHHHHh-----CCCChhHhHHHHH
Q 003563          540 KALASLQRYEEASEIINLSMRLAYNILPLEKKEELRSLGAKMAYDSTDPNHGFDCAKYILQL-----HPYSLSAWNCYYK  614 (810)
Q Consensus       540 ~~~~~~~~~~eA~~~~~~al~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~a~~~~r~~~~~-----~p~~~~~~~~~~~  614 (810)
                      .++.+.++++||+.++..|+....+.+++++...+.++++.|++..+|+..|++++|.++..     +|.....||+...
T Consensus       634 ~~L~k~~r~qeAl~vv~~a~~~~~f~~~~~~~k~l~~~~l~~s~~~~d~~~a~~~lR~~i~~~~~~~~~~q~~l~n~~~s  713 (895)
T KOG2076|consen  634 LSLAKLQRVQEALSVVFTALEAYIFFQDSEIRKELQFLGLKASLYARDPGDAFSYLRSVITQFQFYLDVYQLNLWNLDFS  713 (895)
T ss_pred             HHHHHHHhHHHHHHHHHHHHhhhhhhccHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHH
Confidence            99999999999999999999998887888888899999999999999999999999999999     8888999997666


Q ss_pred             HHHhhcccccccchhhHHHHHHHHhcCCC-CCchhhhcchhhhccchHHHHHHHHHHHhhCCCChHHHHHHHHHHHHHHh
Q 003563          615 VLSRMGKINSKHSKHSKFIRYLRAKYKDC-VPPIIISGHQFTMASHHQDAARCYLEAYKLLPENPLINLCVGSALINLAL  693 (810)
Q Consensus       615 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~~-~~~~~~~g~~~~~~~~~~~Ai~~y~~a~~~~p~~p~~~l~l~~~~~~~~~  693 (810)
                      +++..++    .+...+++.+++.++|++ +|+.+++||+++.+++|..|+++|++|+..+|++|++++|||++|+|+|+
T Consensus       714 ~~~~~~q----~v~~~R~~~~~~~~~~~~~~~l~~i~gh~~~~~~s~~~Al~~y~ra~~~~pd~Pl~nl~lglafih~a~  789 (895)
T KOG2076|consen  714 YFSKYGQ----RVCYLRLIMRLLVKNKDDTPPLALIYGHNLFVNASFKHALQEYMRAFRQNPDSPLINLCLGLAFIHLAL  789 (895)
T ss_pred             HHHHHHH----HHHHHHHHHHHhccCccCCcceeeeechhHhhccchHHHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHH
Confidence            6666666    467788888988899987 66668889999999999999999999999999999999999999999999


Q ss_pred             CccccchhHHHHHHHHHHHHhHhhcCC--CchhhhhHHHHHHHhChhhHHHHHHHHHhccccccCCCCCCCCCCCccccc
Q 003563          694 GFRLQNKHQCLAQGFAFLYNNLRLCEH--SQEALYNIARACHHVGLVSLAASYYEKVLAIKEKDYPIPKHNDKRPDLMES  771 (810)
Q Consensus       694 ~r~~~~r~~~~~q~~~~l~~y~~~~~~--~~e~~ynlgr~~~~lg~~~~Ai~~Y~~vL~~~~~~~~~~~~~~~~~~~~~~  771 (810)
                      ||.+.+||.+|.|||+|+++|.++|..  +||+.|||||+||++|+.|+|++||+|||+++|....             +
T Consensus       790 qr~v~~Rh~~i~qG~afL~RY~~lR~~~~~QEa~YNigRayh~~gl~~LA~~YYekvL~~~p~~~~-------------~  856 (895)
T KOG2076|consen  790 QRRVSNRHAQIAQGFAFLKRYKELRRCEEKQEAFYNIGRAYHQIGLVHLAVSYYEKVLEVSPKDVT-------------D  856 (895)
T ss_pred             HHHHhhhHHHHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHhCCCccccc-------------c
Confidence            999999999999999999999999887  8999999999999999999999999999999875321             1


Q ss_pred             CCCCcccccHHHHHHHHHHHHhcCCHHHHHHHHHhhccC
Q 003563          772 GESGYCDLQREAAYNLHLIYKNSGAVDLARQLLKDYCTF  810 (810)
Q Consensus       772 ~~~~~~~l~~eaa~nl~~iy~~~g~~~~A~~~~~~~~~~  810 (810)
                      ...+++||+++|||||++||+.|||..+|+++++|||+|
T Consensus       857 ~~~d~~dLrkeAA~NL~LIY~~SGn~~lArqil~kyl~~  895 (895)
T KOG2076|consen  857 PKEDNYDLRKEAAYNLHLIYKKSGNMQLARQILEKYLVF  895 (895)
T ss_pred             ccCCcccHHHHHHhhhhhhhccCCcHHHHHHHHHhhccC
Confidence            122579999999999999999999999999999999997



>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query810
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 4e-11
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-04
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 7e-08
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 4e-09
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 3e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-09
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-06
2pl2_A217 Crystal Structure Of Ttc0263: A Thermophilic Tpr Pr 7e-06
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 9e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-04
1zbp_A273 X-Ray Crystal Structure Of Protein Vpa1032 From Vib 3e-04
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 8e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 33/120 (27%), Positives = 65/120 (54%) Query: 47 GNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQ 106 G++++AI ++ + L P E + LG A+ G++ A ++Y A L P+ + W Sbjct: 15 GDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYN 74 Query: 107 LLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFP 166 L ++GD +A+ Y ++A+ +P+ +L + Y + GDY++A E Y++ +L P Sbjct: 75 LGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDP 134
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2PL2|A Chain A, Crystal Structure Of Ttc0263: A Thermophilic Tpr Protein In Thermus Thermophilus Hb27 Length = 217 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1ZBP|A Chain A, X-Ray Crystal Structure Of Protein Vpa1032 From Vibrio Parahaemolyticus. Northeast Structural Genomics Consortium Target Vpr44 Length = 273 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query810
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-20
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-12
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-09
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-18
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 6e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-05
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-16
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-14
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-16
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-16
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-16
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-16
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-12
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-12
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-16
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-13
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 7e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-09
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 9e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 7e-08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 6e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 9e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 1e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  100 bits (252), Expect = 7e-23
 Identities = 67/340 (19%), Positives = 119/340 (35%), Gaps = 32/340 (9%)

Query: 40  ASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPK 99
           +S+ +     +++       ++ +P L E Y+ LG  +   G  + A + Y  A  L P 
Sbjct: 40  SSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD 99

Query: 100 DSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYE 159
               +  L    V  GD   A+     A++  P    +R  L +    +G  E+A   Y 
Sbjct: 100 FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL 159

Query: 160 QIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDADLSVIDLLVAILMENN 219
           +  +  P+   A      +F   G+   +I   E+ + + P+  D      L  +L E  
Sbjct: 160 KAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEAR 217

Query: 220 AYEKTLQHIEHAQIVRFSGKELPLKLK---VKA----GICYLRLGNMEKAEILFADLQWK 272
            +++ +     A           L L              Y   G ++ A   +     +
Sbjct: 218 IFDRAVAAYLRA-----------LSLSPNHAVVHGNLACVYYEQGLIDLAIDTY-----R 261

Query: 273 NAI----DHADLITEVADTLMSLGHSNSALKYY-HFLETNAGTDNGYLYLKLAECYLSLK 327
            AI       D    +A+ L   G    A   Y   L       +      LA       
Sbjct: 262 RAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCP--THADSLNNLANIKREQG 319

Query: 328 ERAHAIMFFYKALDRFEDNIDARLTLASLLLEEAKEEEAI 367
               A+  + KAL+ F +   A   LAS+L ++ K +EA+
Sbjct: 320 NIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL 359


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 810
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-17
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-12
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-04
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 5e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 5e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.001
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.002
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 81.3 bits (199), Expect = 6e-17
 Identities = 38/165 (23%), Positives = 69/165 (41%)

Query: 40  ASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPK 99
            ++      F++A++     + LSPN    +  L   +   G    A D Y  A  L P 
Sbjct: 210 GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH 269

Query: 100 DSALWKQLLTFAVQKGDTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYE 159
               +  L     +KG  A+A      A+R  P       +LA+   E G+ E+A   Y 
Sbjct: 270 FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYR 329

Query: 160 QIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEYLKVHPSDAD 204
           +  ++FP+   A    A +  + G+   ++   +E +++ P+ AD
Sbjct: 330 KALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD 374


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query810
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 100.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.94
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.93
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.9
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.79
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.77
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.77
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.76
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.73
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.72
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.7
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.65
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.64
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.61
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.56
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.55
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.55
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.53
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.4
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.39
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.38
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.25
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.16
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.16
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.95
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.91
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.84
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 98.63
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.18
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.01
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.0
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.74
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.64
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.39
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 83.83
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.1e-44  Score=272.70  Aligned_cols=368  Identities=18%  Similarity=0.141  Sum_probs=325.7

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999999982998999999999998399994899999999998599289999999998209999999999999999749
Q 003563           36 MLGEASLQYAYGNFEQAISLLKEVVRLSPNLPETYNTLGLAHSALGNHKSAFDFYVIAAHLSPKDSALWKQLLTFAVQKG  115 (810)
Q Consensus        36 ~l~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~la~~~~~~g  115 (810)
                      ++..|..++..|+|++|+..++++++.+|+++.++..+|.++...|++++|+..++++++.+|.++.+|..+|.++...|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             69999999986999999999999998689989999999999998699999999999999859998999999999964200


Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             98999999999998099997789999999998099989999999999869999899999999999839947999999998
Q 003563          116 DTAQAMYYIRQAIRAEPKDISLRIHLASFYVEIGDYEKAAESYEQIQKLFPDNVDATKTGAQLFLKCGQTARSIGILEEY  195 (810)
Q Consensus       116 ~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~  195 (810)
                      ++++|+..+..+....|.........+......+....+...........+.........+......+....+...+.+.
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKA  161 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             02222222221211222222222222222222222222222211122222222222222222221100013567888874


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCC
Q ss_conf             85199999958999999999972799999999999999830799882888999999999639988999999982100870
Q 003563          196 LKVHPSDADLSVIDLLVAILMENNAYEKTLQHIEHAQIVRFSGKELPLKLKVKAGICYLRLGNMEKAEILFADLQWKNAI  275 (810)
Q Consensus       196 l~~~p~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~  275 (810)
                      +...|....  .+..+|..+...|++++|...+++++..    .|....++..+|.++...|++++|+..+++.....+.
T Consensus       162 ~~~~~~~~~--~~~~l~~~~~~~~~~~~A~~~~~~al~~----~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~  235 (388)
T d1w3ba_         162 IETQPNFAV--AWSNLGCVFNAQGEIWLAIHHFEKAVTL----DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN  235 (388)
T ss_dssp             HHHCTTCHH--HHHHHHHHHHTTTCHHHHHHHHHHHHHH----CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT
T ss_pred             HCCCCCHHH--HHHHHCCCCCCCCCHHHHHHHHHHHHHH----CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             025861068--9986363010247199999999999984----9464999999715522005299999999985777554


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             36758999999999849909999999998733598988989999999998018999999999998624999999999999
Q 003563          276 DHADLITEVADTLMSLGHSNSALKYYHFLETNAGTDNGYLYLKLAECYLSLKERAHAIMFFYKALDRFEDNIDARLTLAS  355 (810)
Q Consensus       276 ~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~  355 (810)
                       ....+..+|.++...|++++|+..|++++.. .|.++.++..+|.++...|++++|+..++.++...|.+...+..++.
T Consensus       236 -~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~  313 (388)
T d1w3ba_         236 -HAVVHGNLACVYYEQGLIDLAIDTYRRAIEL-QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLAN  313 (388)
T ss_dssp             -CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT-CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             -HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             -7999999999999878999999999999984-99989999999999997487999999998654048730010157999


Q ss_pred             HHHHCCCHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             99980998889872599988785347888898145678999999799983599656786556655656
Q 003563          356 LLLEEAKEEEAITLLSPPKDLDSLDMNSDKSNPWWLNEKIIMKLCHIYRAKGMPEDFVDAIFPLVCES  423 (810)
Q Consensus       356 ~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~  423 (810)
                      ++...|++++|+..++++++..|.++            .+++.+|.+|...|++++|+..++++++..
T Consensus       314 ~~~~~~~~~~A~~~~~~al~~~p~~~------------~~~~~la~~~~~~g~~~~A~~~~~~al~l~  369 (388)
T d1w3ba_         314 IKREQGNIEEAVRLYRKALEVFPEFA------------AAHSNLASVLQQQGKLQEALMHYKEAIRIS  369 (388)
T ss_dssp             HHHTTTCHHHHHHHHHHHTTSCTTCH------------HHHHHHHHHHHTTTCCHHHHHHHHHHHTTC
T ss_pred             HHHHCCCHHHHHHHHHHHHHHCCCCH------------HHHHHHHHHHHHCCCHHHHHHHHHHHHHHC
T ss_conf             99987899999999999998688989------------999999999998599999999999999709



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure