Citrus Sinensis ID: 003724

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
ccccccccccccEEEcccccccEEccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEEccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHcccccccccHHHHcccEEEEEEEcccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEcccccHHHHHHHccccEEEEEEEEcccEEEEEEccHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHccccccHHHEEEEEEEEEcccEEEEccccccc
ccHHHHHcHcccEEEcccccEEEHHcHHcccccEEEEcccccccccccccHcccccEEEEcccccHHccccHHHHHHccEEEcccccHHcHHHHHcHcccccHcEEEcccccccccHHHHHHHHHHHccccEEEEccccccHHHHcHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccEcccHcccccccccccHHHccccccccccccccccccccccccccccccccccccHHHcccccccEEEcccccccccccccccccHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHcccccHHHcHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccccHccccccccccccccccHHHHHcccccccccccHHHHHHEEEEEEEcccccccEEEEEEEcccccEEEEEEEEEEcccccccEEEccccHHHHHHHEEHccEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHccccHHEHHEEEEEEEcccccEEEccccccc
mdeslqllpavetldlsrnkfakvdnlrkcvnlkhldlgFNNLRSIAAFSEVSCHIVKLVLRNNAlttlrgienlkslegldisYNIISTFSELEFLASLPYLLNlwlegnplccsrwyRAQVFSYfahpaklkvdgkeisTRELWERQLIIARRqkrpagfgfyspakgnadgdgnanrkRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaEIIDLMSRVEHMKRERSILWLREFKEWMdhtsenfvdgsicsgatlmnceednyiknkrsqphlaesskyvsgsvqasgdesstnilesensyadmptglhayqsfdhigslgitggfslpgigrmelrqenekpylhdgagaatvqsksfhqdtftiqdrrmvenihespltpidditdafsssarpgspphyredILHRRHNLVAEILQLSAESYsvvssdsktscsdddfreygpsmlevdqsinpeheyssAEVHSLLNLFeedhndqpheidcqrencknngfsaggndgevdssvNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLngnlniseadnvgeqgkhifglnyllrtsdkkqtrenavmtpYISGIGSVAKFLSSVKEDFVEDyfnknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFwcsedkvihlspyisn
mdeslqllpavetldlsrnkfakvdnlrkcvnLKHLDLGFNNLRSIAAFSEVSCHIVKLVLrnnalttlrgienlksleglDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPaklkvdgkeistRELWERQLIIArrqkrpagfgfyspakgnadgdgnanrKRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaeIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAEsskyvsgsvqasgdeSSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHespltpidditdaFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYsvvssdsktscsddDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLleknkrkhtrRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEdkvihlspyisn
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLsaesysvvssdsktscsdddFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
*********AVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFY**************************************************************IIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNY*******************************************TGLHAYQSFDHIGSLGITGGFSLPGIGRM*****************************FTI***************************************ILHRRHNLVAEILQLS*************************************************************************************************************************LQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSD****RENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPY***
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELW*************************************************************************************************************************************************************************************************************************************************************************************ILHRRHNLVAEILQLSA***********************************************************************************************************************************EAD*VGEQGKHIFGLNY********************SGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYI**
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGN***************************************NEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNK*************************TNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAE***************DDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQK*****************************************************************DDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSI*SGATLM**EE********************************************MPTGLHAYQSFDHIGSLGIT***********E******KPYLHDGAGAAT*************************************SS*ARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSS*************************NP************************HEIDCQ***C*NNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKT*A**NLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYIS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDKVIHLSPYISN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query800 2.2.26 [Sep-21-2011]
Q6P4K6 1129 Serine/threonine-protein yes no 0.246 0.174 0.328 3e-17
Q9Y2I1 1504 Nischarin OS=Homo sapiens yes no 0.16 0.085 0.398 5e-15
Q80TM9 1593 Nischarin OS=Mus musculus yes no 0.16 0.080 0.398 6e-15
Q5F4791073 Serine/threonine-protein no no 0.181 0.135 0.346 9e-15
Q4G017 1502 Nischarin OS=Rattus norve no no 0.16 0.085 0.390 3e-14
Q8N1F8 1099 Serine/threonine-protein no no 0.176 0.128 0.346 9e-13
Q6IRN0 1137 Serine/threonine-protein N/A no 0.246 0.173 0.314 3e-12
Q3TAA71072 Serine/threonine-protein no no 0.165 0.123 0.347 3e-12
Q4LDG9190 Dynein light chain 1, axo no no 0.141 0.594 0.371 6e-10
Q6DHB1192 Dynein light chain 1, axo no no 0.141 0.588 0.380 8e-10
>sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 116/210 (55%), Gaps = 13/210 (6%)

Query: 1   MDESLQLLPAVETLDLSRNKFAKVDNLRKCVN-LKHLDLGFNNLRSIAAFSEV-SCHIVK 58
           +D SL+LL +++ LDLS N+  +  +  K ++ L++L+LG+N+L ++   S   +  +  
Sbjct: 176 LDGSLELLNSLKILDLSHNQITECGSYLKVLSELQYLNLGYNHLTAVPELSVGNTAKLHS 235

Query: 59  LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 118
           L+L++N L+   G+ENL +L+ LD+SYN++   S+L  LA L  L  L+LEGNPL   + 
Sbjct: 236 LILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPLYFQKD 295

Query: 119 YRAQVFSYFAHPAK--LKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDG 176
           YRA    + +H A   + +DGK +S+ E+   Q    + + +P+     S   G+     
Sbjct: 296 YRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDLTDSY 355

Query: 177 NANRK------RKKA---CRLASIESEEES 197
           +A  K      RKK+    R ASI    +S
Sbjct: 356 SAAEKSAPRLPRKKSRVKVRTASISERSDS 385

Xenopus tropicalis (taxid: 8364)
>sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 Back     alignment and function description
>sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 Back     alignment and function description
>sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 Back     alignment and function description
>sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 Back     alignment and function description
>sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 Back     alignment and function description
>sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 Back     alignment and function description
>sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 Back     alignment and function description
>sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 Back     alignment and function description
>sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query800
359491520 1089 PREDICTED: uncharacterized protein LOC10 0.905 0.664 0.531 0.0
297734346 992 unnamed protein product [Vitis vinifera] 0.866 0.698 0.516 0.0
356524698 1091 PREDICTED: uncharacterized protein LOC10 0.926 0.679 0.485 0.0
449527667 977 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.92 0.753 0.472 0.0
449439162 1090 PREDICTED: uncharacterized protein LOC10 0.925 0.678 0.474 0.0
42562612 1063 Outer arm dynein light chain 1 protein [ 0.931 0.700 0.442 1e-165
42571803 1051 Outer arm dynein light chain 1 protein [ 0.931 0.708 0.442 1e-165
297847122 1066 leucine-rich repeat family protein [Arab 0.932 0.699 0.446 1e-163
357521685 1238 hypothetical protein MTR_8g107440 [Medic 0.787 0.508 0.482 1e-155
297830430 1009 hypothetical protein ARALYDRAFT_898146 [ 0.842 0.667 0.419 1e-148
>gi|359491520|ref|XP_002278916.2| PREDICTED: uncharacterized protein LOC100250985 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/816 (53%), Positives = 536/816 (65%), Gaps = 92/816 (11%)

Query: 1   MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 60
           MDESLQLLPAVETLDLSRNKF+KVDNLRKC  LKHLDLGFN+LR+I++FSEVSCHIVKLV
Sbjct: 183 MDESLQLLPAVETLDLSRNKFSKVDNLRKCTKLKHLDLGFNHLRTISSFSEVSCHIVKLV 242

Query: 61  LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYR 120
           +RNNALTTLRGIENLKSLE LD+SYN+IS FSE+E LA LP L  LWLEGNP+CC+RWYR
Sbjct: 243 MRNNALTTLRGIENLKSLEDLDLSYNVISNFSEIEILAGLPSLRRLWLEGNPICCARWYR 302

Query: 121 AQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANR 180
           AQVFS+FAHP K+K+D  EISTRE W+RQ+IIA RQKRPA FGFY PA+ +A G+G  + 
Sbjct: 303 AQVFSFFAHPDKVKLDEMEISTREFWKRQIIIASRQKRPASFGFYYPAREDA-GEGGIST 361

Query: 181 KRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKR 240
           KRKK  RLA IE+ E S  + SD++SVSCDNE+ SKE+N  SDD+AEI+DLM RVE MK+
Sbjct: 362 KRKKLSRLACIET-EGSMYICSDQDSVSCDNEVRSKEDNAISDDEAEIVDLMKRVELMKK 420

Query: 241 ERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGS 300
           ERS+LWLREFKEWMD  S++F +G+     ++++   +NY++ K  Q HL ESS+YVS S
Sbjct: 421 ERSVLWLREFKEWMDLASDSFAEGN--KYGSVLDSGTENYMRKKAGQRHLGESSRYVSDS 478

Query: 301 VQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEK 360
           VQASGDES T+ILES NS+AD+  GL   Q  D  G  G                     
Sbjct: 479 VQASGDESGTDILESNNSFADISIGL-VPQYVDRSGESG--------------------- 516

Query: 361 PYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHY 420
                                F ++D            T +D I D  S S  PGSPPHY
Sbjct: 517 -------------------SMFALRD------------TGVDAIQDQ-SKSYSPGSPPHY 544

Query: 421 REDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYS 480
           +ED+LHRRH LV +ILQLSAESYSV SSDS TS   +D  E   S+ EV+QS+N E    
Sbjct: 545 QEDLLHRRHILVEDILQLSAESYSVASSDSNTS-DSNDLCEVESSVSEVEQSVNEEISNR 603

Query: 481 SAEVHSLLNLFEEDHNDQPHEIDCQRENCK--------------------------NNGF 514
           S   HSL   F   + +Q H+I   REN +                          +N F
Sbjct: 604 SVG-HSLTTFFGNIYYEQRHQIPLVRENGRYLLDSHAGQASATLKLLKPEQSLQLCSNDF 662

Query: 515 SAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEAD 574
            AG +DGE+ S  N+EA  L+K K K   R I  + + N V + E  Q L GN +    D
Sbjct: 663 CAGAHDGEIASLSNEEADWLDKKKCKRKPRKIVSVSQNNMVGRAEDSQTLVGNPDFCGGD 722

Query: 575 NVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFL---SSVKEDFVEDYFN 631
              EQG+ IFG N+     D +QT  +A +TP I   G +   L   ++  +DF+++YFN
Sbjct: 723 MEDEQGEQIFGWNFWDGFVDGEQTCASATITPLIDDAGRILSGLRGPTTGADDFIKNYFN 782

Query: 632 KNVADSKSHETCMQY--TVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSIL 689
            N+ADS  +ETC QY  + C+ LE +  +  REVA+L SSE+K YVLL  VT DG+G+IL
Sbjct: 783 LNIADSSVNETCKQYMRSSCF-LELESRYTEREVAILLSSEHKLYVLLVDVTFDGSGTIL 841

Query: 690 NLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSAND 749
            LLGCH++ED+REVL+G+GLQV+RV  E  A Y+ +TRS+EKSRQL CTLQ+        
Sbjct: 842 KLLGCHRLEDVREVLVGVGLQVVRVYIERDAAYMFLTRSMEKSRQLLCTLQVVDSNETCS 901

Query: 750 KCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFW 785
           KCSLRSLEQVQVELFEK ICGG K+ IFQYS+VLFW
Sbjct: 902 KCSLRSLEQVQVELFEKHICGGSKISIFQYSLVLFW 937

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734346|emb|CBI15593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356524698|ref|XP_003530965.1| PREDICTED: uncharacterized protein LOC100788364 [Glycine max] Back     alignment and taxonomy information
>gi|449527667|ref|XP_004170831.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228525 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439162|ref|XP_004137356.1| PREDICTED: uncharacterized protein LOC101203626 [Cucumis sativus] Back     alignment and taxonomy information
>gi|42562612|ref|NP_175287.2| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194190|gb|AEE32311.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42571803|ref|NP_973992.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194191|gb|AEE32312.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847122|ref|XP_002891442.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297337284|gb|EFH67701.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357521685|ref|XP_003631131.1| hypothetical protein MTR_8g107440 [Medicago truncatula] gi|355525153|gb|AET05607.1| hypothetical protein MTR_8g107440 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297830430|ref|XP_002883097.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] gi|297328937|gb|EFH59356.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query800
TAIR|locus:21980651063 AT1G48540 [Arabidopsis thalian 0.532 0.400 0.533 1.3e-154
TAIR|locus:20885251010 AT3G17920 [Arabidopsis thalian 0.371 0.294 0.638 1.1e-148
UNIPROTKB|Q5F4791073 STK11IP "Serine/threonine-prot 0.181 0.135 0.346 3e-16
UNIPROTKB|F1P3Y6 1001 F1P3Y6 "Uncharacterized protei 0.181 0.144 0.346 5.6e-15
UNIPROTKB|C9J715583 NISCH "Nischarin" [Homo sapien 0.216 0.296 0.342 3.1e-14
ZFIN|ZDB-GENE-040426-1022 1160 stk11ip "serine/threonine kina 0.181 0.125 0.373 4.9e-14
ZFIN|ZDB-GENE-050208-570 1444 nisch "nischarin" [Danio rerio 0.198 0.110 0.373 8.1e-14
UNIPROTKB|F1ML951073 STK11IP "Uncharacterized prote 0.181 0.135 0.344 3.5e-13
RGD|13050461072 Stk11ip "serine/threonine kina 0.181 0.135 0.357 7.9e-13
UNIPROTKB|J9JHB1 1439 NISCH "Uncharacterized protein 0.211 0.117 0.341 2.7e-12
TAIR|locus:2198065 AT1G48540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1151 (410.2 bits), Expect = 1.3e-154, Sum P(2) = 1.3e-154
 Identities = 234/439 (53%), Positives = 307/439 (69%)

Query:     1 MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 60
             MDESLQLLPA E+LDLSRNKF KVDNLR+C  LKHLDLGFN+LR+++  S+VSCH+VKLV
Sbjct:   183 MDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVKLV 242

Query:    61 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYR 120
             LRNNALTTLRGIENLKSL+GLD+SYNIIS FSELEFL SL  L  LWLEGNP+CC+RWYR
Sbjct:   243 LRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARWYR 302

Query:   121 AQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANR 180
             A VFSY A P +LK+DGK+I TRE W+RQ+I+A RQ  PA +GFYSPA+   + +G+ NR
Sbjct:   303 AHVFSYVALPDELKLDGKQIGTREFWKRQIIVAHRQSEPASYGFYSPAREEDNEEGSCNR 362

Query:   181 KRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKR 240
             K+KK CRLASI SE EST V SD ES +CD+E    +EN+  + +A+I  L+S+VEH+K+
Sbjct:   363 KKKKICRLASIHSEAESTYVNSDHESATCDHE---NKENMKFNQEADIFGLISKVEHLKK 419

Query:   241 ERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKR-SQPHLAESSKYVSG 299
             ERS+LWLREFKEWMD ++E+F D  +C  +  +N E+  Y K +  S+ H   + +Y SG
Sbjct:   420 ERSVLWLREFKEWMDRSTEDFAD--VCKDSQGINLEKKYYTKIREISRHHGGGTPRYTSG 477

Query:   300 SVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENE 359
             S++AS  +S    LE   S  D   G+   +  +   +  IT   S   +   +  Q+++
Sbjct:   478 SLRASRAKSYRKNLECNGSCVDHKAGMDYMKYVEGNETQKITDDISSISLQSTDRNQKHQ 537

Query:   360 KPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPH 419
             +  +HD   + +V+       T  +   ++ EN + S L    DIT   + S  PGSPPH
Sbjct:   538 E-CVHDEMESLSVEPNDLLPTT--LAKEKLAENGNMSTL----DITQHMTGSTYPGSPPH 590

Query:   420 YREDILHRRHNLVAEILQL 438
             Y++D+L+RRHNLV EILQL
Sbjct:   591 YQKDVLYRRHNLVEEILQL 609
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2088525 AT3G17920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F479 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3Y6 F1P3Y6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C9J715 NISCH "Nischarin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1022 stk11ip "serine/threonine kinase 11 interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-570 nisch "nischarin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1ML95 STK11IP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1305046 Stk11ip "serine/threonine kinase 11 interacting protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHB1 NISCH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query800
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information 
 Score = 44.0 bits (105), Expect = 4e-06
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 9  PAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSE 51
            +ETLDLS N+   +  L    NL+ LDL  N +  ++  S 
Sbjct: 1  TNLETLDLSNNQITDLPPLSNLPNLETLDLSGNKITDLSPLSN 43

Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains. Length = 43
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 800
KOG18591096 consensus Leucine-rich repeat proteins [General fu 100.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.63
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.11
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.08
KOG0617264 consensus Ras suppressor protein (contains leucine 99.07
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.05
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.02
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.99
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.95
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.89
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.8
KOG06181081 consensus Serine/threonine phosphatase 2C containi 98.73
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 98.71
KOG4237498 consensus Extracellular matrix protein slit, conta 98.66
KOG06181081 consensus Serine/threonine phosphatase 2C containi 98.65
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 98.6
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.51
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
KOG2123388 consensus Uncharacterized conserved protein [Funct 98.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.42
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.39
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.29
PLN03150623 hypothetical protein; Provisional 98.23
PLN032101153 Resistant to P. syringae 6; Provisional 98.21
KOG4237498 consensus Extracellular matrix protein slit, conta 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.08
PLN03150623 hypothetical protein; Provisional 98.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.01
PLN032101153 Resistant to P. syringae 6; Provisional 98.0
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.48
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.34
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 96.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 96.8
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.79
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 96.72
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.56
PRK15386426 type III secretion protein GogB; Provisional 96.35
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.24
PRK15386426 type III secretion protein GogB; Provisional 93.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 91.04
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 84.78
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.01
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-81  Score=707.08  Aligned_cols=765  Identities=36%  Similarity=0.484  Sum_probs=634.3

Q ss_pred             CchhcCCCCCCcEEeCCCCCCCCCCCCCCCCCCcEEECCCCCCCccccccccCCCCcEEEccCCCCCCCcCCCCCCCCCE
Q 003724            1 MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEG   80 (800)
Q Consensus         1 LPesL~~L~~Le~LdLS~N~Ls~Ip~L~~L~nLq~LnLS~N~LssLp~l~~~L~~L~~LnLS~NkLtsLp~L~~L~sL~~   80 (800)
                      |+++|..|+.|+.|+|++|+++.+.+|..|+.|++|||++|.++.+|.+...-.+|..|+|++|.++++.++.+|.+|+.
T Consensus       179 mD~SLqll~ale~LnLshNk~~~v~~Lr~l~~LkhLDlsyN~L~~vp~l~~~gc~L~~L~lrnN~l~tL~gie~LksL~~  258 (1096)
T KOG1859|consen  179 MDESLQLLPALESLNLSHNKFTKVDNLRRLPKLKHLDLSYNCLRHVPQLSMVGCKLQLLNLRNNALTTLRGIENLKSLYG  258 (1096)
T ss_pred             HHHHHHHHHHhhhhccchhhhhhhHHHHhcccccccccccchhccccccchhhhhheeeeecccHHHhhhhHHhhhhhhc
Confidence            57889999999999999999999999999999999999999999999877665679999999999999999999999999


Q ss_pred             EEccCCcCCCCchhhhhcCCCCCCEEEccCCCCCCCcccchhHhhccC---CCcEEEcCCCCCCchhhHHHHHHHHhhcC
Q 003724           81 LDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFA---HPAKLKVDGKEISTRELWERQLIIARRQK  157 (800)
Q Consensus        81 LdLS~N~IssL~~L~~L~~LpnLr~LdLs~NpLs~~p~~r~~i~s~L~---sLslL~LDgNpIs~~E~~~a~~l~s~~~~  157 (800)
                      |||++|.|..+.++..+..|..|+.|+|.|||++|.|++|..++.++.   -+..+.|||..++..++|........+..
T Consensus       259 LDlsyNll~~hseL~pLwsLs~L~~L~LeGNPl~c~p~hRaataqYl~~~~a~~~f~LDgk~l~~~efwk~~s~~~hr~~  338 (1096)
T KOG1859|consen  259 LDLSYNLLSEHSELEPLWSLSSLIVLWLEGNPLCCAPWHRAATAQYLHKNSAPVKFKLDGKALGGREFWKRQSGVSHRSS  338 (1096)
T ss_pred             cchhHhhhhcchhhhHHHHHHHHHHHhhcCCccccCHHHHHHHHhHhccccCCcceEecceeccchhhhhhhhheecCCC
Confidence            999999999999999999999999999999999999999999999988   67889999999999999999999999999


Q ss_pred             CCCCccccCCCCCCCCCCCchhhhhhhhhhhhhccccccccccC--CCCCCCCcCcccccc--cccCCCCChHHHHHHHH
Q 003724          158 RPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVG--SDRESVSCDNEIESK--EENVASDDDAEIIDLMS  233 (800)
Q Consensus       158 ~p~~~~~~~P~k~~~~~ed~~~~k~kk~~RL~~I~~ee~ss~~~--SdqqS~s~~~~sss~--ee~~lsd~d~Ei~dlis  233 (800)
                      .|..|+.++|++.....+..+.++.+++.+++.+.....+.+..  |+.++.+++.+..++  .++.....+..+.+++.
T Consensus       339 ~p~s~~~~S~a~~~~~~dgS~~~s~gki~tl~~ihs~~~s~~v~r~S~~e~at~DpE~~s~~~t~a~~f~q~~pe~el~s  418 (1096)
T KOG1859|consen  339 RPASYGFYSPARSENTSDGSQFRSKGKIYTLASIHSEDESTYVNRISDCESATCDPEESSEINTEAAKFSQEAPEFELIS  418 (1096)
T ss_pred             CCCCCCCCCchhccCCCccchhhhcCceeecccccchhhhheeccccccccccCCccccccCCCccccccCCCchhhhcc
Confidence            99999999999999999999999999999999999999888776  788888877775544  34444445555678999


Q ss_pred             HHHHHhhhhhhhHHHHHHHHhhhcccccCCCccccCccccccchhhhHhhhcCCcccccccccccccccccCCCCccccc
Q 003724          234 RVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNIL  313 (800)
Q Consensus       234 ~VE~LKke~s~~WL~ef~Ewmd~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~s~y~~~~~~as~~~~~~n~l  313 (800)
                      ++++++++++..|+|+|+|||+.....+.++.+.+..+..+++ |+.+-+....++.+.++||+.+...+.-..+.+|.+
T Consensus       419 ~~~hl~~~r~vl~lR~~~Ew~~~p~~~~~~~s~~sqpt~seq~-~~tk~rn~p~~e~~g~p~~tp~sl~~~i~~~p~~n~  497 (1096)
T KOG1859|consen  419 KVEHLKKERSVLWLREFKEWLDSPNEDFMDVSKTSQPTESEQK-YYTKLRNEPLHEGSGTPRYTPGSLHHNISSTPTNNV  497 (1096)
T ss_pred             chHHHhhhhhHHHHHHHhhhhcCCchhhccccCCCCCcchhcC-cccccCCCCcccccCCCcCCCCccchhhccCcccch
Confidence            9999999999999999999999999999999999999999998 466666777777779999999999999999999999


Q ss_pred             ccCCCccCCcccccccccccccCCcccccCccCCCCccccccccccCCcccccccccccc-------ccccCcCCccccc
Q 003724          314 ESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQ-------SKSFHQDTFTIQD  386 (800)
Q Consensus       314 es~~s~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~  386 (800)
                      |..++|.|.-+|+..+|+.....+.-++-....+.-.-.|+||++|.   |.+||...+.       +.+.+...|++++
T Consensus       498 e~~~~~~~~~~g~~~e~~~e~~et~~et~~e~~~~~~et~ln~~~~~---c~legpp~~~~~~~~l~vss~~l~e~~l~~  574 (1096)
T KOG1859|consen  498 ELASTFDATITGIKSEANDESGETLYETCTEGEETNQETDLNQKHQL---CTLEGPPDRHEELLRLYVSSSNLQEDPLSD  574 (1096)
T ss_pred             hhcccccccccchhhhcccccccccccccccchhhhhhhhcccccee---ccccCCcccchhhheeecccccccccchhh
Confidence            99999999999999999999988888888889999999999999994   4599987766       7788888999999


Q ss_pred             cccccccCCCCCccccCcccCCCCCCCCCCCCchhhhHHHHHhhHHHHHHhhccCc----ceeecCCCCCcCCccCCCCC
Q 003724          387 RRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAES----YSVVSSDSKTSCSDDDFREY  462 (800)
Q Consensus       387 ~~~~~n~~~s~~~~~~~~~~~~~s~~~p~spp~y~~d~l~rr~~l~ee~lq~s~~~----~~v~s~~s~~s~s~~~~~~~  462 (800)
                      .+..|||+|+.+    ++.++.+.+.+|+||||||+|+|+||++|++||||++||+    |+|+|+|+.++|+++++++.
T Consensus       575 a~~dE~~~m~tl----ea~q~e~~s~~~sSp~~~~kD~L~~r~~lsl~il~ic~d~~~~~y~v~~~D~~ss~~e~en~ls  650 (1096)
T KOG1859|consen  575 AESDENGNMSTL----EAKQSETGSLTPSSPPHYQKDVLTRRANLSLEILQICADSRSINYSVASSDKQSSCSEVENYLS  650 (1096)
T ss_pred             hhhhcccceeee----ecccccccccCCCCCCCccccccccchhHHHHHHHhCcccccccceeecccccchhhhhhhccc
Confidence            999999999999    9999999999999999999999999999999999999999    99999999999999999988


Q ss_pred             CCCccccccccCcccccCCcccccccchhhcccCCCCCcccccc--cc-----------c---cCcccCCCCCCCCcccc
Q 003724          463 GPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQR--EN-----------C---KNNGFSAGGNDGEVDSS  526 (800)
Q Consensus       463 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--e~-----------~---~~~~f~~~~~~~~~~~~  526 (800)
                      +.        .+.....+...+++..|++.=--|-+.++-+...  |+           +   .+.+|..|.|.-+-.+.
T Consensus       651 ~~--------~~~~~eq~~~~rdL~~~r~~i~~C~~cgt~F~~eqp~kg~~~kelr~pd~~k~~t~~v~~~~~s~~~~~~  722 (1096)
T KOG1859|consen  651 EE--------LESNLEQILLQRDLTENRISIYRCVNCGTQFLIEQPEKGSKIKELRCPDSRKVYTTNVTSGLHSLKPSGG  722 (1096)
T ss_pred             Hh--------hhhhHhhhhhhhhhhccccceeeeccccccccccCcccccchhhhcCcchhhcccccccccccccCCccc
Confidence            77        3333445666667766664211222222222222  11           1   37899999999777799


Q ss_pred             chhhhhHhHhhc--cccceeeeecccccc--cchhhhhhhhccCCCcCCcccccccccceeeecccccccccccccccc-
Q 003724          527 VNQEAHLLEKNK--RKHTRRVISLLKEQN--TVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTREN-  601 (800)
Q Consensus       527 ~~q~~~~~~~~k--~k~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  601 (800)
                      |||+.+|.+|+-  |||++|.+..+++..  -+|+-+..--       +-+|+.+-.--...--++|-+-..--+.+.. 
T Consensus       723 v~a~~rl~p~~~~~rkp~e~~~ap~~~es~~ci~kg~~shl-------~~ad~s~~~e~~~~rDh~fw~ns~lp~~c~~~  795 (1096)
T KOG1859|consen  723 VNAEPRLSPKMIVERKPVERLVAPINEESSNCIGKGEASHL-------SDADISDSDEDNTIRDHEFWENSSLPHLCTSH  795 (1096)
T ss_pred             eecccccCcchhhhccchhhhccccccccccccCccchhhh-------hhcccCCccccccccccchhccCCCCcccccc
Confidence            999999999987  999999988887755  2222111111       0111111000000000000000000000100 


Q ss_pred             ---ccccccccCcCccceecccchhhh-HHHhhhccccCCchhhhhccceEE-EEEecCCccccee-------EEEEeec
Q 003724          602 ---AVMTPYISGIGSVAKFLSSVKEDF-VEDYFNKNVADSKSHETCMQYTVC-WILEQDFMHRGRE-------VAVLRSS  669 (800)
Q Consensus       602 ---~~~~~~~~~~~~~~~~~~~~~~~~-~~~~fn~~~a~~~~~e~c~~~~~~-~~~~~~~~~~~~e-------v~~l~ss  669 (800)
                         +++..-+     ..+|-......| ++.||-+..|.+..-|+|+.|+.| +|+|..+.|.|||       ++||++|
T Consensus       796 ~~~~rs~~FL-----e~E~~~~~~e~~q~~~~~paklav~S~~~~c~~~vS~~~i~~~~sTyeqre~~a~~lq~~Ll~~s  870 (1096)
T KOG1859|consen  796 DEVARSKSFL-----ETEFGLLLAEQAQVEELFPAKLAVSSHVETCRSYVSCDVILQICSTYEQRETDAPQLQNVLLLSS  870 (1096)
T ss_pred             hhhHHHHHHH-----HHHhhhhhhhhcccccccchhhccCCCCceeEEEecccchhhhhchhhhcCCCchhhhheeeccc
Confidence               1111000     011111112344 778999999999999999999999 9999999999999       9999999


Q ss_pred             CCeeEEEEEeeeecCCcccccccccccchhhHHHhhhccceEEEEEe------------------eCCceEEEEeccHHH
Q 003724          670 ENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVST------------------EMGATYLLMTRSIEK  731 (800)
Q Consensus       670 ~~klyvll~~~~~d~~~~~~~~l~~~~~e~~~~v~~g~glq~~r~~~------------------~~~~~~~f~t~~~~~  731 (800)
                      |||+||+|++|..|-.++.++++|.|-+.|+|.|.||||+|++++.-                  --.--++|.+|+++|
T Consensus       871 qd~l~~gl~g~S~~le~sa~s~~c~~~~~d~q~~~~~l~~~~~~Les~~~~~~~~~~~~~~~~~i~hrl~~~f~~~~fkE  950 (1096)
T KOG1859|consen  871 QDKLYVGLVGVSTDLEKSALSALCSHFISDFQDVSVGLGLQKVLLESEATVFQPYKFNYSDFNDIDHRLKLYFYQRKFKE  950 (1096)
T ss_pred             ccceeeeeccccchhhhhhcccccccchhhhhhhhhHHHHHHHHHhccchhhhccccccccccchhhhhhhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999988761                  223457899999999


Q ss_pred             HHHHh------------------h-----heeeecccccCCc-----cccchhhHH-------HHHHHHhhhcCCcc-ee
Q 003724          732 SRQLF------------------C-----TLQIFYLVSANDK-----CSLRSLEQV-------QVELFEKQICGGLK-VG  775 (800)
Q Consensus       732 ~~~~~------------------~-----~~~~~~~~~~~~~-----~~~~s~e~v-------qv~l~~~~ic~~~~-~~  775 (800)
                      +++++                  .     .+...|.-..--.     ||..+.|+|       +|.|||+++|++++ +.
T Consensus       951 ~~e~f~~ra~lveG~~~~~~c~l~~~~~~flp~dDaa~sp~~~~~~a~s~~s~edi~p~~~~~~v~l~e~~~ls~lS~l~ 1030 (1096)
T KOG1859|consen  951 DGELFKWRAKLVEGLVVMSNCKLYLMEAFFLPHDDAAKSPYQVVSVAVSRLSAEDILPWKLWGGVVLLEHDMLSTLSLLN 1030 (1096)
T ss_pred             hhHHHHHHHHHhcCchhhhhhhhhhhHhhcccccccccCcccccchhhhhhhhhhcCCcCCCCceEEEeccccchHHHHH
Confidence            99996                  2     3455565555555     899999999       99999999999999 99


Q ss_pred             eeeeeeeeEEecCCCeee
Q 003724          776 IFQYSMVLFWCSEDKVIH  793 (800)
Q Consensus       776 if~y~~~~~~~~~~~~~~  793 (800)
                      +|||.-+.|++....+++
T Consensus      1031 ~~q~~pl~~q~~~~~~vs 1048 (1096)
T KOG1859|consen 1031 YLQQIPLPFQSKLNHQVS 1048 (1096)
T ss_pred             HHhhCCchhhhhhcccch
Confidence            999999999887766653

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query800
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 2e-10
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 3e-10
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 5e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 5e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-04
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (49%), Gaps = 9/151 (5%)
Query: 1   MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 60
           MD +L  L A + L LS N   K+ +L    NL+ L LG N ++ I     V+  + +L 
Sbjct: 41  MDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELW 100
Query: 61  LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLC------ 114
           +  N + +L GIE L +L  L +S N I+ + E++ LA+L  L +L L GNPL       
Sbjct: 101 ISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPLYNDYKEN 160
Query: 115 -CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 144
             +  YR +V      P   K+DG  +   E
Sbjct: 161 NATSEYRIEVVKRL--PNLKKLDGMPVDVDE 189
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query800
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-25
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-23
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  134 bits (339), Expect = 3e-36
 Identities = 50/151 (33%), Positives = 75/151 (49%), Gaps = 9/151 (5%)

Query: 1   MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 60
           MD +L  L A + L LS N   K+ +L    NL+ L LG N ++ I     V+  + +L 
Sbjct: 40  MDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELW 99

Query: 61  LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLC------ 114
           +  N + +L GIE L +L  L +S N I+ + E++ LA+L  L +L L GNPL       
Sbjct: 100 ISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPLYNDYKEN 159

Query: 115 -CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 144
             +  YR +V     +  KL  DG  +   E
Sbjct: 160 NATSEYRIEVVKRLPNLKKL--DGMPVDVDE 188
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 800
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-15
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-09
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 72.1 bits (176), Expect = 1e-15
 Identities = 30/121 (24%), Positives = 55/121 (45%)

Query: 13  TLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGI 72
            L L+      + +L + + + HLDL  N LR++         +  L   +NAL  + G+
Sbjct: 2   VLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGV 61

Query: 73  ENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAK 132
            NL  L+ L +  N +   + ++ L S P L+ L L+GN LC     + ++       + 
Sbjct: 62  ANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSS 121

Query: 133 L 133
           +
Sbjct: 122 I 122
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query800
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.78
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.42
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.27
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.26
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.1
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.93
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.19
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.07
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=3.1e-19  Score=135.32  Aligned_cols=146  Identities=23%  Similarity=0.301  Sum_probs=128.6

Q ss_pred             HCCCCCCCCEEECCCCCCCCCCCC-CCCCCCCEEECCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCC--CCCCCCCCE
Q ss_conf             107999886996879999998798-99998759988899888665552367897699854888999768--889999988
Q 003724            4 SLQLLPAVETLDLSRNKFAKVDNL-RKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRG--IENLKSLEG   80 (800)
Q Consensus         4 sL~~L~sLq~LdLS~N~Ls~IpsL-~~L~sLk~LnLS~N~LssLp~l~~lL~~Lk~LnLS~N~LtsLp~--L~~L~sL~~   80 (800)
                      .+.....|++|+|++|+|+.++.+ ..++.|+.|++++|.|+.++.+. .+++|+.|++++|.++.++.  +..+++|+.
T Consensus        13 ~~~n~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~~~-~l~~L~~L~ls~N~i~~l~~~~~~~l~~L~~   91 (162)
T d1a9na_          13 QYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFP-LLRRLKTLLVNNNRICRIGEGLDQALPDLTE   91 (162)
T ss_dssp             EEECTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECCCC-CCSSCCEEECCSSCCCEECSCHHHHCTTCCE
T ss_pred             HCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCC-CCCCHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             516857484897889978865762004145998989799787647744-5761306431021345777632233453443


Q ss_pred             EECCCCCCCCCCHHHHHCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHH
Q ss_conf             975589689886033406999987998359989878661026742069995898399989914567999999
Q 003724           81 LDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLII  152 (800)
Q Consensus        81 LDLS~N~IssL~eL~~L~sLpnLr~L~LsgNpIs~~~~yr~~ils~L~~LklL~LDgnpIs~~Er~~a~~lf  152 (800)
                      |++++|.|..++++..+..+++|+.|++++||++..+.|+..++..+  |++..||+.+|+..|+..++.+|
T Consensus        92 L~L~~N~i~~~~~l~~l~~l~~L~~L~l~~N~i~~~~~~r~~~i~~l--p~L~~LD~~~i~~~er~~A~~~~  161 (162)
T d1a9na_          92 LILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKV--PQVRVLDFQKVKLKERQEAEKMF  161 (162)
T ss_dssp             EECCSCCCCCGGGGGGGGGCTTCCEEECCSSGGGGSTTHHHHHHHHC--TTCSEETTEECCHHHHHHHHHTT
T ss_pred             CEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHC--CCCCEECCCCCCHHHHHHHHHHH
T ss_conf             42030001665421100136532066407996345610699999878--99583379799999999999986
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure