Citrus Sinensis ID: 003687

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800---
MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTSSRPVETLTVP
ccEEEEEcccccEEEEEEEccccEEEccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccEEEHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccEEEEcccccEEEccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
ccEEEEEcccccEEEEEEHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccccccccEEEccccHHHHHHHHHHHHHcccccEEEEEEEEccccccccEEEccHHHccccccccccHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHEHcccEEcHHHHHHHHHHHHHHHHHHEcccccccccccccccccHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccEEEEEEcccHHHEcccEEEcEEEEEcccHHHHHcccHHHHHHHHHHcHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccccEEEEEcccccEEEEccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccHHcEEccEcEEEEEcccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHccccHcccccccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccEEEcc
mpvigvsrsakGYCIISILETMktysledglteDALVTKLRTSRYHHLFLHTslrqntsgtsrwgeygegglLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTvsyenrprplhlgtatqigaiptegipCLLKvllpsncsglpilyvrdlllnppayeIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMdptwvatglkiDFETLVEECRLASVRIGEMisldgesdqkicsydnipsefFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIkattaplggpkgeiLYAREHEAvwfkgkkfrptvwastpgeeqikqlkpavdskgrkvgeEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHvsegrrrkwvfpaLKDIeldganclkmnglspywfdaaegsavhntVDMQSLFlltgpngggksSLLRSICAASLLGICglmvpaesasipyFDAIMLHMksydspadgkssFQVEMSEIRSIVTATTSRSLVLIDEICrgtetakgtciagsiietldnigclgiVSTHLHGIFSLPLKIKNAAYKAMgteyldgqtvptwkLVDGICRESLAFEtakregvpeTIIQRAEDLYIACGVNCVMIaareqpppsiigASCVYVmlrpdkklyigqtddldgrirahrgkegmqsASFLYFVVPGKSIACQIETLLINQLYSQGFLLaniadgkhrnfgtssrpvetltvp
mpvigvsrsakgyCIISILETmktysledGLTEDALVTKLRTSRYHHlflhtslrqntsgtsRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMisldgesdqkICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKattaplggpKGEILYAREHEAVWFKGKKFRPTVwastpgeeqikqlkpavdskgrkvGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFahvsegrrrkWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIvtattsrslvLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAfetakregvpeTIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGkhrnfgtssrpvetltvp
MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRwgeygeggllwgeCIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTSSRPVETLTVP
*******RSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWAS********************VGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKS***************SEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADG******************
*PVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFL******************EGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVT*****RPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISL***********DNIPSEFFEDMESTWK**VK**HIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPT************QLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYI*************************************************************LYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTSSRPV**LT**
********SAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTS**********
MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQN*SGTSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVN*******************VYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTSSRPVETLTVP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPRPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPEFTCLVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKAKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPSIIGASCVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQGFLLANIADGKHRNFGTSSRPVETLTVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query803 2.2.26 [Sep-21-2011]
Q84LK01118 DNA mismatch repair prote yes no 0.988 0.710 0.716 0.0
A5UZK71085 DNA mismatch repair prote yes no 0.444 0.329 0.277 2e-29
Q045Q5857 DNA mismatch repair prote yes no 0.285 0.267 0.334 2e-28
A1VDD9905 DNA mismatch repair prote yes no 0.356 0.316 0.337 2e-28
P61666905 DNA mismatch repair prote yes no 0.356 0.316 0.337 2e-28
A7NPT51088 DNA mismatch repair prote yes no 0.444 0.328 0.273 2e-28
Q30ZX3904 DNA mismatch repair prote yes no 0.357 0.317 0.315 3e-28
Q9KAC0865 DNA mismatch repair prote yes no 0.287 0.267 0.351 4e-28
A6W1Q6883 DNA mismatch repair prote yes no 0.287 0.261 0.344 8e-28
P61668857 DNA mismatch repair prote yes no 0.285 0.267 0.330 1e-27
>sp|Q84LK0|MSH1_ARATH DNA mismatch repair protein MSH1, mitochondrial OS=Arabidopsis thaliana GN=MSH1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1259 bits (3259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/862 (71%), Positives = 697/862 (80%), Gaps = 68/862 (7%)

Query: 1    MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSG 60
            MPV+G+SRSA+GYC+ISI ETMK YSL+DGLTE+ALVTKLRT R HHLFLH SLR N SG
Sbjct: 246  MPVVGISRSARGYCMISIFETMKAYSLDDGLTEEALVTKLRTRRCHHLFLHASLRHNASG 305

Query: 61   TSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRP 120
            T RWGE+GEGGLLWGEC +R+FEWFEGD + ELL +VK++YGL++EV+FRNV V  +NRP
Sbjct: 306  TCRWGEFGEGGLLWGECSSRNFEWFEGDTLSELLSRVKDVYGLDDEVSFRNVNVPSKNRP 365

Query: 121  RPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICK 180
            RPLHLGTATQIGA+PTEGIPCLLKVLLPS CSGLP LYVRDLLLNPPAY+IA  IQ  CK
Sbjct: 366  RPLHLGTATQIGALPTEGIPCLLKVLLPSTCSGLPSLYVRDLLLNPPAYDIALKIQETCK 425

Query: 181  LMSKVTCSIPEFTC-----LVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELL 235
            LMS VTCSIPEFTC     LVKLLE REAN+IEFCRIKNVLD++LHM+ ++EL EIL+LL
Sbjct: 426  LMSTVTCSIPEFTCVSSAKLVKLLEQREANYIEFCRIKNVLDDVLHMHRHAELVEILKLL 485

Query: 236  MDPTWVATGLKIDFETLVEECRLASVRIGEMISLD-GESDQKICSYDNIPSEFFEDMEST 294
            MDPTWVATGLKIDF+T V EC  AS  IGEMISLD  ES Q +   DN+P+EFF DMES+
Sbjct: 486  MDPTWVATGLKIDFDTFVNECHWASDTIGEMISLDENESHQNVSKCDNVPNEFFYDMESS 545

Query: 295  WKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHE 354
            W+GRVK IHIE EI +VE +AEALSLAV EDF PIISRIKATTA LGGPKGEI YAREHE
Sbjct: 546  WRGRVKGIHIEEEITQVEKSAEALSLAVAEDFHPIISRIKATTASLGGPKGEIAYAREHE 605

Query: 355  AVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAK 414
            +VWFKGK+F P++WA T GE+QIKQLKPA+DSKG+KVGEEWF+T KVE AL RYHEA   
Sbjct: 606  SVWFKGKRFTPSIWAGTAGEDQIKQLKPALDSKGKKVGEEWFTTPKVEIALVRYHEASEN 665

Query: 415  AKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELD- 473
            AKA+VLELLR LS +LQTKIN+LVFASMLLVI KALF+H  EGRRRKWVFP L    LD 
Sbjct: 666  AKARVLELLRELSVKLQTKINVLVFASMLLVISKALFSHACEGRRRKWVFPTLVGFSLDE 725

Query: 474  ------GANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAAS 527
                  GA+ +K+ GLSPYWFD + G+AVHNTVDMQSLFLLTGPNGGGKSSLLRSICAA+
Sbjct: 726  GAKPLDGASRMKLTGLSPYWFDVSSGTAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAAA 785

Query: 528  LLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVL 587
            LLGI GLMVPAESA IP+FD+IMLHMKSYDSP DGKSSFQVEMSEIRSIV+  TSRSLVL
Sbjct: 786  LLGISGLMVPAESACIPHFDSIMLHMKSYDSPVDGKSSFQVEMSEIRSIVSQATSRSLVL 845

Query: 588  IDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYL 647
            IDEICRGTETAKGTCIAGS++E+LD  GCLGIVSTHLHGIFSLPL  KN  YKAMG E +
Sbjct: 846  IDEICRGTETAKGTCIAGSVVESLDTSGCLGIVSTHLHGIFSLPLTAKNITYKAMGAENV 905

Query: 648  DGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIA----------------- 690
            +GQT PTWKL DG+CRESLAFETAKREGVPE++IQRAE LY++                 
Sbjct: 906  EGQTKPTWKLTDGVCRESLAFETAKREGVPESVIQRAEALYLSVYAKDASAEVVKPDQII 965

Query: 691  ------------------------------CG--------VNCVMIAAREQPPPSIIGAS 712
                                          CG        + C+ I ARE PPPS +G+S
Sbjct: 966  TSSNNDQQIQKPVSSERSLEKDLAKAIVKICGKKMIEPEAIECLSIGARELPPPSTVGSS 1025

Query: 713  CVYVMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQL 772
            CVYVM RPDK+LYIGQTDDL+GRIRAHR KEG+Q +SFLY +V GKS+ACQ+ETLLINQL
Sbjct: 1026 CVYVMRRPDKRLYIGQTDDLEGRIRAHRAKEGLQGSSFLYLMVQGKSMACQLETLLINQL 1085

Query: 773  YSQGFLLANIADGKHRNFGTSS 794
            + QG+ LAN+ADGKHRNFGTSS
Sbjct: 1086 HEQGYSLANLADGKHRNFGTSS 1107
DNA mismatch repair protein specifically involved in maintenance of mitochondrial genome configuration by controlling specific rearranged portion. Functions by suppressing asymmetric recombination at some repeat pairs.
Arabidopsis thaliana (taxid: 3702)
>sp|A5UZK7|MUTS_ROSS1 DNA mismatch repair protein MutS OS=Roseiflexus sp. (strain RS-1) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|A7NPT5|MUTS_ROSCS DNA mismatch repair protein MutS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|Q30ZX3|MUTS_DESDG DNA mismatch repair protein MutS OS=Desulfovibrio desulfuricans (strain G20) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|A6W1Q6|MUTS_MARMS DNA mismatch repair protein MutS OS=Marinomonas sp. (strain MWYL1) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|P61668|MUTS_LACJO DNA mismatch repair protein MutS OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query803
296083740 1114 unnamed protein product [Vitis vinifera] 0.998 0.719 0.747 0.0
42565155 1118 MUTL protein-like protein 1 [Arabidopsis 0.988 0.710 0.716 0.0
11994694 1016 unnamed protein product [Arabidopsis tha 0.988 0.781 0.716 0.0
297835516 1115 hypothetical protein ARALYDRAFT_479946 [ 0.985 0.709 0.716 0.0
224107525 1130 predicted protein [Populus trichocarpa] 0.859 0.610 0.814 0.0
225433289 1144 PREDICTED: uncharacterized protein LOC10 0.859 0.603 0.809 0.0
255574867 937 ATP binding protein, putative [Ricinus c 0.843 0.722 0.822 0.0
61696673 1124 DNA mismatch repair protein [Solanum lyc 0.856 0.612 0.758 0.0
449433221 1122 PREDICTED: DNA mismatch repair protein M 0.859 0.614 0.757 0.0
351720948 1130 DNA mismatch repair protein [Glycine max 0.855 0.607 0.744 0.0
>gi|296083740|emb|CBI23729.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/867 (74%), Positives = 721/867 (83%), Gaps = 65/867 (7%)

Query: 1    MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSG 60
            MPV+G+SRSAKGY II +LETMKT+S+EDGLTE+ALVTKLRT  YHHL LHTSLR+N+SG
Sbjct: 246  MPVVGISRSAKGYSIILVLETMKTFSVEDGLTEEALVTKLRTCHYHHLLLHTSLRRNSSG 305

Query: 61   TSRWGEYGEGGLLWGECIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRP 120
            T RWGE+GEGGLLWGEC ARHFEWFEGDPV +LL KVKELYG +++VTFRNVTVS E RP
Sbjct: 306  TCRWGEFGEGGLLWGECSARHFEWFEGDPVSQLLFKVKELYGFDDQVTFRNVTVSSEKRP 365

Query: 121  RPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICK 180
            R LHLGTATQIGAIPTEGIPCLLKVLLPSNC+GLP+LYVRDLLLNPPAYEIAS IQA C+
Sbjct: 366  RSLHLGTATQIGAIPTEGIPCLLKVLLPSNCTGLPLLYVRDLLLNPPAYEIASIIQATCR 425

Query: 181  LMSKVTCSIPEFTC-----LVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELL 235
            LM+ VTCSIPEFTC     LVKLLELREANHIEFCRIK+VLDEIL M+ NS+LN+IL+LL
Sbjct: 426  LMNNVTCSIPEFTCVSPAKLVKLLELREANHIEFCRIKSVLDEILQMHRNSDLNKILKLL 485

Query: 236  MDPTWVATGLKIDFETLVEECRLASVRIGEMISLDGESDQKICSYDNIPSEFFEDMESTW 295
            MDPTWVATGLKIDF+TLV EC   S RIG+MI LDGE+DQKI  +  IP++FFEDMES W
Sbjct: 486  MDPTWVATGLKIDFDTLVNECEWISARIGKMIFLDGENDQKISYHPIIPNDFFEDMESPW 545

Query: 296  KGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHEA 355
            KGRVKRIH+E   AEVE AAEALSLA++EDFLPIISRIKATTAPLGGPKGE++YAREHEA
Sbjct: 546  KGRVKRIHVEEAFAEVERAAEALSLAISEDFLPIISRIKATTAPLGGPKGEVVYAREHEA 605

Query: 356  VWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAKA 415
            VWFKGK+F P  WA TPGEEQIKQL+PA+DSKGRKVG EWF+T+KVE+AL RYHEAG KA
Sbjct: 606  VWFKGKRFAPVAWAGTPGEEQIKQLRPAIDSKGRKVGLEWFTTVKVEDALTRYHEAGDKA 665

Query: 416  KAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPAL------KD 469
            KA+VLELLRGLS+ELQTKINIL+FASMLLVI KALFAHVSEGRRRKWVFP+L      KD
Sbjct: 666  KARVLELLRGLSAELQTKINILIFASMLLVIAKALFAHVSEGRRRKWVFPSLVELHRSKD 725

Query: 470  IE-LDGANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASL 528
            +E LDGAN +K+ GLSPYW D A+GSAVHNTVDM+SLFLLTGPNGGGKSSLLRSICAA+L
Sbjct: 726  MEPLDGANWMKITGLSPYWLDVAQGSAVHNTVDMKSLFLLTGPNGGGKSSLLRSICAAAL 785

Query: 529  LGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLI 588
            LGICG MVPAESA IP+FD+IMLHMKSYDSPADGKSSFQ+EMSE+RSI+T  TSRSLVLI
Sbjct: 786  LGICGFMVPAESALIPHFDSIMLHMKSYDSPADGKSSFQIEMSEMRSIITGATSRSLVLI 845

Query: 589  DEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLD 648
            DEICRGTETAKGTCIAGSI+ETLD IGCLGIVSTHLHGIF+L L  KNA  KAMGTEY+D
Sbjct: 846  DEICRGTETAKGTCIAGSIVETLDKIGCLGIVSTHLHGIFTLGLNTKNAICKAMGTEYVD 905

Query: 649  GQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLY--------IACGVNC----- 695
            G+T PTWKL+DGICRESLAFETA++EG+PETII+RAE+LY        I  G  C     
Sbjct: 906  GKTKPTWKLIDGICRESLAFETAQKEGIPETIIRRAEELYLSIHSKDLITGGTICPKIES 965

Query: 696  ----------------------------------------VMIAAREQPPPSIIGASCVY 715
                                                    V I   EQPPPS IGAS VY
Sbjct: 966  TNEMEVLHKKVESAVTIVCQKKLKELYKQKNTSKLPEINCVAILPGEQPPPSTIGASSVY 1025

Query: 716  VMLRPDKKLYIGQTDDLDGRIRAHRGKEGMQSASFLYFVVPGKSIACQIETLLINQLYSQ 775
            V+   DKKLY+G+TDDL+GR+RAHR KEGMQ ASFLYFVVPGKS+ACQ+ETLLINQL  Q
Sbjct: 1026 VLFSTDKKLYVGETDDLEGRVRAHRSKEGMQKASFLYFVVPGKSLACQLETLLINQLPVQ 1085

Query: 776  GFLLANIADGKHRNFGTSSRPVETLTV 802
            GF L N ADGKHRNFGT    VE +T+
Sbjct: 1086 GFQLVNRADGKHRNFGTLDHSVEVVTL 1112

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|42565155|ref|NP_189075.2| MUTL protein-like protein 1 [Arabidopsis thaliana] gi|75297828|sp|Q84LK0.1|MSH1_ARATH RecName: Full=DNA mismatch repair protein MSH1, mitochondrial; Short=AtMSH1; AltName: Full=MutS protein homolog 1; AltName: Full=Protein CHLOROPLAST MUTATOR; Flags: Precursor gi|30313805|gb|AAO49798.1| DNA mismatch repair protein [Arabidopsis thaliana] gi|332643368|gb|AEE76889.1| MUTL protein-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|11994694|dbj|BAB02932.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835516|ref|XP_002885640.1| hypothetical protein ARALYDRAFT_479946 [Arabidopsis lyrata subsp. lyrata] gi|297331480|gb|EFH61899.1| hypothetical protein ARALYDRAFT_479946 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224107525|ref|XP_002314510.1| predicted protein [Populus trichocarpa] gi|222863550|gb|EEF00681.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225433289|ref|XP_002282256.1| PREDICTED: uncharacterized protein LOC100266612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574867|ref|XP_002528340.1| ATP binding protein, putative [Ricinus communis] gi|223532208|gb|EEF34012.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|61696673|gb|AAX53097.1| DNA mismatch repair protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449433221|ref|XP_004134396.1| PREDICTED: DNA mismatch repair protein MSH1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351720948|ref|NP_001238217.1| DNA mismatch repair protein [Glycine max] gi|61696669|gb|AAX53095.1| DNA mismatch repair protein [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query803
TAIR|locus:20871931118 MSH1 "AT3G24320" [Arabidopsis 0.884 0.635 0.736 0.0
UNIPROTKB|Q0JBW21132 Os04g0507000 "Os04g0507000 pro 0.897 0.636 0.644 9.5e-295
TAIR|locus:21322331324 MSH6 "AT4G02070" [Arabidopsis 0.367 0.222 0.331 3e-24
TIGR_CMR|NSE_0335815 NSE_0335 "DNA mismatch repair 0.349 0.344 0.318 4.5e-24
UNIPROTKB|P74926793 mutS "DNA mismatch repair prot 0.369 0.374 0.297 9.1e-24
TIGR_CMR|ECH_0824804 ECH_0824 "DNA mismatch repair 0.242 0.242 0.361 1.2e-23
CGD|CAL0001526873 MSH2 [Candida albicans (taxid: 0.379 0.349 0.272 4.4e-22
UNIPROTKB|Q8TTB4900 mutS "DNA mismatch repair prot 0.256 0.228 0.348 8.2e-22
UNIPROTKB|A9WFZ9966 mutS "DNA mismatch repair prot 0.349 0.290 0.293 2e-21
FB|FBgn0015546917 spel1 "spellchecker1" [Drosoph 0.337 0.295 0.302 2.7e-21
TAIR|locus:2087193 MSH1 "AT3G24320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2711 (959.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 534/725 (73%), Positives = 600/725 (82%)

Query:     1 MPVIGVSRSAKGYCIISILETMKTYSLEDGLTEDALVTKLRTSRYHHLFLHTSLRQNTSG 60
             MPV+G+SRSA+GYC+ISI ETMK YSL+DGLTE+ALVTKLRT R HHLFLH SLR N SG
Sbjct:   246 MPVVGISRSARGYCMISIFETMKAYSLDDGLTEEALVTKLRTRRCHHLFLHASLRHNASG 305

Query:    61 TSRXXXXXXXXXXXXXCIARHFEWFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRP 120
             T R             C +R+FEWFEGD + ELL +VK++YGL++EV+FRNV V  +NRP
Sbjct:   306 TCRWGEFGEGGLLWGECSSRNFEWFEGDTLSELLSRVKDVYGLDDEVSFRNVNVPSKNRP 365

Query:   121 RPLHLGTATQIGAIPTEGIPCLLKVLLPSNCSGLPILYVRDLLLNPPAYEIASTIQAICK 180
             RPLHLGTATQIGA+PTEGIPCLLKVLLPS CSGLP LYVRDLLLNPPAY+IA  IQ  CK
Sbjct:   366 RPLHLGTATQIGALPTEGIPCLLKVLLPSTCSGLPSLYVRDLLLNPPAYDIALKIQETCK 425

Query:   181 LMSKVTCSIPEFTC-----LVKLLELREANHIEFCRIKNVLDEILHMYGNSELNEILELL 235
             LMS VTCSIPEFTC     LVKLLE REAN+IEFCRIKNVLD++LHM+ ++EL EIL+LL
Sbjct:   426 LMSTVTCSIPEFTCVSSAKLVKLLEQREANYIEFCRIKNVLDDVLHMHRHAELVEILKLL 485

Query:   236 MDPTWVATGLKIDFETLVEECRLASVRIGEMISLD-GESDQKICSYDNIPSEFFEDMEST 294
             MDPTWVATGLKIDF+T V EC  AS  IGEMISLD  ES Q +   DN+P+EFF DMES+
Sbjct:   486 MDPTWVATGLKIDFDTFVNECHWASDTIGEMISLDENESHQNVSKCDNVPNEFFYDMESS 545

Query:   295 WKGRVKRIHIEPEIAEVEMAAEALSLAVTEDFLPIISRIKATTAPLGGPKGEILYAREHE 354
             W+GRVK IHIE EI +VE +AEALSLAV EDF PIISRIKATTA LGGPKGEI YAREHE
Sbjct:   546 WRGRVKGIHIEEEITQVEKSAEALSLAVAEDFHPIISRIKATTASLGGPKGEIAYAREHE 605

Query:   355 AVWFKGKKFRPTVWASTPGEEQIKQLKPAVDSKGRKVGEEWFSTLKVEEALERYHEAGAK 414
             +VWFKGK+F P++WA T GE+QIKQLKPA+DSKG+KVGEEWF+T KVE AL RYHEA   
Sbjct:   606 SVWFKGKRFTPSIWAGTAGEDQIKQLKPALDSKGKKVGEEWFTTPKVEIALVRYHEASEN 665

Query:   415 AKAKVLELLRGLSSELQTKINILVFASMLLVIGKALFAHVSEGRRRKWVFPALKDIELD- 473
             AKA+VLELLR LS +LQTKIN+LVFASMLLVI KALF+H  EGRRRKWVFP L    LD 
Sbjct:   666 AKARVLELLRELSVKLQTKINVLVFASMLLVISKALFSHACEGRRRKWVFPTLVGFSLDE 725

Query:   474 ------GANCLKMNGLSPYWFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAAS 527
                   GA+ +K+ GLSPYWFD + G+AVHNTVDMQSLFLLTGPNGGGKSSLLRSICAA+
Sbjct:   726 GAKPLDGASRMKLTGLSPYWFDVSSGTAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAAA 785

Query:   528 LLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVL 587
             LLGI GLMVPAESA IP+FD+IMLHMKSYDSP DGKSSFQVEMSEIRSIV+  TSRSLVL
Sbjct:   786 LLGISGLMVPAESACIPHFDSIMLHMKSYDSPVDGKSSFQVEMSEIRSIVSQATSRSLVL 845

Query:   588 IDEICRGTETAKGTCIAGSIIETLDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYL 647
             IDEICRGTETAKGTCIAGS++E+LD  GCLGIVSTHLHGIFSLPL  KN  YKAMG E +
Sbjct:   846 IDEICRGTETAKGTCIAGSVVESLDTSGCLGIVSTHLHGIFSLPLTAKNITYKAMGAENV 905

Query:   648 DGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVNCVMIAAREQPPPS 707
             +GQT PTWKL DG+CRESLAFETAKREGVPE++IQRAE LY++  V     +A    P  
Sbjct:   906 EGQTKPTWKLTDGVCRESLAFETAKREGVPESVIQRAEALYLS--VYAKDASAEVVKPDQ 963

Query:   708 IIGAS 712
             II +S
Sbjct:   964 IITSS 968
GO:0000228 "nuclear chromosome" evidence=IBA
GO:0000400 "four-way junction DNA binding" evidence=IBA
GO:0000710 "meiotic mismatch repair" evidence=IBA
GO:0003684 "damaged DNA binding" evidence=ISS;IBA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004518 "nuclease activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006200 "ATP catabolic process" evidence=IBA
GO:0006298 "mismatch repair" evidence=ISS
GO:0007131 "reciprocal meiotic recombination" evidence=IBA
GO:0008094 "DNA-dependent ATPase activity" evidence=IBA
GO:0009411 "response to UV" evidence=IBA
GO:0030983 "mismatched DNA binding" evidence=IEA
GO:0032137 "guanine/thymine mispair binding" evidence=IBA
GO:0032138 "single base insertion or deletion binding" evidence=IBA
GO:0032301 "MutSalpha complex" evidence=IBA
GO:0043570 "maintenance of DNA repeat elements" evidence=IBA
GO:0045910 "negative regulation of DNA recombination" evidence=IBA
GO:0032042 "mitochondrial DNA metabolic process" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0000002 "mitochondrial genome maintenance" evidence=IGI;IMP
GO:0009408 "response to heat" evidence=IGI
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0009555 "pollen development" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
UNIPROTKB|Q0JBW2 Os04g0507000 "Os04g0507000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2132233 MSH6 "AT4G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0335 NSE_0335 "DNA mismatch repair protein MutS" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
UNIPROTKB|P74926 mutS "DNA mismatch repair protein MutS" [Thermotoga maritima MSB8 (taxid:243274)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0824 ECH_0824 "DNA mismatch repair protein MutS" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
CGD|CAL0001526 MSH2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TTB4 mutS "DNA mismatch repair protein MutS" [Methanosarcina acetivorans C2A (taxid:188937)] Back     alignment and assigned GO terms
UNIPROTKB|A9WFZ9 mutS "DNA mismatch repair protein MutS" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
FB|FBgn0015546 spel1 "spellchecker1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84LK0MSH1_ARATHNo assigned EC number0.71690.98870.7101yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query803
cd03243202 cd03243, ABC_MutS_homologs, ATP-binding cassette d 1e-69
smart00534185 smart00534, MUTSac, ATPase domain of DNA mismatch 3e-52
COG0249843 COG0249, MutS, Mismatch repair ATPase (MutS family 5e-48
pfam00488235 pfam00488, MutS_V, MutS domain V 1e-43
cd03286218 cd03286, ABC_MSH6_euk, ATP-binding cassette domain 7e-41
cd03284216 cd03284, ABC_MutS1, ATP-binding cassette domain of 1e-40
TIGR01070840 TIGR01070, mutS1, DNA mismatch repair protein MutS 9e-33
cd03280200 cd03280, ABC_MutS2, ATP-binding cassette domain of 4e-32
cd03287222 cd03287, ABC_MSH3_euk, ATP-binding cassette domain 9e-30
cd03283199 cd03283, ABC_MutS-like, ATP-binding cassette domai 4e-29
cd03285222 cd03285, ABC_MSH2_euk, ATP-binding cassette domain 7e-29
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 1e-28
PRK05399854 PRK05399, PRK05399, DNA mismatch repair protein Mu 2e-28
cd03281213 cd03281, ABC_MSH5_euk, ATP-binding cassette domain 2e-27
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 8e-26
cd1043872 cd10438, GIY-YIG_MSH, Catalytic GIY-YIG domain of 3e-24
COG1193 753 COG1193, COG1193, Mismatch repair ATPase (MutS fam 1e-21
cd03282204 cd03282, ABC_MSH4_euk, ATP-binding cassette domain 3e-21
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 4e-15
pfam0154176 pfam01541, GIY-YIG, GIY-YIG catalytic domain 3e-07
cd0071969 cd00719, GIY-YIG_SF, GIY-YIG nuclease domain super 8e-07
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-04
COG282795 COG2827, COG2827, Predicted endonuclease containin 0.002
pfam13476204 pfam13476, AAA_23, AAA domain 0.002
cd1045668 cd10456, GIY-YIG_UPF0213, The GIY-YIG domain of un 0.003
cd03279213 cd03279, ABC_sbcCD, ATP-binding cassette domain of 0.004
>gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs Back     alignment and domain information 
 Score =  227 bits (581), Expect = 1e-69
 Identities = 80/186 (43%), Positives = 111/186 (59%), Gaps = 2/186 (1%)

Query: 493 GSAVHNTVDMQS--LFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIM 550
            + V N +++ S  L L+TGPN GGKS+ LRSI  A LL   G  VPAESASIP  D I 
Sbjct: 17  ETFVPNDINLGSGRLLLITGPNMGGKSTYLRSIGLAVLLAQIGCFVPAESASIPLVDRIF 76

Query: 551 LHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIET 610
             + + DS +DG+S+F  E+ E++ I++  T RSLVLIDE+ RGT TA+G  IA +++E 
Sbjct: 77  TRIGAEDSISDGRSTFMAELLELKEILSLATPRSLVLIDELGRGTSTAEGLAIAYAVLEH 136

Query: 611 LDNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFET 670
           L   GC  + +TH H +  LP ++       M      G    T+KL+DGIC  S A + 
Sbjct: 137 LLEKGCRTLFATHFHELADLPEQVPGVKNLHMEELITTGGLTFTYKLIDGICDPSYALQI 196

Query: 671 AKREGV 676
           A+  G+
Sbjct: 197 AELAGL 202

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA structures or lesions results in ADP/ATP exchange. Length = 202
>gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215944 pfam00488, MutS_V, MutS domain V Back     alignment and domain information
>gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog Back     alignment and domain information
>gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog Back     alignment and domain information
>gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS Back     alignment and domain information
>gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 Back     alignment and domain information
>gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog Back     alignment and domain information
>gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog Back     alignment and domain information
>gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|198385 cd10438, GIY-YIG_MSH, Catalytic GIY-YIG domain of eukaryotic DNA mismatch repair protein MutS homologs Back     alignment and domain information
>gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|216559 pfam01541, GIY-YIG, GIY-YIG catalytic domain Back     alignment and domain information
>gnl|CDD|198380 cd00719, GIY-YIG_SF, GIY-YIG nuclease domain superfamily Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|225383 COG2827, COG2827, Predicted endonuclease containing a URI domain [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222160 pfam13476, AAA_23, AAA domain Back     alignment and domain information
>gnl|CDD|198403 cd10456, GIY-YIG_UPF0213, The GIY-YIG domain of uncharacterized protein family UPF0213 related to structure-specific endonuclease SLX1 Back     alignment and domain information
>gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 803
KOG02171125 consensus Mismatch repair ATPase MSH6 (MutS family 100.0
TIGR01070840 mutS1 DNA mismatch repair protein MutS. 100.0
PRK05399854 DNA mismatch repair protein MutS; Provisional 100.0
COG0249843 MutS Mismatch repair ATPase (MutS family) [DNA rep 100.0
PRK00409 782 recombination and DNA strand exchange inhibitor pr 100.0
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 100.0
KOG02181070 consensus Mismatch repair MSH3 [Replication, recom 100.0
KOG0219902 consensus Mismatch repair ATPase MSH2 (MutS family 100.0
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 100.0
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 100.0
KOG0220867 consensus Mismatch repair ATPase MSH4 (MutS family 100.0
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 100.0
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 100.0
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 100.0
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 100.0
COG1193 753 Mismatch repair ATPase (MutS family) [DNA replicat 100.0
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 100.0
KOG0221849 consensus Mismatch repair ATPase MSH5 (MutS family 100.0
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 100.0
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 100.0
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.97
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.97
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.86
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.85
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.85
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.85
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.84
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.84
COG4152300 ABC-type uncharacterized transport system, ATPase 99.84
PRK13537306 nodulation ABC transporter NodI; Provisional 99.83
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.82
COG1127263 Ttg2A ABC-type transport system involved in resist 99.82
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.81
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.81
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.81
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.8
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.8
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.8
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.8
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.8
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.8
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.8
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.79
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.79
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.79
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.79
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.79
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.79
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.79
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.79
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.79
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.79
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.79
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.79
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.79
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.79
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.79
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.79
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.79
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.79
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.79
cd03246173 ABCC_Protease_Secretion This family represents the 99.78
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.78
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.78
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.78
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.78
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.78
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.78
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.78
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.78
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.78
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.78
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.78
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.78
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.78
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.78
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.78
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.77
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.77
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.77
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.77
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.77
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.77
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.77
PRK10908222 cell division protein FtsE; Provisional 99.77
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.77
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.77
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.77
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.77
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.77
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.77
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.77
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.77
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.77
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.77
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.77
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.77
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.76
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.76
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.76
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.76
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.76
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.76
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.76
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.76
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.76
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.76
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.76
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.76
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.76
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.76
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.76
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.76
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.76
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.76
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.76
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.76
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.76
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.76
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.75
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.75
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.75
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.75
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.75
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.75
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.75
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.75
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.75
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.75
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.75
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.75
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.75
PRK09984262 phosphonate/organophosphate ester transporter subu 99.75
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.75
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.75
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.75
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.75
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.75
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.75
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.75
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.75
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.75
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.75
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.75
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.75
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.74
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.74
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.74
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.74
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.74
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.74
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.74
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.74
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.74
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.74
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.74
COG0411250 LivG ABC-type branched-chain amino acid transport 99.74
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.74
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.74
PRK10938 490 putative molybdenum transport ATP-binding protein 99.74
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.74
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.74
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.74
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.73
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.73
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.73
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.73
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.73
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.73
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.73
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.73
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.73
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.73
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.73
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.73
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.73
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.73
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.73
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.73
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.73
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.73
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.73
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.72
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.72
cd03234226 ABCG_White The White subfamily represents ABC tran 99.72
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.72
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.72
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.72
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.72
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.72
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.72
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.72
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.72
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.72
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.72
COG0410237 LivF ABC-type branched-chain amino acid transport 99.72
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.72
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.72
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.72
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.72
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.72
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.71
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.71
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.71
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.71
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.71
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.71
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.71
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.71
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.71
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.71
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.71
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.71
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.71
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.71
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.71
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.71
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.71
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.71
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.71
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.71
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.7
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.7
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.7
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.7
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.7
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.7
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.7
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.7
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.7
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.7
COG4181228 Predicted ABC-type transport system involved in ly 99.7
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.7
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.7
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.7
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.7
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.7
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.7
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.69
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.69
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.69
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.69
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.69
PRK10938490 putative molybdenum transport ATP-binding protein 99.69
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.69
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.69
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.69
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.69
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.69
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.69
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.69
COG4619223 ABC-type uncharacterized transport system, ATPase 99.68
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.68
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.68
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.68
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.68
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.68
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.68
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.68
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.68
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.68
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.68
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.68
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.67
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.67
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.67
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.67
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.67
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.67
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.67
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.67
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.67
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.67
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.67
PRK13409590 putative ATPase RIL; Provisional 99.67
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.67
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.67
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.66
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.66
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.66
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.66
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.66
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.66
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.66
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.66
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.66
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.65
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.65
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.65
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.65
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.64
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.64
COG4559259 ABC-type hemin transport system, ATPase component 99.64
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.64
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.63
COG1123 539 ATPase components of various ABC-type transport sy 99.63
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.63
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.63
COG4586325 ABC-type uncharacterized transport system, ATPase 99.63
PLN03211 659 ABC transporter G-25; Provisional 99.63
PRK13409 590 putative ATPase RIL; Provisional 99.62
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.61
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.61
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.61
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.61
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.61
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.6
PRK11147 635 ABC transporter ATPase component; Reviewed 99.6
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.6
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.6
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.59
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.59
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.59
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.59
PRK11147635 ABC transporter ATPase component; Reviewed 99.59
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.59
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.59
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.59
PLN03073718 ABC transporter F family; Provisional 99.59
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.59
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.59
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.58
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.58
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.58
COG4133209 CcmA ABC-type transport system involved in cytochr 99.58
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.58
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.57
COG0488 530 Uup ATPase components of ABC transporters with dup 99.57
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.57
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.57
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.56
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.56
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.56
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.56
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.56
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.55
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.55
PLN03073 718 ABC transporter F family; Provisional 99.55
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.55
COG1123539 ATPase components of various ABC-type transport sy 99.55
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.55
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.54
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.53
COG0488530 Uup ATPase components of ABC transporters with dup 99.53
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.53
PLN03140 1470 ABC transporter G family member; Provisional 99.52
COG4988559 CydD ABC-type transport system involved in cytochr 99.52
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.52
COG4987573 CydC ABC-type transport system involved in cytochr 99.5
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.49
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.49
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.49
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.48
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.47
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.47
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.45
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.45
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.44
PTZ00243 1560 ABC transporter; Provisional 99.44
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.44
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.43
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.42
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.42
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.42
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.41
PLN032321495 ABC transporter C family member; Provisional 99.4
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.4
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.4
COG4136213 ABC-type uncharacterized transport system, ATPase 99.4
PLN03232 1495 ABC transporter C family member; Provisional 99.4
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.4
PLN03130 1622 ABC transporter C family member; Provisional 99.39
PLN03140 1470 ABC transporter G family member; Provisional 99.39
PLN031301622 ABC transporter C family member; Provisional 99.38
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.38
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.37
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.37
PTZ002431560 ABC transporter; Provisional 99.36
COG4172 534 ABC-type uncharacterized transport system, duplica 99.36
KOG0062 582 consensus ATPase component of ABC transporters wit 99.36
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.35
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.35
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.34
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.3
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.28
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.28
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.27
COG4172534 ABC-type uncharacterized transport system, duplica 99.25
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.23
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.19
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.18
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.17
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.17
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.14
COG4178604 ABC-type uncharacterized transport system, permeas 99.14
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.12
smart00533308 MUTSd DNA-binding domain of DNA mismatch repair MU 99.1
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.09
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.08
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.07
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.07
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.04
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.99
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.95
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 98.94
COG3910233 Predicted ATPase [General function prediction only 98.94
KOG2355291 consensus Predicted ABC-type transport, ATPase com 98.91
COG4170330 SapD ABC-type antimicrobial peptide transport syst 98.9
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 98.87
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 98.85
KOG00541381 consensus Multidrug resistance-associated protein/ 98.83
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.73
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 98.71
COG1129500 MglA ABC-type sugar transport system, ATPase compo 98.7
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.65
KOG0062582 consensus ATPase component of ABC transporters wit 98.58
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 98.57
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.57
PRK006351809 excinuclease ABC subunit A; Provisional 98.56
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.54
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.49
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.46
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 98.38
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.34
PRK13695174 putative NTPase; Provisional 98.31
smart00382148 AAA ATPases associated with a variety of cellular 98.28
KOG02171125 consensus Mismatch repair ATPase MSH6 (MutS family 98.15
PRK06067234 flagellar accessory protein FlaH; Validated 98.12
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 98.1
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 98.07
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.03
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 97.99
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 97.83
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 97.82
TIGR00634563 recN DNA repair protein RecN. All proteins in this 97.77
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.76
PRK07721438 fliI flagellum-specific ATP synthase; Validated 97.75
COG3845501 ABC-type uncharacterized transport systems, ATPase 97.72
PRK04296190 thymidine kinase; Provisional 97.72
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 97.71
PRK10869553 recombination and repair protein; Provisional 97.71
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.65
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.65
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.64
PRK09183259 transposase/IS protein; Provisional 97.57
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.56
PRK06793432 fliI flagellum-specific ATP synthase; Validated 97.46
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.44
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.43
PF00004132 AAA: ATPase family associated with various cellula 97.43
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.41
PRK06893229 DNA replication initiation factor; Validated 97.36
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 97.33
PF1355562 AAA_29: P-loop containing region of AAA domain 97.31
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.3
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.28
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.27
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.25
PRK03918880 chromosome segregation protein; Provisional 97.22
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.22
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.21
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.19
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.18
PRK06921266 hypothetical protein; Provisional 97.15
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.15
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.14
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.14
PHA02562562 46 endonuclease subunit; Provisional 97.11
PRK11823446 DNA repair protein RadA; Provisional 97.11
PRK12377248 putative replication protein; Provisional 97.1
PRK07952244 DNA replication protein DnaC; Validated 97.09
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.09
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.08
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.07
PRK08727233 hypothetical protein; Validated 97.06
PRK06526254 transposase; Provisional 97.06
PRK102461047 exonuclease subunit SbcC; Provisional 97.03
cd01128249 rho_factor Transcription termination factor rho is 97.02
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.02
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.01
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.01
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.01
PRK08699325 DNA polymerase III subunit delta'; Validated 97.0
PRK14088440 dnaA chromosomal replication initiation protein; P 97.0
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.97
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.95
TIGR00767415 rho transcription termination factor Rho. Members 96.95
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.94
PRK09825176 idnK D-gluconate kinase; Provisional 96.93
>KOG0217 consensus Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-67  Score=608.65  Aligned_cols=686  Identities=28%  Similarity=0.316  Sum_probs=584.6

Q ss_pred             eeeeecCCCceEEEEEeec----cceeeccc--CCCHHHHHHHHhhcCCCcceeecccCCCCCccccccccCCCcccccc
Q 003687            3 VIGVSRSAKGYCIISILET----MKTYSLED--GLTEDALVTKLRTSRYHHLFLHTSLRQNTSGTSRWGEYGEGGLLWGE   76 (803)
Q Consensus         3 ~~gi~~~~~gy~~~~v~~~----~~~~~~~~--~lt~ea~~~~l~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~~   76 (803)
                      +.+++++++|||.|+..++    |..+..++  +|++|++..++|..++||.|.|.+|..+++   +|+.|+.|+..|.+
T Consensus       181 ~~~a~r~~~~~~~i~~~~~~~~~~~a~~~E~~r~l~~e~~RD~~rrr~~dp~yDp~TLyiP~s---~~~kftpg~kqwWe  257 (1125)
T KOG0217|consen  181 EGQASRSASGYCGISNGETELSRMEAFDHEKERYLKLEDVRDALRRRRGDPEYDPRTLYIPPS---FWKKFTPGEKQWWE  257 (1125)
T ss_pred             cCccccccccccccccccccccchhhhcccchhhccHHHhhhhhcCCCCCCCCCccceecCHH---HHhcCCchhhhhhh
Confidence            6789999999999999999    99999998  999999999999999999999999998887   99999999999999


Q ss_pred             ccccccc---ccCCCchHHHHHHHHHhhCCCcccceEEEeecCCCCCC---CCchhhhhhhc--cccCCCcccchhhccC
Q 003687           77 CIARHFE---WFEGDPVIELLLKVKELYGLENEVTFRNVTVSYENRPR---PLHLGTATQIG--AIPTEGIPCLLKVLLP  148 (803)
Q Consensus        77 ~~~~~~~---~~~~~~~~~ll~~v~~~~~~~~~~~f~~~~~~~~~rp~---pl~~~ta~qlg--~~~~~~ip~ll~~~lp  148 (803)
                      |.+++|+   ||.++-.-+|+.+++..++.+.+..|++++++..++|.   |++.++++|.|  +.+++++|+.+...+|
T Consensus       258 iKs~~fD~ivfFk~GKFyELye~DA~vg~~~~dl~f~~vN~~~~GfPE~sf~~~a~q~iq~GYkvarVEQtEt~l~~e~r  337 (1125)
T KOG0217|consen  258 IKSDNFDTIVFFKKGKFYELYEMDALVGARLFDLKFMDVNMPHSGFPEGSFDYWADQFIQKGYKVARVEQTETPLGKEIR  337 (1125)
T ss_pred             hhhhcccEEEEEecchHHHHHhhhhhhhhhhcceeecccccccCCCCccchhhHHHHHHhccceeeeeccccChHHhhhh
Confidence            9999999   99999999999999999999999999999999999999   99999999999  9999999999999999


Q ss_pred             CCCCC----chHHHHHhhccCCCchHHHHHHHHHHHHhcccCCCCch--HHH-----HHHHHHhhhhhhHHHH--HHHHH
Q 003687          149 SNCSG----LPILYVRDLLLNPPAYEIASTIQAICKLMSKVTCSIPE--FTC-----LVKLLELREANHIEFC--RIKNV  215 (803)
Q Consensus       149 ~~~~~----~~~~~~r~lll~pP~~~~a~~i~~~~~~~~~~~~~~p~--~~~-----~~~ll~~~~a~~~~~~--~~~~~  215 (803)
                      +.+.+    .+|||++++|.+||-+++|..++.+|+.|++++++.|.  +++     ......+||.+-.+||  +.++.
T Consensus       338 ~~~~~~kdkvvrRev~~ilt~GT~td~~l~~~~~akylmai~e~~~~~~~~~~s~gvc~iDtstge~~~~eF~DDr~~s~  417 (1125)
T KOG0217|consen  338 ERKTGKKDKVVRREVCRILTNGTLTDIALLTSDLAKYLMAIKESEESYSTGEVSFGVCFIDTSTGEINIGEFCDDRHCSK  417 (1125)
T ss_pred             hcccccchhhHHHHHHHHhcCCcchhHHHhccHHHHHHHHHhhcCCCCCcCceeeeEEEEEcccceEEEEEeecchhhhH
Confidence            99999    99999999999999999999999999999999999998  555     4567999999999999  79999


Q ss_pred             HHHHHhhhcCchHHHHHHhhcchhhhhhccCCChHHHHHHHH----HHHHHhhc-hhcccCC--c-cccccCCCCCCh--
Q 003687          216 LDEILHMYGNSELNEILELLMDPTWVATGLKIDFETLVEECR----LASVRIGE-MISLDGE--S-DQKICSYDNIPS--  285 (803)
Q Consensus       216 ~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~c~----~~~~~i~~-~v~~~~~--~-~~~~~~~~~i~~--  285 (803)
                      ++.+|.+++-.|+-...+.|.+|||..++.++......|.|+    |..+++.. ||+.+--  + -+-.++....|.  
T Consensus       418 L~tlLs~~rp~E~I~e~~~ls~~t~~~ik~~~~~~~~~n~~~~~eFwdsek~~~eii~~dy~~~~g~e~~~sil~~p~~~  497 (1125)
T KOG0217|consen  418 LDTLLSQVRPVELIEERKNLSDPTKVIIKLKLSSNLVENLVPKSEFWDSEKTGREIISEDYFESLGLEDSPSILKSPNTD  497 (1125)
T ss_pred             HHHHHHcccHHHHHHHhhccCCceeeeeeeeecchhhhcccChhhhcchhhHHHHHhhhhhhhcccccCchhhccCCCcc
Confidence            999999999999999999999999999999999999999999    77776666 7765410  0 111222233343  


Q ss_pred             -hHHhhhhhhhccccccccchHHHHHHHHHHHHHHHH---HhhchHHHHHHHHhhcCCCCCCCccchhcccccceeeecc
Q 003687          286 -EFFEDMESTWKGRVKRIHIEPEIAEVEMAAEALSLA---VTEDFLPIISRIKATTAPLGGPKGEILYAREHEAVWFKGK  361 (803)
Q Consensus       286 -~f~~~~e~~~rg~~~~~~~~~~~~~v~~a~~~L~~a---i~ed~~~~l~~~~~~~~~l~~~~~ei~~~~~~~~~~~r~~  361 (803)
                       +|+-+...+|++||+..++++++-++..-.+....+   +..|+.++.....+.....|+.++++.|..+.-.+|+ |+
T Consensus       498 ~~la~safg~~~~Ylk~~~id~~llsm~n~~ey~~~~~s~mvlD~~tL~NleIf~Ns~~G~~~gtL~~~~~~csTpf-GK  576 (1125)
T KOG0217|consen  498 KELALSAFGGLFYYLKKLLIDEELLSMKNFEEYDSLDQSEMVLDGATLENLEIFSNSRNGGDEGTLFYAVNRCSTPF-GK  576 (1125)
T ss_pred             chhhHHHHHHHHHHHHHHhhHHHHhhhhhhhhcchhcccceeecchhhhhhhhhccCCCCCCchhHHHHHhhccChH-HH
Confidence             677778899999999999999999998888777666   6677777777777766777889999999999888998 88


Q ss_pred             ceecccccCCCCccc--cCcccccccCCCC------ccceeeeecHHHHHHHHHHHHHHHH------HHHHHHHHHHHHH
Q 003687          362 KFRPTVWASTPGEEQ--IKQLKPAVDSKGR------KVGEEWFSTLKVEEALERYHEAGAK------AKAKVLELLRGLS  427 (803)
Q Consensus       362 r~~~~v~~~~~~~~~--i~~lv~~~~~~g~------~v~~e~~~t~~l~~~l~~~~~a~~~------~~~~i~~il~~L~  427 (803)
                      |+.. .|...+..++  |++.....+..++      ++...|++++.++.++.|+++....      ...++++-++++.
T Consensus       577 Rllk-~Wl~~Pl~~~~~I~~R~dav~~l~~~~~~~~~~~e~l~klPDlERlL~Rih~~~~~~~k~i~~f~rvLegfk~~~  655 (1125)
T KOG0217|consen  577 RLLK-TWLMAPLCDKEDIKQRQDAVDSLGKAPMDRTKVGETLKKLPDLERLLVRIHNGGEKNKKKIADFIRVLEGFKEIN  655 (1125)
T ss_pred             HHHH-HHhhCcCCCHHHHHHHHHHHHHHhcCchhHHHHHHHHhhCCcHHHHHHHHHhcCccchhHHHHHHHHHHHHHHHH
Confidence            8776 6887776655  8877777776666      7777889999999999999875443      1111111111100


Q ss_pred             HHH-----------------------------------------------------------------------------
Q 003687          428 SEL-----------------------------------------------------------------------------  430 (803)
Q Consensus       428 ~~l-----------------------------------------------------------------------------  430 (803)
                      ..+                                                                             
T Consensus       656 ~~~~~~~~v~~~~~~~~~is~~~~~~p~~~~~i~~~~~af~r~~a~~eg~i~P~~Gfd~eyD~a~k~~~e~e~~L~~~L~  735 (1125)
T KOG0217|consen  656 KLLGSLINVLKEGEGLRLISELLESMPNLSEEIENWTEAFDRVKAVKEGVIVPLEGFDEEYDEAMKRVDEAENELLAYLE  735 (1125)
T ss_pred             HHHHHHHHHHHhhHHHHHHHHHhcCcchhhHHHHHHHHHHHHHHHhhcCccCCCccccHHHHHHhhHHHHHHHHHHHHHH
Confidence            000                                                                             


Q ss_pred             --------------------------------------------------------------------------------
Q 003687          431 --------------------------------------------------------------------------------  430 (803)
Q Consensus       431 --------------------------------------------------------------------------------  430 (803)
                                                                                                      
T Consensus       736 ~~rk~l~c~si~~~~vGk~~y~lEvP~n~~~~s~~~~~~~S~~Kg~~RY~tp~~~kli~~l~~aee~~~~~~~d~~~r~~  815 (1125)
T KOG0217|consen  736 EYRKRLGCSSIVFVDVGKDVYQLEVPENGGVPSSLRYELMSAKKGVSRYYTPDLRKLIAHLDEAEERKKSSLSDLKRRLI  815 (1125)
T ss_pred             HHHHhcCCCceeEeecCceEEEEecCcccCCCCchHHHHHHhhcCcccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             ---HHHHHHHHHHHHHHHHHHHHhhhhhhcc--cCCceeeEeecCccCCcceEEEecccccccccC--CCceeccccCCC
Q 003687          431 ---QTKINILVFASMLLVIGKALFAHVSEGR--RRKWVFPALKDIELDGANCLKMNGLSPYWFDAA--EGSAVHNTVDMQ  503 (803)
Q Consensus       431 ---~~~i~~L~~~~~~~~~a~~l~a~a~~a~--~~~~~~P~i~~~~~~g~~~i~l~~l~p~~~~~~--~~~~VlndIsLG  503 (803)
                         ..+..........++..|++++++..+.  ..++|+|++.+. .+....+.++++.|+++...  ++.+++|++.+|
T Consensus       816 ~~f~~~~~~w~~tv~~~a~iD~l~sla~~s~~~~~~~Crp~i~~~-~dt~~~l~~~~~~Hpcfsl~s~~~~fipN~v~~g  894 (1125)
T KOG0217|consen  816 VRFDEHYIIWQATVKALASIDCLLSLAETSKGLGGPMCRPEIVES-TDTPGFLIVKGLRHPCFSLPSTGTSFIPNDVELG  894 (1125)
T ss_pred             HHhhhhHHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccceeecc-cCCCceeEEecccCceeecCcCCCccccchhhcc
Confidence               0000011111222445566676665543  456899999875 33333577787766665542  356899999994


Q ss_pred             -----ceEEEEecCCCChhHHHHHHHhhHhhhhccccccccccccchhHHHhhhCCCCCCccCCccchHHHHHHHHHHHH
Q 003687          504 -----SLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVT  578 (803)
Q Consensus       504 -----eii~ItGPNGsGKSTLLR~Iagl~~laq~G~~Vpa~~a~i~~~d~I~~~ig~~d~l~~~~stfs~em~~l~~iLa  578 (803)
                           .+..+|||||+|||||||+++.+++|+|.|++||++...++.+|.||+++|+.|.+..+.|||..++.+.+.|+.
T Consensus       895 ~~~e~~~~llTGpNmgGKSTllRq~c~~vilaq~G~~VPa~~~~~tpidrI~tRlGA~D~im~g~STF~vELsET~~IL~  974 (1125)
T KOG0217|consen  895 GAEENREGLLTGPNMGGKSTLLRQACIAVILAQIGCDVPAEVMELTPIDRIFTRLGANDDIMSGESTFFVELSETKKILK  974 (1125)
T ss_pred             ccccceeeeeccCCcCCchHHHHHHHHHHHHHHhCCCccHHHhcccchHHHhhhcccccchhcCCceEEEeccchHHHHh
Confidence                 456699999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCcEEEEeCCCCCCChHHHHHHHHHHHHHHHh-cCCEEEEEccChhhhhCcccccccccceeEEEEeCCc-eeeeeE
Q 003687          579 ATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDN-IGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQ-TVPTWK  656 (803)
Q Consensus       579 ~a~~psLlLLDEP~sGLD~~~g~~L~~~ILe~L~~-~g~tvI~sTH~~eL~~~~~~~~~v~~~~m~~~~~~~~-l~~tYk  656 (803)
                      .+++.+||++||.++||.+.+|.+|+.++++++.. .+|..+|+|||+.++....+.+.+...+|...++++. ++|+||
T Consensus       975 ~aT~~SLvi~DELGRGtst~DG~aIA~aVLe~l~~~i~c~~fFSTHYhsl~~~~~~~p~Vrl~~Ma~~vd~e~~vtFLYk 1054 (1125)
T KOG0217|consen  975 HATRHSLVIVDELGRGTSTFDGTAIAEAVLEHLSEGIQCLGFFSTHYHSLCVDFMHHPQVRLLHMACVVDEEIDVTFLYK 1054 (1125)
T ss_pred             hcCccceeeehhhcCcccccCCcchHHHHHHHHHhcccccCCccccccchhHhhhcCccccchhheeeecCCccEEEeeh
Confidence            99999999999999999999999999999999976 6899999999999998888889999999998777666 999999


Q ss_pred             EeeCCCCCchHHHHHHHcCCCHHHHHHHHHHHHHhccc
Q 003687          657 LVDGICRESLAFETAKREGVPETIIQRAEDLYIACGVN  694 (803)
Q Consensus       657 L~~G~~~~S~al~iA~~~Glp~~Ii~rA~~~~~~~~~~  694 (803)
                      +.+|.|+.|||+++|+++|+|+.||++|.....+++..
T Consensus      1055 l~~G~cpkSyG~~vArmaglp~~vi~~a~~~a~E~e~~ 1092 (1125)
T KOG0217|consen 1055 LEEGICPKSYGFNVARMAGLPDQVIDRAEIKAHELEKS 1092 (1125)
T ss_pred             hccCCCCcchhHHHHHhcCCcHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999998888654

>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG0218 consensus Mismatch repair MSH3 [Replication, recombination and repair] Back     alignment and domain information
>KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>KOG0220 consensus Mismatch repair ATPase MSH4 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0221 consensus Mismatch repair ATPase MSH5 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0217 consensus Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query803
1nne_A765 Crystal Structure Of The Muts-adpbef3-dna Complex L 7e-25
2o8b_B1022 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 1e-22
1ewr_A649 Crystal Structure Of Taq Muts Length = 649 2e-22
1fw6_A768 Crystal Structure Of A Taq Muts-Dna-Adp Ternary Com 2e-22
1ewq_A765 Crystal Structure Taq Muts Complexed With A Heterod 2e-22
1oh5_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 5e-22
1wbd_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 5e-22
1wbb_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 6e-22
1wb9_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 6e-22
2o8b_A934 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 1e-21
2o8e_A934 Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, 1e-21
3k0s_A799 Crystal Structure Of E.Coli Dna Mismatch Repair Pro 2e-21
1ng9_A800 E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt 4e-21
1e3m_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 2e-19
3thw_B918 Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo 5e-18
>pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 102/204 (50%), Gaps = 11/204 (5%)
Query: 496 VHNTVDM-QSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLHMK 554
           V N ++M   L L+TGPN  GKS+ LR     +LL   G  VPAE A +P FD I   + 
Sbjct: 568 VPNDLEMAHELVLITGPNMAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIG 627
Query: 555 SYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDNI 614
           + D  A GKS+F VEM E+  I+   T  SLVL+DE+ RGT +  G  IA ++ E L   
Sbjct: 628 ASDDLAGGKSTFMVEMEEVALILKEATENSLVLLDEVGRGTSSLDGVAIATAVAEALHER 687
Query: 615 GCLGIVSTHLHGIFSLPL-KIKN---AAYKAMGTEYLDGQTVPTWKLVDGICRESLAFET 670
               + +TH   + +L L ++KN   AA +  G      Q +P      G   +S   E 
Sbjct: 688 RAYTLFATHYFELTALGLPRLKNLHVAAREEAGGLVFYHQVLP------GPASKSYGVEV 741
Query: 671 AKREGVPETIIQRAEDLYIACGVN 694
           A   G+P+ ++ RA  L  A    
Sbjct: 742 AAMAGLPKEVVARARALLQAMAAR 765
>pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 Back     alignment and structure
>pdb|1EWR|A Chain A, Crystal Structure Of Taq Muts Length = 649 Back     alignment and structure
>pdb|1FW6|A Chain A, Crystal Structure Of A Taq Muts-Dna-Adp Ternary Complex Length = 768 Back     alignment and structure
>pdb|1EWQ|A Chain A, Crystal Structure Taq Muts Complexed With A Heteroduplex Dna At 2.2 A Resolution Length = 765 Back     alignment and structure
>pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 Back     alignment and structure
>pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 Back     alignment and structure
>pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 Back     alignment and structure
>pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 Back     alignment and structure
>pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 Back     alignment and structure
>pdb|1E3M|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A G:t Mismatch Length = 800 Back     alignment and structure
>pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query803
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 2e-36
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 4e-33
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 2e-32
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 5e-28
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 2e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 3e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-05
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 Back     alignment and structure
 Score =  147 bits (373), Expect = 2e-36
 Identities = 84/342 (24%), Positives = 130/342 (38%), Gaps = 49/342 (14%)

Query: 387 KGRKVGEEWF--STLKVEEALERYH-------EA---GAKAKAKVLE--LLRGLSSELQT 432
             R + EE+   ST K     +RY         A    A+ +  V     +R L      
Sbjct: 648 TTRNLPEEYELKSTKK---GCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDK 704

Query: 433 KINILVFASMLL----VIGKALFAHVSEGRRRKWVFPALKDIELDGAN---------CL- 478
                  A   +    V+     A+ S G       P +   E              C+ 
Sbjct: 705 NYKDWQSAVECIAVLDVL--LCLANYSRGGDGPMCRPVILLPEDTPPFLELKGSRHPCIT 762

Query: 479 KMNGLSPY-----WFDAAEGSAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAASLLGICG 533
           K      +          E    +         L+TGPN GGKS+L+R     +++   G
Sbjct: 763 KTFFGDDFIPNDILIGCEEEEQENGKAYCV---LVTGPNMGGKSTLMRQAGLLAVMAQMG 819

Query: 534 LMVPAESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICR 593
             VPAE   +   D +   + + D    G+S+F VE+SE  SI+   T+ SLVL+DE+ R
Sbjct: 820 CYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGR 879

Query: 594 GTETAKGTCIAGSIIETL-DNIGCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTV 652
           GT T  GT IA ++++ L + I C  + STH H +     +        M     +    
Sbjct: 880 GTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECED 939

Query: 653 PTW-------KLVDGICRESLAFETAKREGVPETIIQRAEDL 687
           P+        K + G C +S  F  A+   +PE +IQ+    
Sbjct: 940 PSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRK 981
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Length = 178 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 803
d1wb9a2234 c.37.1.12 (A:567-800) DNA repair protein MutS, the 4e-31
d1ewqa2224 c.37.1.12 (A:542-765) DNA repair protein MutS, the 2e-29
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.004
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Length = 234 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score =  119 bits (300), Expect = 4e-31
 Identities = 62/196 (31%), Positives = 96/196 (48%), Gaps = 4/196 (2%)

Query: 496 VHNTVDM---QSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVPAESASIPYFDAIMLH 552
           + N +++   + + ++TGPN GGKS+ +R     +L+   G  VPA+   I   D I   
Sbjct: 31  IANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTR 90

Query: 553 MKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLD 612
           + + D  A G+S+F VEM+E  +I+   T  SLVL+DEI RGT T  G  +A +  E L 
Sbjct: 91  VGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLA 150

Query: 613 NI-GCLGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETA 671
           N    L + +TH   +  LP K++  A   +              + DG   +S     A
Sbjct: 151 NKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVA 210

Query: 672 KREGVPETIIQRAEDL 687
              GVP+ +I+RA   
Sbjct: 211 ALAGVPKEVIKRARQK 226
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query803
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 100.0
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.84
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.84
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.83
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.83
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.82
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.82
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.82
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.82
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.81
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.8
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.79
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.75
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.75
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.73
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.73
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.72
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.71
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.68
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.68
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.68
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.08
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.94
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.61
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.36
d1wb9a1297 DNA repair protein MutS, domain III {Escherichia c 98.36
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.99
d1ewqa1275 DNA repair protein MutS, domain III {Thermus aquat 97.95
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.23
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.96
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.93
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.92
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.92
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.91
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.68
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.67
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.64
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.54
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.52
d1okkd2207 GTPase domain of the signal recognition particle r 96.51
d1vmaa2213 GTPase domain of the signal recognition particle r 96.51
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.41
d2qy9a2211 GTPase domain of the signal recognition particle r 96.19
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.13
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.09
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.07
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.02
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.01
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.97
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.95
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.84
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.77
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.54
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.51
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.5
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.48
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.42
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.24
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.16
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.09
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.87
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.49
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.45
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.36
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.33
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.2
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.02
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.98
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.92
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.79
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.46
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.22
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.15
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.97
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.96
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.92
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.89
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.88
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.84
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.77
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.39
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.38
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.15
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.03
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.91
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.8
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.76
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.73
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.72
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.71
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.61
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.11
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 91.02
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.71
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.52
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.44
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.31
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.03
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.91
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.88
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.86
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.67
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.48
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.39
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.32
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.14
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.12
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.07
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 88.88
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 88.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.58
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.53
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.5
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.43
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.21
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.17
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.15
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.11
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 88.09
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.01
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 87.52
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.41
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.32
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 86.75
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 86.23
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.9
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 85.76
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 85.73
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.7
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 85.62
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 85.23
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 85.1
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.29
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.13
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.81
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.75
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 83.47
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 83.4
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.35
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 83.34
d2fh5b1207 Signal recognition particle receptor beta-subunit 83.2
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.04
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 82.76
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.38
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.19
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.01
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 81.97
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.88
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.8
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 81.65
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.63
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 81.45
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 81.19
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 80.38
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 80.22
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=0  Score=361.58  Aligned_cols=227  Identities=29%  Similarity=0.419  Sum_probs=208.9

Q ss_pred             CEEEEEECCCCCCCCEEEEECCCCCCCC-CCCCCEECCCCCC---CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             0300863376677433899044665323-4799431012588---96699980699982289999975575410162115
Q 003687          462 WVFPALKDIELDGANCLKMNGLSPYWFD-AAEGSAVHNTVDM---QSLFLLTGPNGGGKSSLLRSICAASLLGICGLMVP  537 (803)
Q Consensus       462 ~~~P~i~~~~~~g~~~i~i~~l~p~~~~-~~~~~~V~ndi~L---g~i~iItGPNgsGKSTlLK~I~~l~llaq~G~~VP  537 (803)
                      ||+|++++.     +.+.+++.+|+.++ ...+++|+||+.+   +++++|||||||||||+||+|+++++|||+|+|||
T Consensus         1 y~~P~~~~~-----~~l~i~~~rHPlle~~~~~~~VpNdi~l~~~~~~~iiTGpN~~GKSt~lk~i~l~~~laq~G~~Vp   75 (234)
T d1wb9a2           1 YTCPTFIDK-----PGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVP   75 (234)
T ss_dssp             CBCCEECSS-----SCEEEEEECCTTHHHHCSSCCCCEEEEECSSSCEEEEECCTTSSHHHHHHHHHHHHHHHTTTCCBS
T ss_pred             CCCCEECCC-----CCEEEEEEECCEEECCCCCCCCCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             978778189-----968999737877974469982640579889953999954673136899998799999987297674


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CCC
Q ss_conf             6656543057895307877882378552278779999999958999099990899999968899999999999983-597
Q 003687          538 AESASIPYFDAIMLHMKSYDSPADGKSSFQVEMSEIRSIVTATTSRSLVLIDEICRGTETAKGTCIAGSIIETLDN-IGC  616 (803)
Q Consensus       538 Ae~a~i~~~d~I~~~ig~~d~i~~~~StF~~el~el~~iL~~at~~sLVLLDEpgsGTD~~dg~aLa~aiLe~L~~-~g~  616 (803)
                      |+.+.++.+|+||++++..|++..+.|+|+.||++++.++..+++++|||+||+|+||+|.||.++++++++++.. .++
T Consensus        76 A~~a~~~~~d~I~~~~~~~d~~~~~~S~F~~E~~~~~~il~~~~~~sLvliDE~~~gT~~~eg~~l~~a~l~~l~~~~~~  155 (234)
T d1wb9a2          76 AQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKA  155 (234)
T ss_dssp             SSEEEECCCCEEEEEEC-----------CHHHHHHHHHHHHHCCTTEEEEEESCCCCSSSSHHHHHHHHHHHHHHHTTCC
T ss_pred             CCCEECCCCHHHEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             17666134420234874675343653189999999999997454660885322235877456667898764543204544


Q ss_pred             EEEEECCCHHHHHCCCCCCCCCCCEEEEEEECCCEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99998268255407532323222146999748933333477507789816999999939999999999999998432
Q 003687          617 LGIVSTHLHGIFSLPLKIKNAAYKAMGTEYLDGQTVPTWKLVDGICRESLAFETAKREGVPETIIQRAEDLYIACGV  693 (803)
Q Consensus       617 ~vIisTH~~eL~~l~~~~~~i~~~~m~~~~~~~~l~~tYkL~~G~~~~S~al~iA~~~Glp~~Ii~rA~~l~~~~~~  693 (803)
                      .++++||++++.......+++.+.+|.....++.+.|+||+.+|++++|||+++|+++|+|++|++||+++++++|.
T Consensus       156 ~~i~tTH~~~l~~~~~~~~~v~~~~~~~~~~~~~i~f~YkL~~G~~~~s~ai~iA~~~Glp~~ii~~A~~i~~~lE~  232 (234)
T d1wb9a2         156 LTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELES  232 (234)
T ss_dssp             EEEEECSCGGGGGHHHHSTTEEEEEEEEEEETTEEEEEEEEEESCCSSCCHHHHHHHTTCCHHHHHHHHHHHHHHHT
T ss_pred             EEEEECCHHHHHHHHHCCCCEEEEEEEEEECCCCCEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHC
T ss_conf             28985246877643312455478998876036840178774679999729999999919699999999999998763
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure