Citrus Sinensis ID: 003711

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-

MASNNQNKPPVLSNNITKASPSSNKKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTAEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKLINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVGKTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSLG

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEcccccccccccccccccccccccccccEEEcccccEEEcccEEEEcccHHHHHHHHHHHHcccHHHHccccccccccccEEEEEEEEEEcccccEEEEccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHcccccccccccccccccccccccc

ccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccEEEEEccccccccccccccccccccccEEEcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccEEEEEEEccccHHHHcccccEEEEEccccEEEEccccccccccccEEEEcccccccccHHHHHHHcHHHHHHHHccccEEEEEEccccccHHHHHcEcccccccEcHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEcHHHHHHccccccccccccccccccEcEEEcccccEEEcccccEEEccHHHHHHHHHHHHHHcccccccHHHHHHHcEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcHHcccccccHHHcHHHHHcHHHcccccEEEEEEEEccEHHHHHHHHHHHHHHHHHHcHccccccccccccHHHHHcccc

masnnqnkppvlsnnitkaspssnkkklgvdevtcdkeqkfGAEKMVGTANNARIRQAFSVVNGiqdlglssnpasnagsecgtieFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTAEVIKhkelavssEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKLINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRvfcrvrpllpddssgsegklisyptttealgrgidimqngqkhsfsfdrvfmpdesqeDVFVEISQLVQSALDGYKVCIFaygqtgsgktytmmgkpghpdlkglipRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRlenacngkqyaikhdasgnthvtdLTVVDVCSTKEVSYLLDRAahsrsvgktqmneqssrsHFVFTLRISGLNESTEQQVQGILNLIDLagserlsksgstgdrLKETQAINKSLSSLSDVIFALAKkekkedhvpfrnskltyllqpclggdsktlMFVNispeassvgesLCSLRFAARVNaceigtprrqtsmrssesrlslg

masnnqnkppvlsnnitkaspssnkkklgvdEVTCDKEQKFGAEKMVGTANNARIRQAFSVVNGIQDLGLSSNPasnagsecgtieFTREDVEALLSEkmryknkfnykeRCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTAEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLevsdlsaletktefegqKKLINELRNHLEDAEYKLIEGEKLRKRLHNTIlelkgnirvfCRVRPllpddssgsegklisyPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYaikhdasgnthVTDLTVVDVCSTKEVSYLLDRAahsrsvgktqmneqssrsHFVFTLRISGLNESTEQQVQGILNLIDLAGSERlsksgstgdrlKETQAINKSLSSLSDVIFALAKkekkedhvpfrnsKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNAceigtprrqtsmrssesrlslg

**********************************************VGTANNARIRQAFSVVNGIQDLG************CGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSF**********************************************************INDMYKLLQEYNSSLQHY******************************TLRGQYIS***************************************************************************************************************LINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLL***********ISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMG*****DLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDR*******************HFVFTLRISGLNESTEQQVQGILNLIDL***************************************************KLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEI*******************

**********************************************************************************************************************IK***L******************************************************************************************************************************************************************************************************RVELQQVRDD**************************DLEARCASQSNQIRSLSDQLAAAEEKLEV*********TEFEGQKKLINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLL***********************************FSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDA*************IKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVGKTQMNEQSSRSHFVFTLRISGLN******VQGILNLIDLAGSERLS*****GDRLKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACE********************

**********VLSNNITK************DEVTCDKEQKFGAEKMVGTANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTAEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKLINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAA****************SHFVFTLRISGLNESTEQQVQGILNLIDLAGSER**********LKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEIGT*****************

*******************************EVT*DKE**FGAEKMVGTANNARIRQAFSVVNGIQ**************ECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTAEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKLINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDA********GKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVGKT**NEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAG*******************INKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEIGTP****************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASNNQNKPPVLSNNITKASPSSNKKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTxxxxxxxxxxxxxxxxxxxxxFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLAALDSLAREKETRLNMERSxxxxxxxxxxxxxxxxxxxxxxxxxxxxYKLLQEYNSSLQHYxxxxxxxxxxxxxxxxxxxxxKSAIVENLSTLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVExxxxxxxxxxxxxxxxxxxxxVIKHKELAVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEVSDLSALETKTExxxxxxxxxxxxxxxxxxxxxxxxxxxxRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVGKTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSLG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		801	2.2.26 [Sep-21-2011]
P46875		754	Kinesin-3 OS=Arabidopsis	yes	no	0.940	0.998	0.719	0.0
P46864		745	Kinesin-2 OS=Arabidopsis	no	no	0.928	0.998	0.690	0.0
Q07970		793	Kinesin-1 OS=Arabidopsis	no	no	0.971	0.981	0.610	0.0
F4JGP4		790	Kinesin-5 OS=Arabidopsis	no	no	0.967	0.981	0.590	0.0
P28739		770	Kinesin-like protein klpA	yes	no	0.657	0.684	0.426	1e-105
Q9US03		817	Kinesin-like protein 2 OS	yes	no	0.749	0.734	0.400	1e-104
Q9BPU3		792	Kinesin-related protein 2	yes	no	0.446	0.452	0.534	1e-102
Q60443		622	Kinesin-like protein KIFC	no	no	0.602	0.776	0.429	1e-99
Q5XI63		693	Kinesin-like protein KIFC	yes	no	0.610	0.705	0.431	1e-99
Q9QWT9		674	Kinesin-like protein KIFC	yes	no	0.601	0.715	0.429	3e-98

>sp\|P46875\|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1	Back alignment and function desciption

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/757 (71%), Positives = 656/757 (86%), Gaps = 4/757 (0%)

Query: 46  MVGT-ANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKN 104
           MVG  ANN RIR AF V NG +DL  +S PAS  GSE G +EFTREDVE LL+E+++YK+
Sbjct: 1   MVGAMANNGRIRSAFPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKS 60

Query: 105 KFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNK 164
           KFNYKERCENMMDYIKRLRLCI+WFQELE DYAFE E+L+NALEL+E+ C +ME++L+NK
Sbjct: 61  KFNYKERCENMMDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCVDMEVSLKNK 120

Query: 165 EEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKA 224
           EEELN+II ELRK+F S+Q +LA+E+++KLAA DSL +EKE RL++E++ A L+E+LGKA
Sbjct: 121 EEELNMIIEELRKNFESVQVQLAREQTEKLAANDSLGKEKEARLSVEKAQAGLTEELGKA 180

Query: 225 QEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENL 284
           Q +LQ+ANQRI S+NDMYKLLQEYNSSLQ YN+KLQ D+D AHE+IKRGEKE++AI+EN+
Sbjct: 181 QGDLQTANQRIQSVNDMYKLLQEYNSSLQLYNSKLQGDLDEAHETIKRGEKERTAIIENI 240

Query: 285 STLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALT 344
             L+GQ+ +LQEQL+  KASQ++ M+QK  LV+E+AS++VELQQV+DDRD  L +V+ L 
Sbjct: 241 GNLKGQFSALQEQLAASKASQEDIMKQKGELVNEIASLKVELQQVKDDRDRHLVEVKTLQ 300

Query: 345 AEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKK 404
            E  K+ +   +  +LE  C+SQS QIR L D+L  +E +L+VSDLS  E   E+E QK+
Sbjct: 301 TEATKYNDFKDAITELETTCSSQSTQIRQLQDRLVNSERRLQVSDLSTFEKMNEYEDQKQ 360

Query: 405 LINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLIS 464
            I +L++ +E+AE KL+EGEKLRK+LHNTILELKGNIRVFCRVRPLLP +++G EGK IS
Sbjct: 361 SIIDLKSRVEEAELKLVEGEKLRKKLHNTILELKGNIRVFCRVRPLLPGENNGDEGKTIS 420

Query: 465 YPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAY 524
           YPT+ EALGRGID+MQN QKH+F+FD+VF P  SQEDVF EISQLVQSALDGYKVCIFAY
Sbjct: 421 YPTSLEALGRGIDLMQNAQKHAFTFDKVFAPTASQEDVFTEISQLVQSALDGYKVCIFAY 480

Query: 525 GQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIR 584
           GQTGSGKTYTMMG+PG+ + KGLIPR LEQIF+TRQSL SQGWKYE+QVSMLEIYNETIR
Sbjct: 481 GQTGSGKTYTMMGRPGNVEEKGLIPRCLEQIFETRQSLRSQGWKYELQVSMLEIYNETIR 540

Query: 585 DLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSV 644
           DLLSTN++A R ++  + +++AIKHDASGNTHV +LT++DV S++EVS+LLD AA +RSV
Sbjct: 541 DLLSTNKEAVRTDSGVSPQKHAIKHDASGNTHVAELTILDVKSSREVSFLLDHAARNRSV 600

Query: 645 GKTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAGSERLSKSGSTGDRLKETQ 704
           GKTQMNEQSSRSHFVFTLRISG+NESTEQQVQG+LNLIDLAGSERLSKSGSTGDRLKETQ
Sbjct: 601 GKTQMNEQSSRSHFVFTLRISGVNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQ 660

Query: 705 AINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSV 764
           AINKSLSSL DVIFALA   KKEDHVPFRNSKLTYLLQPCLGGD+KTLMFVNI+PE+SS 
Sbjct: 661 AINKSLSSLGDVIFALA---KKEDHVPFRNSKLTYLLQPCLGGDAKTLMFVNIAPESSST 717

Query: 765 GESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSLG 801
           GESLCSLRFAARVNACEIGTPRRQT+++  E+RLSLG
Sbjct: 718 GESLCSLRFAARVNACEIGTPRRQTNIKPLENRLSLG 754

Possible role in mitosis.
Arabidopsis thaliana (taxid: 3702)

>sp\|P46864\|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1	Back alignment and function description

>sp\|Q07970\|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1	Back alignment and function description

>sp\|F4JGP4\|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1	Back alignment and function description

>sp\|P28739\|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=klpA PE=2 SV=3	Back alignment and function description

>sp\|Q9US03\|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1	Back alignment and function description

>sp\|Q9BPU3\|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum GN=kif2 PE=2 SV=1	Back alignment and function description

>sp\|Q60443\|KIFC1_CRIGR Kinesin-like protein KIFC1 OS=Cricetulus griseus PE=2 SV=1	Back alignment and function description

>sp\|Q5XI63\|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus GN=Kifc1 PE=2 SV=1	Back alignment and function description

>sp\|Q9QWT9\|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus GN=Kifc1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		801
224124204		752	predicted protein [Populus trichocarpa]	0.938	1.0	0.793	0.0
255563647		780	kinesin, putative [Ricinus communis] gi\|	0.968	0.994	0.740	0.0
224115186		712	predicted protein [Populus trichocarpa]	0.888	1.0	0.765	0.0
225461150		763	PREDICTED: kinesin-3 [Vitis vinifera] gi	0.935	0.981	0.744	0.0
147768264		834	hypothetical protein VITISV_028758 [Viti	0.982	0.943	0.689	0.0
18423656		754	kinesin 3 [Arabidopsis thaliana] gi\|1170	0.940	0.998	0.719	0.0
356543172		799	PREDICTED: kinesin-3-like isoform 1 [Gly	0.980	0.982	0.692	0.0
356543174		805	PREDICTED: kinesin-3-like isoform 2 [Gly	0.987	0.982	0.691	0.0
10176794		746	kinesin-like protein [Arabidopsis thalia	0.930	0.998	0.717	0.0
357474839		760	Kinesin-3 [Medicago truncatula] gi\|35550	0.928	0.978	0.697	0.0

>gi\|224124204\|ref\|XP_002319271.1\| predicted protein [Populus trichocarpa] gi\|222857647\|gb\|EEE95194.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1239 bits (3205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/756 (79%), Positives = 679/756 (89%), Gaps = 4/756 (0%)

Query: 46  MVGTANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNK 105
           MVGTANN R+R AFSVVNG Q+ GL+S P SNAGSE G  EFTREDV ALL E+M+YKNK
Sbjct: 1   MVGTANNGRMRHAFSVVNGEQEGGLNSAPPSNAGSEYGGFEFTREDVYALLCERMKYKNK 60

Query: 106 FNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKE 165
           FNYKERCENMMDYIKRLRLCIKWFQELEG Y FE E+L+NAL+ +E +CAEM+L ++NKE
Sbjct: 61  FNYKERCENMMDYIKRLRLCIKWFQELEGSYLFEQEKLQNALDFAESRCAEMDLIVKNKE 120

Query: 166 EELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKAQ 225
           EELNLIIVELRKS ASLQEKL+KEES+KLAA+DSLAREKE RL +E+S ASLSE+LGK Q
Sbjct: 121 EELNLIIVELRKSLASLQEKLSKEESEKLAAMDSLAREKEARLTVEKSQASLSEELGKIQ 180

Query: 226 EELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENLS 285
            ELQ+ANQRI S++DMYKLLQEYNSSLQ YN+KLQ D+D AHE++KRGEKEK+AIVENLS
Sbjct: 181 GELQNANQRITSVSDMYKLLQEYNSSLQLYNSKLQTDLDTAHENVKRGEKEKAAIVENLS 240

Query: 286 TLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALTA 345
           TL GQY+SLQ+Q ++ KAS ++A +QKDALV EVAS+R ELQQVR+DRD    QVQ LTA
Sbjct: 241 TLGGQYMSLQDQFNSCKASVNDAAKQKDALVKEVASVRAELQQVREDRDQLQLQVQTLTA 300

Query: 346 EVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKL 405
           EV+  +EL + S +L+ RC SQSNQ+++L DQL AA+ KL VSDLSA E KTEFE QKKL
Sbjct: 301 EVVNCEELVIKSNELKERCVSQSNQLKTLQDQLDAAQNKLRVSDLSAFEAKTEFEEQKKL 360

Query: 406 INELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLISY 465
           I EL+N LEDAE K++EGE LRK+LHNTILELKGNIRVFCRVRPLLP+DS G++GK +SY
Sbjct: 361 ICELQNRLEDAELKIVEGETLRKKLHNTILELKGNIRVFCRVRPLLPEDSPGADGKDVSY 420

Query: 466 PTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYG 525
           PTTTEALGRGID+ QNGQK+SF+FD+VFMPD +QEDVFVEISQLVQSALDGYKVCIFAYG
Sbjct: 421 PTTTEALGRGIDLTQNGQKYSFTFDKVFMPDSTQEDVFVEISQLVQSALDGYKVCIFAYG 480

Query: 526 QTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRD 585
           QTGSGKTYTMMGKPG+ + KGLIPRSLEQIFQTRQSL SQGWKYEMQVSMLEIYNETIRD
Sbjct: 481 QTGSGKTYTMMGKPGNLEQKGLIPRSLEQIFQTRQSLQSQGWKYEMQVSMLEIYNETIRD 540

Query: 586 LLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVG 645
           LLST +D+SR E   NGKQY IKHDA+GNTHV+DLTVVDVCS++EVS+LLD+A+HSRSVG
Sbjct: 541 LLST-KDSSRTEYGSNGKQYTIKHDANGNTHVSDLTVVDVCSSREVSFLLDQASHSRSVG 599

Query: 646 KTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAGSERLSKSGSTGDRLKETQA 705
           KTQMNEQSSRSHFVFTLRISG+NE+TEQQVQG+LNLIDLAGSERLSKSGSTGDRL+ETQA
Sbjct: 600 KTQMNEQSSRSHFVFTLRISGVNENTEQQVQGVLNLIDLAGSERLSKSGSTGDRLRETQA 659

Query: 706 INKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVG 765
           INKSLSSLSDVIF+LA   KKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISP+ SS+G
Sbjct: 660 INKSLSSLSDVIFSLA---KKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPDHSSLG 716

Query: 766 ESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSLG 801
           ESLCSLRFA+RVNACEIG PRRQ +MRS +SRLSLG
Sbjct: 717 ESLCSLRFASRVNACEIGIPRRQANMRSFDSRLSLG 752

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255563647\|ref\|XP_002522825.1\| kinesin, putative [Ricinus communis] gi\|223537909\|gb\|EEF39523.1\| kinesin, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224115186\|ref\|XP_002316967.1\| predicted protein [Populus trichocarpa] gi\|222860032\|gb\|EEE97579.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225461150\|ref\|XP_002282749.1\| PREDICTED: kinesin-3 [Vitis vinifera] gi\|302143201\|emb\|CBI20496.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147768264\|emb\|CAN78128.1\| hypothetical protein VITISV_028758 [Vitis vinifera]	Back alignment and taxonomy information

>gi|18423656|ref|NP_568811.1| kinesin 3 [Arabidopsis thaliana] gi|1170621|sp|P46875.1|ATK3_ARATH RecName: Full=Kinesin-3; AltName: Full=Kinesin-like protein C gi|1438844|dbj|BAA04674.1| heavy chain polypeptide of kinesin-like protein [Arabidopsis thaliana] gi|27808616|gb|AAO24588.1| At5g54670 [Arabidopsis thaliana] gi|110736249|dbj|BAF00095.1| heavy chain polypeptide of kinesin like protein [Arabidopsis thaliana] gi|332009142|gb|AED96525.1| kinesin 3 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356543172\|ref\|XP_003540037.1\| PREDICTED: kinesin-3-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|356543174\|ref\|XP_003540038.1\| PREDICTED: kinesin-3-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|10176794\|dbj\|BAB09933.1\| kinesin-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357474839\|ref\|XP_003607705.1\| Kinesin-3 [Medicago truncatula] gi\|355508760\|gb\|AES89902.1\| Kinesin-3 [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		801
TAIR\|locus:2157533		754	ATK3 "kinesin 3" [Arabidopsis	0.940	0.998	0.719	4.7e-293
TAIR\|locus:2136437		745	ATK2 "kinesin 2" [Arabidopsis	0.927	0.997	0.692	6.7e-278
TAIR\|locus:2127378		793	ATK1 "kinesin 1" [Arabidopsis	0.971	0.981	0.611	2.2e-247
TAIR\|locus:2115713		790	ATK5 "kinesin 5" [Arabidopsis	0.967	0.981	0.590	7.2e-242
DICTYBASE\|DDB_G0267396		792	kif2 "kinesin family member 2"	0.656	0.664	0.424	8.3e-104
POMBASE\|SPAC664.10		817	klp2 "kinesin-like protein Klp	0.926	0.908	0.363	4.9e-101
ASPGD\|ASPL0000005109		770	klpA [Emericella nidulans (tax	0.724	0.753	0.404	7.4e-98
RGD\|1359118		693	Kifc1 "kinesin family member C	0.620	0.717	0.439	1.2e-90
UNIPROTKB\|F1LSD4		693	Kifc1 "Kinesin-like protein KI	0.620	0.717	0.439	1.2e-90
UNIPROTKB\|Q5XI63		693	Kifc1 "Kinesin-like protein KI	0.620	0.717	0.439	1.2e-90

TAIR\|locus:2157533 ATK3 "kinesin 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2814 (995.6 bits), Expect = 4.7e-293, P = 4.7e-293
 Identities = 545/757 (71%), Positives = 656/757 (86%)

Query:    46 MVGT-ANNARIRQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKN 104
             MVG  ANN RIR AF V NG +DL  +S PAS  GSE G +EFTREDVE LL+E+++YK+
Sbjct:     1 MVGAMANNGRIRSAFPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKS 60

Query:   105 KFNYKERCENMMDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNK 164
             KFNYKERCENMMDYIKRLRLCI+WFQELE DYAFE E+L+NALEL+E+ C +ME++L+NK
Sbjct:    61 KFNYKERCENMMDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCVDMEVSLKNK 120

Query:   165 EEELNLIIVELRKSFASLQEKLAKEESDKLAALDSLAREKETRLNMERSHASLSEDLGKA 224
             EEELN+II ELRK+F S+Q +LA+E+++KLAA DSL +EKE RL++E++ A L+E+LGKA
Sbjct:   121 EEELNMIIEELRKNFESVQVQLAREQTEKLAANDSLGKEKEARLSVEKAQAGLTEELGKA 180

Query:   225 QEELQSANQRIASINDMYKLLQEYNSSLQHYNTKLQKDIDAAHESIKRGEKEKSAIVENL 284
             Q +LQ+ANQRI S+NDMYKLLQEYNSSLQ YN+KLQ D+D AHE+IKRGEKE++AI+EN+
Sbjct:   181 QGDLQTANQRIQSVNDMYKLLQEYNSSLQLYNSKLQGDLDEAHETIKRGEKERTAIIENI 240

Query:   285 STLRGQYISLQEQLSTYKASQDEAMRQKDALVHEVASMRVELQQVRDDRDHQLSQVQALT 344
               L+GQ+ +LQEQL+  KASQ++ M+QK  LV+E+AS++VELQQV+DDRD  L +V+ L 
Sbjct:   241 GNLKGQFSALQEQLAASKASQEDIMKQKGELVNEIASLKVELQQVKDDRDRHLVEVKTLQ 300

Query:   345 AEVIKHKELAVSSEDLEARCASQSNQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKK 404
              E  K+ +   +  +LE  C+SQS QIR L D+L  +E +L+VSDLS  E   E+E QK+
Sbjct:   301 TEATKYNDFKDAITELETTCSSQSTQIRQLQDRLVNSERRLQVSDLSTFEKMNEYEDQKQ 360

Query:   405 LINELRNHLEDAEYKLIEGEKLRKRLHNTILELKGNIRVFCRVRPLLPDDSSGSEGKLIS 464
              I +L++ +E+AE KL+EGEKLRK+LHNTILELKGNIRVFCRVRPLLP +++G EGK IS
Sbjct:   361 SIIDLKSRVEEAELKLVEGEKLRKKLHNTILELKGNIRVFCRVRPLLPGENNGDEGKTIS 420

Query:   465 YPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAY 524
             YPT+ EALGRGID+MQN QKH+F+FD+VF P  SQEDVF EISQLVQSALDGYKVCIFAY
Sbjct:   421 YPTSLEALGRGIDLMQNAQKHAFTFDKVFAPTASQEDVFTEISQLVQSALDGYKVCIFAY 480

Query:   525 GQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIR 584
             GQTGSGKTYTMMG+PG+ + KGLIPR LEQIF+TRQSL SQGWKYE+QVSMLEIYNETIR
Sbjct:   481 GQTGSGKTYTMMGRPGNVEEKGLIPRCLEQIFETRQSLRSQGWKYELQVSMLEIYNETIR 540

Query:   585 DLLSTNRDASRLENACNGKQYAIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSV 644
             DLLSTN++A R ++  + +++AIKHDASGNTHV +LT++DV S++EVS+LLD AA +RSV
Sbjct:   541 DLLSTNKEAVRTDSGVSPQKHAIKHDASGNTHVAELTILDVKSSREVSFLLDHAARNRSV 600

Query:   645 GKTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLAGSERLSKSGSTGDRLKETQ 704
             GKTQMNEQSSRSHFVFTLRISG+NESTEQQVQG+LNLIDLAGSERLSKSGSTGDRLKETQ
Sbjct:   601 GKTQMNEQSSRSHFVFTLRISGVNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQ 660

Query:   705 AINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSV 764
             AINKSLSSL DVIFALAKKE   DHVPFRNSKLTYLLQPCLGGD+KTLMFVNI+PE+SS 
Sbjct:   661 AINKSLSSLGDVIFALAKKE---DHVPFRNSKLTYLLQPCLGGDAKTLMFVNIAPESSST 717

Query:   765 GESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSLG 801
             GESLCSLRFAARVNACEIGTPRRQT+++  E+RLSLG
Sbjct:   718 GESLCSLRFAARVNACEIGTPRRQTNIKPLENRLSLG 754

GO:0003777 "microtubule motor activity" evidence=IEA;ISS

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0007018 "microtubule-based movement" evidence=IEA

GO:0000226 "microtubule cytoskeleton organization" evidence=RCA

GO:0000911 "cytokinesis by cell plate formation" evidence=RCA

GO:0008017 "microtubule binding" evidence=IDA

GO:0016887 "ATPase activity" evidence=IDA

TAIR\|locus:2136437 ATK2 "kinesin 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2127378 ATK1 "kinesin 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115713 ATK5 "kinesin 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0267396 kif2 "kinesin family member 2" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

POMBASE\|SPAC664.10 klp2 "kinesin-like protein Klp2" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000005109 klpA [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

RGD\|1359118 Kifc1 "kinesin family member C1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LSD4 Kifc1 "Kinesin-like protein KIFC1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5XI63 Kifc1 "Kinesin-like protein KIFC1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P46875	ATK3_ARATH	No assigned EC number	0.7199	0.9400	0.9986	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		801
cd01366		329	cd01366, KISc_C_terminal, Kinesin motor domain, KI	0.0
pfam00225		326	pfam00225, Kinesin, Kinesin motor domain	1e-141
smart00129		335	smart00129, KISc, Kinesin motor, catalytic domain	1e-141
cd00106		328	cd00106, KISc, Kinesin motor domain	1e-125
cd01369		325	cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine	6e-92
cd01371		333	cd01371, KISc_KIF3, Kinesin motor domain, kinesins	1e-91
cd01372		341	cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik	6e-91
cd01365		356	cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K	5e-89
cd01374		321	cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E	3e-82
cd01370		338	cd01370, KISc_KIP3_like, Kinesin motor domain, KIP	4e-82
cd01375		334	cd01375, KISc_KIF9_like, Kinesin motor domain, KIF	5e-82
cd01364		352	cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC	3e-77
cd01373		337	cd01373, KISc_KLP2_like, Kinesin motor domain, KLP	8e-76
cd01367		322	cd01367, KISc_KIF2_like, Kinesin motor domain, KIF	5e-71
cd01368		345	cd01368, KISc_KIF23_like, Kinesin motor domain, KI	7e-71
cd01376		319	cd01376, KISc_KID_like, Kinesin motor domain, KIF2	7e-69
COG5059		568	COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	1e-62
PLN03188		1320	PLN03188, PLN03188, kinesin-12 family protein; Pro	3e-52
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	6e-38
COG5059		568	COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	6e-21
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	3e-17
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-13
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-13
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-13
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	9e-13
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-12
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-11
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-11
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-10
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-07
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-07
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	5e-07
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	6e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-06
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	5e-06
PRK09039		343	PRK09039, PRK09039, hypothetical protein; Validate	6e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	7e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	1e-05
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	6e-05
COG1579		239	COG1579, COG1579, Zn-ribbon protein, possibly nucl	6e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-04
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	2e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
pfam05622		713	pfam05622, HOOK, HOOK protein	3e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-04
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	4e-04
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	4e-04
pfam07111		739	pfam07111, HCR, Alpha helical coiled-coil rod prot	4e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	7e-04
TIGR00618		1042	TIGR00618, sbcc, exonuclease SbcC	8e-04
pfam13166		713	pfam13166, AAA_13, AAA domain	0.001
COG4477		570	COG4477, EzrA, Negative regulator of septation rin	0.002
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.003
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.003
pfam05483		787	pfam05483, SCP-1, Synaptonemal complex protein 1 (	0.003
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.004

>gnl\|CDD\|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

 Score =  546 bits (1410), Expect = 0.0
 Identities = 212/347 (61%), Positives = 254/347 (73%), Gaps = 19/347 (5%)

Query: 438 KGNIRVFCRVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQN-GQKHSFSFDRVFMPD 496
           KGNIRVFCRVRPLLP +S+     +IS+P   +  G  I++ +  G+K SFSFDRVF PD
Sbjct: 1   KGNIRVFCRVRPLLPSESTE-YSSVISFP---DEDGGTIELSKGTGKKKSFSFDRVFDPD 56

Query: 497 ESQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPGHPDLKGLIPRSLEQIF 556
            SQEDVF E+S LVQSALDGY VCIFAYGQTGSGKTYTM G    P+  G+IPR+LEQ+F
Sbjct: 57  ASQEDVFEEVSPLVQSALDGYNVCIFAYGQTGSGKTYTMEG---PPENPGIIPRALEQLF 113

Query: 557 QTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQYAIKHDASGNTH 616
            T + L  +GW Y +  SMLEIYNETIRDLL+T             K+  IKHD+ G T+
Sbjct: 114 NTAEELKEKGWSYTITASMLEIYNETIRDLLATKPA--------PKKKLEIKHDSKGETY 165

Query: 617 VTDLTVVDVCSTKEVSYLLDRAAHSRSVGKTQMNEQSSRSHFVFTLRISGLNESTEQQVQ 676
           VT+LT V V S +EV+ LL+  + +RSV  T MNE SSRSH VF L+I G N  T +Q +
Sbjct: 166 VTNLTEVPVSSPEEVTRLLNLGSKNRSVASTNMNEHSSRSHAVFQLKIRGTNLQTGEQTR 225

Query: 677 GILNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSK 736
           G LNL+DLAGSERL KSG+TGDRLKE QAINKSLS+L DVI AL     K+ HVP+RNSK
Sbjct: 226 GKLNLVDLAGSERLKKSGATGDRLKEAQAINKSLSALGDVISALR---SKDSHVPYRNSK 282

Query: 737 LTYLLQPCLGGDSKTLMFVNISPEASSVGESLCSLRFAARVNACEIG 783
           LTYLLQ  LGG+SKTLMFVNISP  S++ E+LCSLRFA+RV + E+G
Sbjct: 283 LTYLLQDSLGGNSKTLMFVNISPLESNLSETLCSLRFASRVRSVELG 329

Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 329

>gnl\|CDD\|215803 pfam00225, Kinesin, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|214526 smart00129, KISc, Kinesin motor, catalytic domain	Back alignment and domain information

>gnl\|CDD\|238054 cd00106, KISc, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>gnl\|CDD\|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>gnl\|CDD\|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>gnl\|CDD\|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>gnl\|CDD\|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>gnl\|CDD\|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>gnl\|CDD\|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>gnl\|CDD\|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>gnl\|CDD\|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>gnl\|CDD\|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group	Back alignment and domain information

>gnl\|CDD\|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>gnl\|CDD\|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>gnl\|CDD\|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|181619 PRK09039, PRK09039, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|218661 pfam05622, HOOK, HOOK protein	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|148617 pfam07111, HCR, Alpha helical coiled-coil rod protein (HCR)	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|129705 TIGR00618, sbcc, exonuclease SbcC	Back alignment and domain information

>gnl\|CDD\|221952 pfam13166, AAA_13, AAA domain	Back alignment and domain information

>gnl\|CDD\|226883 COG4477, EzrA, Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1)	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		801
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	100.0
KOG4280		574	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	100.0
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01370		338	KISc_KIP3_like Kinesin motor domain, KIP3-like sub	100.0
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01373		337	KISc_KLP2_like Kinesin motor domain, KLP2-like sub	100.0
PLN03188		1320	kinesin-12 family protein; Provisional	100.0
cd01368		345	KISc_KIF23_like Kinesin motor domain, KIF23-like s	100.0
cd01365		356	KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p	100.0
KOG0242		675	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01367		322	KISc_KIF2_like Kinesin motor domain, KIF2-like gro	100.0
cd01369		325	KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy	100.0
cd01366		329	KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/	100.0
cd01371		333	KISc_KIF3 Kinesin motor domain, kinesins II or KIF	100.0
cd01364		352	KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind	100.0
cd01376		319	KISc_KID_like Kinesin motor domain, KIF22/Kid-like	100.0
cd01374		321	KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like	100.0
cd01372		341	KISc_KIF4 Kinesin motor domain, KIF4-like subfamil	100.0
cd01375		334	KISc_KIF9_like Kinesin motor domain, KIF9-like sub	100.0
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	100.0
smart00129		335	KISc Kinesin motor, catalytic domain. ATPase. Micr	100.0
PF00225		335	Kinesin: Kinesin motor domain; InterPro: IPR001752	100.0
cd00106		328	KISc Kinesin motor domain. This catalytic (head) d	100.0
KOG0246		676	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0247		809	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	100.0
cd01363		186	Motor_domain Myosin and Kinesin motor domain. Thes	100.0
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.59
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.58
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.55
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.53
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.5
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.49
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.48
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.46
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.46
KOG0971		1243	consensus Microtubule-associated protein dynactin	99.43
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.42
PRK02224		880	chromosome segregation protein; Provisional	99.42
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	99.37
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	99.35
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.31
KOG0971		1243	consensus Microtubule-associated protein dynactin	99.3
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.23
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.22
PRK03918		880	chromosome segregation protein; Provisional	99.2
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	99.19
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	99.18
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.17
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	99.17
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.16
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.16
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	99.14
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	99.13
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.12
PF00038		312	Filament: Intermediate filament protein; InterPro:	99.1
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.06
PRK01156		895	chromosome segregation protein; Provisional	99.05
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	99.05
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	99.03
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.01
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	99.01
PRK04778		569	septation ring formation regulator EzrA; Provision	99.0
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.99
PRK04863		1486	mukB cell division protein MukB; Provisional	98.96
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.95
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.92
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.91
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	98.91
PRK04778		569	septation ring formation regulator EzrA; Provision	98.91
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.9
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.89
PRK04863		1486	mukB cell division protein MukB; Provisional	98.87
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	98.85
KOG0018		1141	consensus Structural maintenance of chromosome pro	98.85
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	98.84
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.84
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	98.8
KOG0018		1141	consensus Structural maintenance of chromosome pro	98.79
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	98.77
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	98.76
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	98.76
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	98.72
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	98.71
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.71
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.7
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	98.69
PHA02562		562	46 endonuclease subunit; Provisional	98.69
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	98.67
PHA02562		562	46 endonuclease subunit; Provisional	98.65
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	98.62
COG4372		499	Uncharacterized protein conserved in bacteria with	98.61
PRK11637		428	AmiB activator; Provisional	98.59
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	98.57
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.57
PRK11637		428	AmiB activator; Provisional	98.54
COG4372		499	Uncharacterized protein conserved in bacteria with	98.53
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.53
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.5
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	98.5
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	98.49
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.48
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	98.46
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	98.45
PF14662		193	CCDC155: Coiled-coil region of CCDC155	98.45
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	98.45
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	98.43
COG5185		622	HEC1 Protein involved in chromosome segregation, i	98.4
KOG0963		629	consensus Transcription factor/CCAAT displacement	98.39
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	98.37
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	98.36
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	98.35
COG4942		420	Membrane-bound metallopeptidase [Cell division and	98.33
PRK10929		1109	putative mechanosensitive channel protein; Provisi	98.32
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	98.32
COG4942		420	Membrane-bound metallopeptidase [Cell division and	98.29
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	98.26
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	98.22
COG5185		622	HEC1 Protein involved in chromosome segregation, i	98.2
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	98.2
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	98.19
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	98.19
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.18
PRK11281		1113	hypothetical protein; Provisional	98.17
COG4477		570	EzrA Negative regulator of septation ring formatio	98.17
KOG0963		629	consensus Transcription factor/CCAAT displacement	98.13
PRK10929		1109	putative mechanosensitive channel protein; Provisi	98.07
PRK11281		1113	hypothetical protein; Provisional	98.05
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.01
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	98.01
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	98.0
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.99
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	97.9
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	97.9
PRK09039		343	hypothetical protein; Validated	97.88
PRK09039		343	hypothetical protein; Validated	97.84
COG4477		570	EzrA Negative regulator of septation ring formatio	97.84
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	97.82
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.78
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	97.76
KOG0979		1072	consensus Structural maintenance of chromosome pro	97.75
PF13514		1111	AAA_27: AAA domain	97.74
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	97.7
KOG0979		1072	consensus Structural maintenance of chromosome pro	97.69
PRK10246		1047	exonuclease subunit SbcC; Provisional	97.69
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	97.66
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.65
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	97.65
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.6
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	97.56
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	97.52
PRK10246		1047	exonuclease subunit SbcC; Provisional	97.49
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	97.49
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.48
KOG1937		521	consensus Uncharacterized conserved protein [Funct	97.48
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	97.48
PF13514		1111	AAA_27: AAA domain	97.45
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.42
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	97.37
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	97.37
COG4717		984	Uncharacterized conserved protein [Function unknow	97.33
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.32
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	97.32
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	97.25
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	97.21
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	97.21
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	97.19
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	97.18
KOG1937		521	consensus Uncharacterized conserved protein [Funct	97.13
KOG0249		916	consensus LAR-interacting protein and related prot	97.11
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	97.09
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	97.08
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	97.06
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	97.01
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	97.0
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.97
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.91
KOG0249		916	consensus LAR-interacting protein and related prot	96.9
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.89
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.84
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	96.79
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.74
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.69
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	96.68
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	96.57
PLN02939		977	transferase, transferring glycosyl groups	96.52
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	96.3
PRK10869		553	recombination and repair protein; Provisional	96.25
PRK10869		553	recombination and repair protein; Provisional	96.24
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	96.22
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	96.22
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	96.19
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	96.11
KOG2991		330	consensus Splicing regulator [RNA processing and m	95.99
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	95.99
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	95.99
PLN02939		977	transferase, transferring glycosyl groups	95.95
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	95.95
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	95.92
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	95.91
KOG2991		330	consensus Splicing regulator [RNA processing and m	95.91
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	95.85
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	95.83
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	95.73
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	95.72
PF13166		712	AAA_13: AAA domain	95.71
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	95.7
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	95.68
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	95.66
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.64
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	95.62
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	95.45
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	95.34
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	95.29
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	95.09
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	95.03
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	94.9
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	94.9
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	94.85
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	94.66
PF13949		296	ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI	94.59
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	94.33
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	94.25
KOG4302		660	consensus Microtubule-associated protein essential	94.23
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	94.22
KOG4302		660	consensus Microtubule-associated protein essential	94.2
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	94.07
KOG2196		254	consensus Nuclear porin [Nuclear structure]	93.98
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	93.97
COG3206		458	GumC Uncharacterized protein involved in exopolysa	93.95
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	93.93
COG4026		290	Uncharacterized protein containing TOPRIM domain,	93.92
PRK03992		389	proteasome-activating nucleotidase; Provisional	93.87
PRK06620		214	hypothetical protein; Validated	93.85
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	93.83
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	93.72
COG4717		984	Uncharacterized conserved protein [Function unknow	93.67
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	93.67
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	93.67
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	93.62
PRK06835		329	DNA replication protein DnaC; Validated	93.61
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	93.61
COG2433		652	Uncharacterized conserved protein [Function unknow	93.44
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	93.39
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	93.3
PRK08084		235	DNA replication initiation factor; Provisional	93.22
PRK06893		229	DNA replication initiation factor; Validated	93.1
PRK10884		206	SH3 domain-containing protein; Provisional	93.08
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	93.07
KOG4677		554	consensus Golgi integral membrane protein [Intrace	93.05
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	93.02
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	92.97
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	92.94
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	92.92
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	92.83
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	92.82
PRK12377		248	putative replication protein; Provisional	92.82
KOG1103		561	consensus Predicted coiled-coil protein [Function	92.77
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	92.73
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	92.13
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	92.03
PRK07952		244	DNA replication protein DnaC; Validated	91.94
KOG0288		459	consensus WD40 repeat protein TipD [General functi	91.89
PRK14086		617	dnaA chromosomal replication initiation protein; P	91.87
COG3096		1480	MukB Uncharacterized protein involved in chromosom	91.69
PLN03188		1320	kinesin-12 family protein; Provisional	91.56
PRK05642		234	DNA replication initiation factor; Validated	91.44
KOG1103		561	consensus Predicted coiled-coil protein [Function	91.36
PRK08903		227	DnaA regulatory inactivator Hda; Validated	91.35
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	91.29
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	91.08
PRK08116		268	hypothetical protein; Validated	91.07
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	90.9
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	90.88
PRK10865		857	protein disaggregation chaperone; Provisional	90.85
PRK09087		226	hypothetical protein; Validated	90.64
COG3206		458	GumC Uncharacterized protein involved in exopolysa	90.6
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	90.58
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	90.53
PRK14088		440	dnaA chromosomal replication initiation protein; P	90.52
KOG2751		447	consensus Beclin-like protein [Signal transduction	90.42
KOG2751		447	consensus Beclin-like protein [Signal transduction	90.33
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	90.31
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	90.31
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	90.11
KOG2196		254	consensus Nuclear porin [Nuclear structure]	90.09
PRK11519		719	tyrosine kinase; Provisional	89.96
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	89.93
cd09234		337	V_HD-PTP_like Protein-interacting V-domain of mamm	89.87
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	89.79
COG5283		1213	Phage-related tail protein [Function unknown]	89.77
PRK08939		306	primosomal protein DnaI; Reviewed	89.72
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	89.72
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	89.64
COG5008		375	PilU Tfp pilus assembly protein, ATPase PilU [Cell	89.13
PRK08181		269	transposase; Validated	88.83
PRK11519		719	tyrosine kinase; Provisional	88.62
PRK14087		450	dnaA chromosomal replication initiation protein; P	88.54
PRK00149		450	dnaA chromosomal replication initiation protein; R	88.53
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	88.09
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	88.05
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	87.89
PF13245		76	AAA_19: Part of AAA domain	87.73
PF03915		424	AIP3: Actin interacting protein 3; InterPro: IPR02	87.71
PRK08727		233	hypothetical protein; Validated	87.61
PF13863		126	DUF4200: Domain of unknown function (DUF4200)	87.43
KOG0972		384	consensus Huntingtin interacting protein 1 (Hip1)	87.19
PRK12704		520	phosphodiesterase; Provisional	87.14
KOG4687		389	consensus Uncharacterized coiled-coil protein [Fun	86.77
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	86.74
PRK10436		462	hypothetical protein; Provisional	86.61
cd08915		342	V_Alix_like Protein-interacting V-domain of mammal	86.47
COG0593		408	DnaA ATPase involved in DNA replication initiation	86.36
KOG4572		1424	consensus Predicted DNA-binding transcription fact	86.27
PF03148		384	Tektin: Tektin family; InterPro: IPR000435 Tektin	85.96
PRK10361		475	DNA recombination protein RmuC; Provisional	85.95
PF15358		558	TSKS: Testis-specific serine kinase substrate	85.77
smart00283		262	MA Methyl-accepting chemotaxis-like domains (chemo	85.5
COG1484		254	DnaC DNA replication protein [DNA replication, rec	85.48
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	85.2
KOG2685		421	consensus Cystoskeletal protein Tektin [Cytoskelet	85.17
PRK06921		266	hypothetical protein; Provisional	85.14
COG5283		1213	Phage-related tail protein [Function unknown]	85.13
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	85.13
TIGR02533		486	type_II_gspE general secretory pathway protein E.	85.03
PF15294		278	Leu_zip: Leucine zipper	85.03
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	84.81
PRK12704		520	phosphodiesterase; Provisional	84.72
PRK12422		445	chromosomal replication initiation protein; Provis	84.51
PRK10361		475	DNA recombination protein RmuC; Provisional	84.5
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	84.49
PF11570		136	E2R135: Coiled-coil receptor-binding R-domain of c	84.43
KOG4460		741	consensus Nuclear pore complex, Nup88/rNup84 compo	84.33
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	83.79
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	83.73
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	83.49
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	83.42
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	83.32
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	83.23
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	83.21
PF11180		192	DUF2968: Protein of unknown function (DUF2968); In	83.15
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	83.1
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	82.89
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	82.61
PRK00411		394	cdc6 cell division control protein 6; Reviewed	82.53
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	82.37
PRK06526		254	transposase; Provisional	82.36
KOG3859		406	consensus Septins (P-loop GTPases) [Cell cycle con	82.31
TIGR02971		327	heterocyst_DevB ABC exporter membrane fusion prote	82.15
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	82.1
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	82.07
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	81.96
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	81.74
TIGR03794		421	NHPM_micro_HlyD NHPM bacteriocin system secretion	81.72
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	81.7
PF03999		619	MAP65_ASE1: Microtubule associated protein (MAP65/	81.64
KOG0992		613	consensus Uncharacterized conserved protein [Funct	81.08
KOG3850		455	consensus Predicted membrane protein [Function unk	81.0
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	80.99
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	80.79
PF08172		248	CASP_C: CASP C terminal; InterPro: IPR012955 This	80.64
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	80.6
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	80.46
PTZ00112		1164	origin recognition complex 1 protein; Provisional	80.4
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	80.34
COG3096		1480	MukB Uncharacterized protein involved in chromosom	80.16

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

Probab=100.00  E-value=4.3e-84  Score=718.20  Aligned_cols=417  Identities=54%  Similarity=0.780  Sum_probs=352.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHhhhhhhhhcccCceeEEe
Q 003711          369 NQIRSLSDQLAAAEEKLEVSDLSALETKTEFEGQKKLINELRNHLEDAEYKLI---EGEKLRKRLHNTILELKGNIRVFC  445 (801)
Q Consensus       369 ~~~~~l~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~l~~~l~---~~e~~~~~l~~~l~~l~~~i~~~~  445 (801)
                      .++..|+.++..++..+..+......+..++......+..+..++..+...+.   ..+..++.|++++.+++|+|||||
T Consensus       241 ~~i~~l~~~l~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~l~~~~~e~~~r~kL~N~i~eLkGnIRV~C  320 (670)
T KOG0239|consen  241 KKIQALQQELEELKAELKELNDQVSLLTREVQEALKESNTLQSDLESLEENLVEKKKEKEERRKLHNEILELKGNIRVFC  320 (670)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCceEEE
Confidence            33444444444444444444444444444444433333333334444333333   344889999999999999999999


Q ss_pred             eeCCCCCCCCCCCCCceEEcCCCccccccceeeecCCceeEEEeceecCCCCChhhHHHHHHHHHHHhhcCCceEEEeec
Q 003711          446 RVRPLLPDDSSGSEGKLISYPTTTEALGRGIDIMQNGQKHSFSFDRVFMPDESQEDVFVEISQLVQSALDGYKVCIFAYG  525 (801)
Q Consensus       446 r~~~~~~~e~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~f~fd~v~~~~~~~~~~~~~~~~~v~~~~~G~n~~v~~yG  525 (801)
                      ||||..+.+.......++.+++...+......-......+.|.||+||+|.++|++||.++.|+|++++||||+||||||
T Consensus       321 RvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~fdkVf~p~~sQ~~VF~e~~~lv~S~lDGYnVCIFAYG  400 (670)
T KOG0239|consen  321 RVRPLLPSEKQRLQSKVIDTEEQGEVQVDSPDKGDKLEPQSFKFDKVFGPLASQDDVFEEVSPLVQSALDGYNVCIFAYG  400 (670)
T ss_pred             EecCCCccccccccccccccCCcceeEeecCCCCCCCccccceeeeecCCcccHHHHHHHHHHHHHHHhcCcceeEEEec
Confidence            99999988877655566666665333333333333444557999999999999999999999999999999999999999


Q ss_pred             cCCcccceeeccCCCCCCCCCchHHHHHHHHHHHHhhhhcCCeeeEEEEEEEEEccceecccCCCccchhhhhccCCCce
Q 003711          526 QTGSGKTYTMMGKPGHPDLKGLIPRSLEQIFQTRQSLLSQGWKYEMQVSMLEIYNETIRDLLSTNRDASRLENACNGKQY  605 (801)
Q Consensus       526 ~tgsGKt~tl~G~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~~~v~~S~~ei~~e~v~DLL~~~~~~~~~~~~~~~~~~  605 (801)
                      ||||||||||.|+  .+...|||||++.+||..+..... +|.|.+.+||+||||++|+|||++..         .+..+
T Consensus       401 QTGSGKTyTM~G~--~~~~~Giipral~~lF~~~~~~~~-g~~y~~~~s~~EIYNe~i~DlL~~~~---------~~~k~  468 (670)
T KOG0239|consen  401 QTGSGKTYTMSGP--TPEDPGIIPRALEKLFRTITSLKS-GWKYDKTVSMLEIYNEAIRDLLSDES---------YVGKL  468 (670)
T ss_pred             ccCCCccccccCC--CcccCCccHHHHHHHHHHHHhhcc-CceEEeeeehhHHHHHHHHHhccccc---------cccce
Confidence            9999999999995  233459999999999999999755 99999999999999999999998764         23788


Q ss_pred             EEEeCCCCCeEEcccEEEEeCChHHHHHHHHHHhhcCccccCCCCCCCCCceeEEEEEEeeccCCCCceEEEEEEEEecC
Q 003711          606 AIKHDASGNTHVTDLTVVDVCSTKEVSYLLDRAAHSRSVGKTQMNEQSSRSHFVFTLRISGLNESTEQQVQGILNLIDLA  685 (801)
Q Consensus       606 ~~~~~~~~~~~~~~~~~~~v~s~~e~~~~l~~~~~~r~~~~~~~n~~ssrsh~i~~i~i~~~~~~~~~~~~~~l~~vDLa  685 (801)
                      .|+++..+..+|.+++.+.|.+..++..+++.|..+|++++|.+|..|||||+||+|+|...+..+...+.|.|+|||||
T Consensus       469 ~I~~~~~~~~~V~~~t~~~V~s~~~v~~ll~~g~~nRsv~~T~~Ne~SSRSH~v~~v~v~g~~~~t~~~~~g~l~LVDLA  548 (670)
T KOG0239|consen  469 EIVDDAEGNLMVPLLTVIKVGSSEEVDILLEIGLSNRSVASTASNERSSRSHLVFRVRIRGINELTGIRVTGVLNLVDLA  548 (670)
T ss_pred             eEEEcCCCceecccceEEecCCHHHHHHHHHHhhccccccccccchhhhccceEEEEEEeccccCcccccccceeEeecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCccccchHHHHHHHHHHHHHHHHHHHhcccCCCCCcccCCcccccccccccCCCccEEEEEecCCCCCCHH
Q 003711          686 GSERLSKSGSTGDRLKETQAINKSLSSLSDVIFALAKKEKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPEASSVG  765 (801)
Q Consensus       686 gse~~~~~~~~~~~~~e~~~in~sl~~L~~~i~~l~~~~~~~~~vp~r~s~LT~lL~~~l~g~s~~~~i~~isp~~~~~~  765 (801)
                      ||||+++++++|.|++|+++||+||++||+||.+|+..   ..||||||||||+||+|||||+++|+||++|||...++.
T Consensus       549 GSER~~~s~~tG~RlkE~Q~INkSLS~LgdVi~AL~~k---~~HiPyRNSKLT~lLq~sLGG~sKTLmfv~isP~~~~~~  625 (670)
T KOG0239|consen  549 GSERVSKSGVTGERLKEAQNINKSLSALGDVISALASK---RSHIPYRNSKLTQLLQDSLGGDSKTLMFVNISPAAAALF  625 (670)
T ss_pred             cCcccCcCCCchhhhHHHHHhchhhhhhHHHHHHHhhc---CCCCcccccchHHHhHhhhCCccceeeEEEeCccHHHHh
Confidence            99999999999999999999999999999999999984   789999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhcccCCCcccccccCccccccC
Q 003711          766 ESLCSLRFAARVNACEIGTPRRQTSMRSSESRLSL  800 (801)
Q Consensus       766 etl~tL~fa~~~~~~~~~~~~~~~~~~~~~~~~~~  800 (801)
                      ||+++|+||.|++.|++|+.++++......+..++
T Consensus       626 Etl~sL~FA~rv~~~~lG~a~~~~~~~~~~~~~~~  660 (670)
T KOG0239|consen  626 ETLCSLRFATRVRSVELGSARKQVSTSDDVSLKRF  660 (670)
T ss_pred             hhhhccchHHHhhceecccccccccccchhhhhhh
Confidence            99999999999999999999999887776665544

>KOG4280 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>KOG0242 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group	Back alignment and domain information

>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>smart00129 KISc Kinesin motor, catalytic domain	Back alignment and domain information

>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>cd00106 KISc Kinesin motor domain	Back alignment and domain information

>KOG0246 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0247 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01363 Motor_domain Myosin and Kinesin motor domain	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>KOG2196 consensus Nuclear porin [Nuclear structure]	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2196 consensus Nuclear porin [Nuclear structure]	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>cd09234 V_HD-PTP_like Protein-interacting V-domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>COG5283 Phage-related tail protein [Function unknown]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PF13863 DUF4200: Domain of unknown function (DUF4200)	Back alignment and domain information

>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms]	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules []	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PF15358 TSKS: Testis-specific serine kinase substrate	Back alignment and domain information

>smart00283 MA Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer)	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>COG5283 Phage-related tail protein [Function unknown]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species	Back alignment and domain information

>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PF03999 MAP65_ASE1: Microtubule associated protein (MAP65/ASE1 family); InterPro: IPR007145 This is a family of microtubule associated proteins	Back alignment and domain information

>KOG0992 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3850 consensus Predicted membrane protein [Function unknown]	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		801
2rep_A		376	Crystal Structure Of The Motor Domain Of Human Kine		9e-90
4gkr_A		371	Structure Of The C-Terminal Motor Domain Of Kar3 Fr		7e-89
3t0q_A		349	Motor Domain Structure Of The Kar3-Like Kinesin Fro		1e-87
4etp_A		403	C-Terminal Motor And Motor Homology Domain Of Kar3v		5e-87
1f9t_A		358	Crystal Structures Of Kinesin Mutants Reveal A Sign		1e-84
2ncd_A		420	Ncd (Non-Claret Disjunctional) Dimer From D. Melano		1e-80
3kar_A		346	The Motor Domain Of Kinesin-Like Protein Kar3, A Sa		2e-80
1cz7_A		406	The Crystal Structure Of A Minus-End Directed Micro		2e-80
1f9w_A		347	Crystal Structures Of Mutants Reveal A Signalling P		2e-80
1f9v_A		347	Crystal Structures Of Mutants Reveal A Signalling P		3e-80
1f9u_A		347	Crystal Structures Of Mutants Reveal A Signalling P		4e-80
1n6m_A		409	Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY		1e-79
3u06_A		412	Crystal Structure Of The Kinesin-14 Ncdg347d Length		1e-79
3l1c_A		383	Kinesin-14 Protein Ncd, T436s Mutant Length = 383		4e-79
4h1g_A		715	Structure Of Candida Albicans Kar3 Motor Domain Fus		1e-78
3h4s_A		386	Structure Of The Complex Of A Mitotic Kinesin With		4e-74
2h58_A		330	Crystal Structure Of The Kifc3 Motor Domain In Comp		1e-73
1sdm_A		369	Crystal Structure Of Kinesin-Like Calmodulin Bindin		7e-70
3b6u_A		372	Crystal Structure Of The Motor Domain Of Human Kine		2e-59
1goj_A		355	Structure Of A Fast Kinesin: Implications For Atpas		8e-57
3gbj_A		354	Crystal Structure Of The Motor Domain Of Kinesin Ki		2e-55
1mkj_A		349	Human Kinesin Motor Domain With Docked Neck Linker		3e-53
1bg2_A		325	Human Ubiquitous Kinesin Motor Domain Length = 325		3e-53
4atx_C		340	Rigor Kinesin Motor Domain With An Ordered Neck-Lin		9e-53
3b6v_A		395	Crystal Structure Of The Motor Domain Of Human Kine		4e-52
2y5w_A		365	Crystal Structure Of Drosophila Melanogaster Kinesi		8e-51
2vvg_A		350	Crystal Structure Of The G.Intestinalis Kinesin 2 G		1e-50
1t5c_A		349	Crystal Structure Of The Motor Domain Of Human Kine		6e-50
1i5s_A		367	Crystal Structure Of The Kif1a Motor Domain Complex		8e-50
1i6i_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		9e-50
2wbe_C		373	Kinesin-5-Tubulin Complex With Amppnp Length = 373		9e-50
1ia0_K		394	Kif1a Head-Microtubule Complex Structure In Atp-For		1e-49
1vfv_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		1e-49
4aqv_C		373	Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma		4e-49
4a14_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		6e-48
1ii6_A		368	Crystal Structure Of The Mitotic Kinesin Eg5 In Com		2e-47
4a28_A		368	Eg5-2 Length = 368		2e-47
1q0b_A		367	Crystal Structure Of The Motor Protein Ksp In Compl		2e-47
4a1z_A		368	Eg5-1 Length = 368		2e-47
3hqd_A		369	Human Kinesin Eg5 Motor Domain In Complex With Ampp		2e-47
1x88_A		359	Human Eg5 Motor Domain Bound To Mg-Adp And Monastro		3e-47
4ap0_A		370	The Mitotic Kinesin Eg5 In Complex With Mg-Adp And		3e-47
3zcw_A		348	Eg5 - New Allosteric Binding Site Length = 348		6e-47
2owm_A		443	Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3		6e-47
3nwn_A		359	Crystal Structure Of The Human Kif9 Motor Domain In		2e-46
2xt3_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		4e-45
3lre_A		355	Crystal Structure Analysis Of Human Kinesin-8 Motor		2e-43
3bfn_A		388	Crystal Structure Of The Motor Domain Of Human Kine		3e-42
2kin_A		238	Kinesin (Monomeric) From Rattus Norvegicus Length =		2e-34
1ry6_A		360	Crystal Structure Of Internal Kinesin Motor Domain		3e-32
1v8j_A		410	The Crystal Structure Of The Minimal Functional Dom		1e-31
2heh_A		387	Crystal Structure Of The Kif2c Motor Domain (Casp T		3e-31
3edl_D		331	Kinesin13-Microtubule Ring Complex Length = 331		5e-31
3dc4_A		344	Crystal Structure Of The Drosophila Kinesin Family		6e-31
3pxn_A		344	Crystal Structure Of The Drosophila Kinesin Family		1e-30
2gry_A		420	Crystal Structure Of The Human Kif2 Motor Domain In		8e-28
3kin_B		117	Kinesin (Dimeric) From Rattus Norvegicus Length = 1		1e-08
2kin_B		100	Kinesin (Monomeric) From Rattus Norvegicus Length =		4e-08

>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376