Citrus Sinensis ID: 003813


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790---
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
cccccccccccccEEEccccccccccccHHHHcccccccEEEccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcHHHHcccccccEEEccccEEEEEEcccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHHcccccEEEccccccEEEcccccccccccccccccEEEccccccEEEcccHHHccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHHcccccEEEcccccccccccHHHHHHcccccEEEccccccEEEccccccccccccEEEcccccccccccHHHcccccccccccccccccEEEccccccEEEEEEEEEEcccHHHHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccEEEEEEcc
cccHHHccccccEEEEcccccccccccccHHHccccccEEEEcccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHHHHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEcccccccccccHccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccccccEEEEcccccccccccHHHHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccccccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccHHccEEEccccccccccccccccEEEEEccccccccccHHHHcccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccHHHccHHHcccccccccccccccccccccEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
miphqlgnlsnlqyldlsgynfklhADTISWLSGLSLLKHLYISSVNlskasdsllvinslpslkelklsfcklhhfpplssanfsslttldlsenefqgqipsrlgnltslkyLDLSFnqfnsvvpgwlsklndleFLSLQSNRlqgnisslglENLTSIQTLLLSgndelggkiptsfgrfcklksfstgftnlsQDISEILGIFSACVAnelesldlgscqifghmtnqlgrfkglnfldlsnttmdgsiplslgqianleyldlsknelngtvseIHFVNLTKLVTFrangnslifkinpnwvppfqltglgvrscrlgprfplwlqsQKKLNDLYISStrisakiprRFWNSIFQYWFLNISgnqmyggvpkfdspsmplvtnlgsifdlsnnalsgsIFHLICQGENFSKNIEFFQLSknhfsgeipdcwmnwprlrmlnlrnnnftgslpmsiGTLSSLMSLNLrnnrlsgiiptsfnnfTILEALDmgenelvgniptwmGERFSRLIILNlrsnkfhgdfpiQLCRLASLQILDVAYnnlsgtiprcinnfsamattdssdqsndIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGidisknnfsgevpvevtnlqglqslnfsynlftgripdnigvMRSIESLDfsanqlsgyipqsmsnlsFLNYLNLsnnnlngeipsstqlqsfggssfadndlcgaplpnctkksvlvtddqnrigneedgdetdWTLYISMALGFVVGFWCFigpllikrrwRYKYCHFLDrlwdgcfvrkcy
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGAPlpnctkksvlvtddqnrigneedgdetDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLdrlwdgcfvrkCY
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPrlrmlnlrnnnFTGSLPMSIGTlsslmslnlrnnrlsGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMsnlsflnylnlsnnnlnGEIPSSTQLQSFGGSSFADNDLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
*******NLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMAT*******NDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNN**********************NDLCGAPLPNCTKKSVLVT*************ETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKC*
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMAT**********FYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGA****************************DWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADNDLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query793 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.829 0.525 0.303 2e-65
C0LGQ5 1249 LRR receptor-like serine/ no no 0.925 0.587 0.304 2e-65
Q9FL28 1173 LRR receptor-like serine/ no no 0.778 0.526 0.305 5e-65
Q9C9H7847 Receptor-like protein 12 no no 0.824 0.772 0.310 1e-64
Q9LYN8 1192 Leucine-rich repeat recep no no 0.754 0.501 0.299 1e-57
C0LGS2 1136 Probable LRR receptor-lik no no 0.822 0.573 0.290 1e-54
Q9LVP0 1102 Probable leucine-rich rep no no 0.745 0.536 0.303 7e-52
C0LGV1 1135 LRR receptor-like serine/ no no 0.752 0.525 0.297 2e-51
Q9FZ59 1088 Leucine-rich repeat recep no no 0.745 0.543 0.298 9e-51
O49318 1124 Probable leucine-rich rep no no 0.736 0.519 0.293 1e-50
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  251 bits (641), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 234/771 (30%), Positives = 345/771 (44%), Gaps = 113/771 (14%)

Query: 24  LHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPLSSA 83
           L  D  S L  L  LK L +    L+          +L +L+ L L+ C+L    P    
Sbjct: 132 LSGDIPSQLGSLVNLKSLKLGDNELNGTIPE--TFGNLVNLQMLALASCRLTGLIPSRFG 189

Query: 84  NFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQS 143
               L TL L +NE +G IP+ +GN TSL     +FN+ N  +P  L++L +L+ L+L  
Sbjct: 190 RLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGD 249

Query: 144 NRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISE- 202
           N   G I S  L +L SIQ L L GN +L G IP        L++      NL+  I E 
Sbjct: 250 NSFSGEIPS-QLGDLVSIQYLNLIGN-QLQGLIPKRLTELANLQTLDLSSNNLTGVIHEE 307

Query: 203 ----------------ILGIFSACVAN---ELESLDLGSCQIFGHMTNQLGRFKGLNFLD 243
                           + G     + +    L+ L L   Q+ G +  ++   + L  LD
Sbjct: 308 FWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLD 367

Query: 244 LSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKIN 303
           LSN T+ G IP SL Q+  L  L L+ N L GT+S     NLT L  F    N+L  K+ 
Sbjct: 368 LSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSS-SISNLTNLQEFTLYHNNLEGKV- 425

Query: 304 PNWVPPFQLTGLG-------------------VRSC-----------RLGPRFPLWLQSQ 333
                P ++  LG                   + +C           RL    P  +   
Sbjct: 426 -----PKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRL 480

Query: 334 KKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIF 393
           K L  L++    +   IP    N   Q   ++++ NQ+ G +P     S   +T L  +F
Sbjct: 481 KDLTRLHLRENELVGNIPASLGN-CHQMTVIDLADNQLSGSIPS----SFGFLTAL-ELF 534

Query: 394 DLSNNALSGSIFHLICQGENFSKNIEF--------------------FQLSKNHFSGEIP 433
            + NN+L G++   +   +N ++ I F                    F +++N F G+IP
Sbjct: 535 MIYNNSLQGNLPDSLINLKNLTR-INFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIP 593

Query: 434 DCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILEAL 493
                   L  L L  N FTG +P + G +S L  L++  N LSGIIP        L  +
Sbjct: 594 LELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHI 653

Query: 494 DMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTI 553
           D+  N L G IPTW+G +   L  L L SNKF G  P ++  L ++  L +  N+L+G+I
Sbjct: 654 DLNNNYLSGVIPTWLG-KLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSI 712

Query: 554 PRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDIS 613
           P+ I N  A+   +  +                      + G L      L+ +  + +S
Sbjct: 713 PQEIGNLQALNALNLEENQ--------------------LSGPLPSTIGKLSKLFELRLS 752

Query: 614 KNNFSGEVPVEVTNLQGLQS-LNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQS 672
           +N  +GE+PVE+  LQ LQS L+ SYN FTGRIP  I  +  +ESLD S NQL G +P  
Sbjct: 753 RNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQ 812

Query: 673 MSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADN-DLCGAPLPNCTK 722
           + ++  L YLNLS NNL G++    Q   +   +F  N  LCG+PL +C +
Sbjct: 813 IGDMKSLGYLNLSYNNLEGKL--KKQFSRWQADAFVGNAGLCGSPLSHCNR 861




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
315436720 1020 verticillium wilt resistance-like protei 0.981 0.762 0.474 0.0
224072885 1024 predicted protein [Populus trichocarpa] 0.979 0.758 0.455 0.0
356561550 1093 PREDICTED: LRR receptor-like serine/thre 0.976 0.708 0.426 1e-172
255581850 1082 leucine-rich repeat receptor protein kin 0.984 0.721 0.419 1e-170
255539443 1054 serine-threonine protein kinase, plant-t 0.974 0.733 0.420 1e-170
356561552 1019 PREDICTED: LRR receptor-like serine/thre 0.976 0.759 0.425 1e-170
356561665 1072 PREDICTED: LRR receptor-like serine/thre 0.972 0.719 0.406 1e-169
356561606 1051 PREDICTED: leucine-rich repeat receptor 0.977 0.737 0.416 1e-168
356561667 1018 PREDICTED: leucine-rich repeat receptor 0.976 0.760 0.423 1e-168
350284773 1041 receptor-like protein [Malus x domestica 0.973 0.741 0.433 1e-168
>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/855 (47%), Positives = 527/855 (61%), Gaps = 77/855 (9%)

Query: 1    MIPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINS 60
            ++P QLGNL+NL  LDL  ++  ++A+ + WLS L  LKHL +SSVNLSKASD   V N+
Sbjct: 162  VVPPQLGNLTNLHVLDLHDFSSLVYAENLQWLSHLVKLKHLDLSSVNLSKASDWFQVTNT 221

Query: 61   LPSLKELKLSFCKLHHFPPLSSANFSSLTTLDLS-------------------------E 95
            LPSL E+ LS C+LH  P  +  NFSSL+ LDLS                          
Sbjct: 222  LPSLVEIHLSGCQLHRLPLQADVNFSSLSILDLSSNSFSNPLIPGWIFKLNSLLSLDLSH 281

Query: 96   NEFQGQIPSRLGNLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGL 155
            N FQGQ+P  L +L+SL+YL+L +N F S +P WL  L  LEFL+L SN   G+IS+ G 
Sbjct: 282  NNFQGQLPHGLRSLSSLRYLNLYWNNFKSAIPSWLYGLTSLEFLNLGSNYFHGSISN-GF 340

Query: 156  ENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSA--CVAN 213
            +NLTS+ TL LS N EL G +P S G  C LK       +LS+D+SEIL   S+  C+ N
Sbjct: 341  QNLTSLTTLDLSDN-ELTGAVPNSMGSLCSLKKIKLSGLHLSRDLSEILQALSSPGCLLN 399

Query: 214  ELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNEL 273
             LESL L SC+IFGH+T+++  FK L  L LS  ++ GSIP SLG +A+L  LDLS+N +
Sbjct: 400  GLESLYLDSCEIFGHLTDRILLFKNLADLSLSRNSISGSIPASLGLLASLRTLDLSQNRV 459

Query: 274  NGT------------------------VSEIHFVNLTKLVTFRANGNSLIFKINPNWVPP 309
            NGT                        VSE+HF NLT+L  F+A+GN L+ + +P WVPP
Sbjct: 460  NGTLPESIGQLWKMEKLWLSHNMLEGVVSEVHFANLTRLRLFQASGNPLVLEASPEWVPP 519

Query: 310  FQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGN 369
            FQL  + + S  LGP+FP WL+SQ+    L IS T I    P  FWN    Y+ LN+S N
Sbjct: 520  FQLGVMALSSWHLGPKFPSWLRSQRDFVYLDISVTGIIDTFPNWFWNLSTIYFSLNLSHN 579

Query: 370  QMYGGVPK-------------------FDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQ 410
            Q+YG +P                    FD P +P +++  +  DLS+N  SG I +L+C 
Sbjct: 580  QIYGELPHRIGTSPVADLVYVDLSFNHFDGP-LPCLSSKVNTLDLSSNLFSGPISNLLCC 638

Query: 411  GENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLN 470
                   +E   L+ NH SGEIPDCWMNWP +  ++L NN+ +G +P S+G+L+ L SL+
Sbjct: 639  KMEEPYWLETLHLADNHLSGEIPDCWMNWPNMVSVDLENNSLSGVIPSSMGSLNLLQSLH 698

Query: 471  LRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFP 530
            LR N LSG++P+S  N T L A+D+GEN  VGNIP W+GE+ S  II++L SN+F G  P
Sbjct: 699  LRKNNLSGVLPSSLQNCTSLLAIDLGENHFVGNIPGWIGEKLSDSIIISLGSNRFQGQIP 758

Query: 531  IQLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDAL 590
              LC L+ L ILD+A+NNLSGTIP+C  N SAMA   +S  SN I YA       +E  L
Sbjct: 759  DNLCSLSYLTILDLAHNNLSGTIPKCFMNLSAMAANQNS--SNPISYAFGHFGTSLETLL 816

Query: 591  LVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIG 650
            L++KG L+EY S L LV  +D+S NN +GE+P  +T+L GL+ LN S N   GRIP NIG
Sbjct: 817  LMIKGILLEYSSTLQLVTSMDLSDNNLAGEIPAGMTDLLGLRFLNLSNNQLKGRIPKNIG 876

Query: 651  VMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADN 710
             +R +ES+D S NQL G IP SMS L+FL+YLNLS NNL G+IPSSTQLQSF  SS+  N
Sbjct: 877  NLRLLESIDLSRNQLRGEIPPSMSALTFLSYLNLSENNLTGKIPSSTQLQSFDISSYDGN 936

Query: 711  DLCGAPLPN-CTKKSVLVTDDQNRIGNEEDGDETDWT-LYISMALGFVVGFWCFIGPLLI 768
             LCG PL   C+  +   +D  N   NE DG E DW   Y SMA GFVVGFW  +GPLL 
Sbjct: 937  HLCGPPLLEICSTDATTSSDHNNNENNEGDGLEVDWLWFYASMAFGFVVGFWVVMGPLLF 996

Query: 769  KRRWRYKYCHFLDRL 783
             + WR++Y   L+RL
Sbjct: 997  NKSWRFRYFRILERL 1011




Source: Gossypium barbadense

Species: Gossypium barbadense

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356561550|ref|XP_003549044.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
>gi|255581850|ref|XP_002531725.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223528628|gb|EEF30645.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255539443|ref|XP_002510786.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549901|gb|EEF51388.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356561552|ref|XP_003549045.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Glycine max] Back     alignment and taxonomy information
>gi|356561665|ref|XP_003549100.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Glycine max] Back     alignment and taxonomy information
>gi|356561606|ref|XP_003549072.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Back     alignment and taxonomy information
>gi|356561667|ref|XP_003549101.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Back     alignment and taxonomy information
>gi|350284773|gb|AEQ27758.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query793
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.941 0.792 0.306 2e-72
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.906 0.821 0.304 9.9e-71
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.933 0.773 0.301 2.7e-68
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.871 0.796 0.293 2e-63
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.852 0.833 0.307 1.1e-62
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.926 0.824 0.288 1.4e-62
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.918 0.740 0.288 5e-62
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.930 0.825 0.286 1.8e-60
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.924 0.877 0.287 4e-58
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.808 0.756 0.293 1.4e-57
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 732 (262.7 bits), Expect = 2.0e-72, P = 2.0e-72
 Identities = 248/809 (30%), Positives = 373/809 (46%)

Query:     2 IPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSL 61
             IP  +GNLS+L  L LS YN  L     S +  LS L  L++SS   S    S   I +L
Sbjct:   141 IPSSIGNLSHLTSLHLS-YNQFLGLIPSS-IENLSRLTSLHLSSNQFSGQIPSS--IGNL 196

Query:    62 PSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQ 121
               L  L+LS  +     P S  N S+LT L L  N+F GQIPS +GNL  L YL LS+N 
Sbjct:   197 SHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNN 256

Query:   122 FNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFG 181
             F   +P     LN L  L + SN+L GN+  + L NLT +  LLLS N +  G IP +  
Sbjct:   257 FVGEIPSSFGNLNQLIVLQVDSNKLSGNVP-ISLLNLTRLSALLLSHN-QFTGTIPNNIS 314

Query:   182 RFCKLKSF---STGFTN------------LSQDISE-----ILGIFSACVANELESLDLG 221
                 L  F   +  FT             +  D+S+      L   +    + L+ L +G
Sbjct:   315 LLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIG 374

Query:   222 SCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLD-LSKNELNGTVSEI 280
             S    G +   L RF  L   DLS+       P+     ++L+ LD L  + L  T  ++
Sbjct:   375 SNNFIGTIPRSLSRFVNLTLFDLSHLNTQCR-PVDFSIFSHLKSLDDLRLSYLTTTTIDL 433

Query:   281 HFVNLTKLVTFRA---NGNSLIFKINPNWV---PPFQ-LTGLGVRSCRLGPRFPLWLQSQ 333
             + + L    T R+   +GN L+   N + V   PP Q +  L +  C +   FP  L++Q
Sbjct:   434 NDI-LPYFKTLRSLDISGN-LVSATNKSSVSSDPPSQSIQSLYLSGCGITD-FPEILRTQ 490

Query:   334 KKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSI- 392
              +L  L +S+ +I  ++P   W ++   ++LN+S N             +  V     I 
Sbjct:   491 HELGFLDVSNNKIKGQVPGWLW-TLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIH 549

Query:   393 FDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPXXXXXXXXXXX- 451
                SNN  +G I   IC G    +++    LS+N+++G IP C                 
Sbjct:   550 LFASNNNFTGKIPSFIC-G---LRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNN 605

Query:   452 FTGSLPMSIGTXXXXXXXXXXXXXXXGIIPTSFNNFTILEALDMGENELVGNIPTWMGER 511
              +G LP  I                 G +P S   F+ LE L++  N +    P W+   
Sbjct:   606 LSGGLPKHI--FESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSS- 662

Query:   512 FSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIP-RCINNFSAMATTDSS- 569
              S+L +L LRSN FHG  PI       L+I+D+++N+ +GT+P      +SAM++   + 
Sbjct:   663 LSKLQVLVLRSNAFHG--PIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNE 720

Query:   570 DQSNDIFYASLGDEKIVEDALLVM-KGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNL 628
             DQSN+ +   +G     +D++++M KG  +E   IL +   +D S N F GE+P  +  L
Sbjct:   721 DQSNEKY---MGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLL 777

Query:   629 QGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMXXXXXXXXXXXXXXX 688
             + L  LN S N F G IP ++G + ++ESLD S N+L+G IPQ +               
Sbjct:   778 KELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQ 837

Query:   689 XXGEIPSSTQLQSFGGSSFADN-DLCGAPLPNCTKKSVLVTDDQNRIGNEEDGDETDWTL 747
               G +P  TQ +    S+F +N  L G  L    +        QN     E+ DE + + 
Sbjct:   838 LAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEIS- 896

Query:   748 YISMALGFVVG--FWCFIGPLLI--KRRW 772
             +I+ A+GF+ G  F   IG +L+  K  W
Sbjct:   897 WIAAAIGFIPGIVFGLTIGYILVSYKPEW 925


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00031679
hypothetical protein (1024 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-48
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  218 bits (557), Expect = 9e-60
 Identities = 200/724 (27%), Positives = 306/724 (42%), Gaps = 182/724 (25%)

Query: 8   NLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLS------KASDSLLVINSL 61
           N S +  +DLSG N       IS     ++ +  YI ++NLS         D +   +S 
Sbjct: 67  NSSRVVSIDLSGKN-------ISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSS- 118

Query: 62  PSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLGNLTSLKYLDLSFNQ 121
            SL+ L LS         +   +  +L TLDLS N   G+IP+ +G+ +SLK LDL  N 
Sbjct: 119 -SLRYLNLSNNNFTG--SIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV 175

Query: 122 FNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFG 181
               +P  L+ L  LEFL+L SN+L G                          +IP   G
Sbjct: 176 LVGKIPNSLTNLTSLEFLTLASNQLVG--------------------------QIPRELG 209

Query: 182 RFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNF 241
           +   LK    G+ NLS                             G +  ++G    LN 
Sbjct: 210 QMKSLKWIYLGYNNLS-----------------------------GEIPYEIGGLTSLNH 240

Query: 242 LDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFK 301
           LDL    + G IP SLG + NL+YL L +N+L+G +    F +L KL++   + NSL  +
Sbjct: 241 LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGE 299

Query: 302 INPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQY 361
           I                     P   + LQ+   L  L++ S   + KIP     S+ + 
Sbjct: 300 I---------------------PELVIQLQN---LEILHLFSNNFTGKIPVAL-TSLPRL 334

Query: 362 WFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFF 421
             L +  N+  G +PK          NLG                          N+   
Sbjct: 335 QVLQLWSNKFSGEIPK----------NLGK-----------------------HNNLTVL 361

Query: 422 QLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIP 481
            LS N+ +GEIP+   +   L  L L +N+  G +P S+G   SL  + L++N  SG +P
Sbjct: 362 DLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELP 421

Query: 482 TSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQI 541
           + F    ++  LD+  N L G I +   +  S L +L+L  NKF G  P        L+ 
Sbjct: 422 SEFTKLPLVYFLDISNNNLQGRINSRKWDMPS-LQMLSLARNKFFGGLP-DSFGSKRLEN 479

Query: 542 LDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYK 601
           LD++ N  SG +PR + + S +                                      
Sbjct: 480 LDLSRNQFSGAVPRKLGSLSELMQ------------------------------------ 503

Query: 602 SILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFS 661
                   + +S+N  SGE+P E+++ + L SL+ S+N  +G+IP +   M  +  LD S
Sbjct: 504 --------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLS 555

Query: 662 ANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADN-DLCG----AP 716
            NQLSG IP+++ N+  L  +N+S+N+L+G +PS+    +   S+ A N DLCG    + 
Sbjct: 556 QNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSG 615

Query: 717 LPNC 720
           LP C
Sbjct: 616 LPPC 619


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 793
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.59
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
PLN03150623 hypothetical protein; Provisional 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.43
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PRK15386426 type III secretion protein GogB; Provisional 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.87
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.87
KOG4341483 consensus F-box protein containing LRR [General fu 97.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.79
PRK15386426 type III secretion protein GogB; Provisional 97.62
KOG4341483 consensus F-box protein containing LRR [General fu 97.47
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.06
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.26
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.89
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.6
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.49
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.23
KOG4308478 consensus LRR-containing protein [Function unknown 93.81
KOG4308478 consensus LRR-containing protein [Function unknown 93.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.27
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.13
smart0037026 LRR Leucine-rich repeats, outliers. 90.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.38
smart0037026 LRR Leucine-rich repeats, outliers. 90.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.7
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.01
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6e-66  Score=621.75  Aligned_cols=541  Identities=32%  Similarity=0.519  Sum_probs=392.0

Q ss_pred             CCccEEEccCCCCCCCCCccCCCCCCCCEEECcCccCCCccccccc-CCCCCCEEeCcCCcCccCCcccccCCCCCCEEE
Q 003813           62 PSLKELKLSFCKLHHFPPLSSANFSSLTTLDLSENEFQGQIPSRLG-NLTSLKYLDLSFNQFNSVVPGWLSKLNDLEFLS  140 (793)
Q Consensus        62 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~-~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~  140 (793)
                      .+++.|++++|.+++..+..|..+++|++|+|++|.+.+.+|..+. .+++|++|++++|.+++.+|.  +.+++|++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~  146 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLD  146 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEE
Confidence            3566666666666655555566666666666666666655554433 566666666666666555543  3456666666


Q ss_pred             ccCCccccccChhhhcCCCCCcEEEcCCCCCCCCCCcccccCCCCCcEEEccCCcccccchhHHhhhccccCCCccEEEc
Q 003813          141 LQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDL  220 (793)
Q Consensus       141 L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~L~~L~L  220 (793)
                      +++|.+.+.+|.. ++++++|++|++++|. +.+.+|..+.++++|++|++++|.+.+.+|..++.+     ++|++|++
T Consensus       147 Ls~n~~~~~~p~~-~~~l~~L~~L~L~~n~-l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l-----~~L~~L~L  219 (968)
T PLN00113        147 LSNNMLSGEIPND-IGSFSSLKVLDLGGNV-LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM-----KSLKWIYL  219 (968)
T ss_pred             CcCCcccccCChH-HhcCCCCCEEECccCc-ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCc-----CCccEEEC
Confidence            6666665555554 5666666666666665 555555555555555555555555555555555444     55555555


Q ss_pred             cCcccccccccccCCCCCCCEEeCcCCcCCCCcchhhcCCCCCCEEEccCCCCccccChhhhhcCCCCcEEECCCCeeee
Q 003813          221 GSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIF  300 (793)
Q Consensus       221 ~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~  300 (793)
                      ++|++.+.+|..++.+++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|. .+.++++|++|++++|.+  
T Consensus       220 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~Ls~n~l--  296 (968)
T PLN00113        220 GYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP-SIFSLQKLISLDLSDNSL--  296 (968)
T ss_pred             cCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch-hHhhccCcCEEECcCCee--
Confidence            55555555555555555555555555555555555555555555555555555544443 344455555555554444  


Q ss_pred             ecCCCCCCcccccEEEccCccCCCCCCcccccCCCCCeEEeecCccccccChhHHhccccccEEEeeCccccccCCCCCC
Q 003813          301 KINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKFDS  380 (793)
Q Consensus       301 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~  380 (793)
                                            .+.+|.++..+++|+.|++++|.+.+.+|..+. .+++|+.|++++|.+.+.+|    
T Consensus       297 ----------------------~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~-~l~~L~~L~L~~n~l~~~~p----  349 (968)
T PLN00113        297 ----------------------SGEIPELVIQLQNLEILHLFSNNFTGKIPVALT-SLPRLQVLQLWSNKFSGEIP----  349 (968)
T ss_pred             ----------------------ccCCChhHcCCCCCcEEECCCCccCCcCChhHh-cCCCCCEEECcCCCCcCcCC----
Confidence                                  444555555555666666666655555544432 34445555555444443333    


Q ss_pred             CCCCccCCCCcEEEcccCcccccccchhhcccCCCCCccEEEccCCcccccCCCCccCCCCCCEEEccCCcccccCCCCC
Q 003813          381 PSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSI  460 (793)
Q Consensus       381 ~~~~~~~~~l~~l~ls~n~l~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~  460 (793)
                                               ..    +..+++|+.|++++|++++.+|..+..+++|+.|++++|++.+.+|..+
T Consensus       350 -------------------------~~----l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~  400 (968)
T PLN00113        350 -------------------------KN----LGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSL  400 (968)
T ss_pred             -------------------------hH----HhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHH
Confidence                                     11    1225788889999999988888888888999999999999998999989


Q ss_pred             CCCCCccEEEccCCccccccCccccCCCCCCEEeCCCCcccccCchhHHhhcccCcEEEccCccccccCCccccCCCCcC
Q 003813          461 GTLSSLMSLNLRNNRLSGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQ  540 (793)
Q Consensus       461 ~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~  540 (793)
                      ..+++|+.|++++|++++..|..|..+++|+.|++++|.+++.+|..+. .+++|++|++++|++.+.+|..+ ..++|+
T Consensus       401 ~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~  478 (968)
T PLN00113        401 GACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLE  478 (968)
T ss_pred             hCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccce
Confidence            9999999999999999998999999999999999999999988888776 68999999999999998888765 458999


Q ss_pred             EEEcccCccccccCccccccccCccccCCCCCCccccccCCccchhhhhhhhhccchhhhhhhccceeEEEcccCcceee
Q 003813          541 ILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGE  620 (793)
Q Consensus       541 ~L~Ls~N~l~~~~p~~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~  620 (793)
                      .|++++|++++.+|..+.+++.|                                            +.|+|++|++++.
T Consensus       479 ~L~ls~n~l~~~~~~~~~~l~~L--------------------------------------------~~L~Ls~N~l~~~  514 (968)
T PLN00113        479 NLDLSRNQFSGAVPRKLGSLSEL--------------------------------------------MQLKLSENKLSGE  514 (968)
T ss_pred             EEECcCCccCCccChhhhhhhcc--------------------------------------------CEEECcCCcceee
Confidence            99999999999888877766554                                            7899999999999


Q ss_pred             CccccccccCCceeeccCCcccccCCccccCcCCCCEEECCCCcCCCCCcccccCCCCCCeEEcccCcccccCCCCCccC
Q 003813          621 VPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQ  700 (793)
Q Consensus       621 ~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~  700 (793)
                      +|+.++++++|++|+|++|.++|.+|..++.+++|+.|||++|+++|.+|..+.++++|+++|+++|+++|.+|..+++.
T Consensus       515 ~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~  594 (968)
T PLN00113        515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFL  594 (968)
T ss_pred             CChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcCCccccCC-CccCCC
Q 003813          701 SFGGSSFADN-DLCGAP  716 (793)
Q Consensus       701 ~~~~~~~~~n-~l~~~~  716 (793)
                      ++...++.|| .+||.+
T Consensus       595 ~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        595 AINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccChhhhcCCccccCCc
Confidence            9999999999 899865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-35
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-22
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-35
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-10
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-08
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-06
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 6e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-06
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 2e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 6e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 8e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 9e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 9e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 147 bits (372), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 182/696 (26%), Positives = 280/696 (40%), Gaps = 108/696 (15%) Query: 86 SSLTTLDLSENEFQGQIPS--RLGNLTSLKYLDLSFNQFNSVVPGWLS---KLNDLEFLS 140 +SLT+LDLS N G + + LG+ + LK+L++S N + PG +S KLN LE L Sbjct: 100 ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--FPGKVSGGLKLNSLEVLD 157 Query: 141 LQSNRLQG-NISSLGL-ENLTSIQTLLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQ 198 L +N + G N+ L + ++ L +SGN ++ G + S R L+ N S Sbjct: 158 LSANSISGANVVGWVLSDGCGELKHLAISGN-KISGDVDVS--RCVNLEFLDVSSNNFST 214 Query: 199 DISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLDLSNTTMDGSIPLSLG 258 I LG SA L+ LD+ ++ G + + L L++S+ G IP Sbjct: 215 GI-PFLGDCSA-----LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-- 266 Query: 259 QIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPNWVPPFQLTGLGVR 318 + +L+YL L++N+ G + + L +GN VPPF Sbjct: 267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFY-----GAVPPF-------- 313 Query: 319 SCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWNSIFQYWFLNISGNQMYGGVPKF 378 S L L +SS S ++P + L++S N+ G +P+ Sbjct: 314 -----------FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 362 Query: 379 DSPSMPLVTNLGS---IFDLSNNALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDC 435 +TNL + DLS+N SG I +CQ N ++ L N F+G+IP Sbjct: 363 -------LTNLSASLLTLDLSSNNFSGPILPNLCQ--NPKNTLQELYLQNNGFTGKIPPT 413 Query: 436 WMNWPXXXXXXXXXXXFTGSLPMSIGT------------------------XXXXXXXXX 471 N +G++P S+G+ Sbjct: 414 LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 473 Query: 472 XXXXXXGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPI 531 G IP+ +N T L + + N L G IP W+G R L IL L +N F G+ P Sbjct: 474 DFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPA 532 Query: 532 QLCRLASLQILDVAYNNLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDA-- 589 +L SL LD+ N +GTIP + S + ++ + G +K A Sbjct: 533 ELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN 592 Query: 590 LLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLF-------- 641 LL +G E + L+ +I+ + G N + L+ SYN+ Sbjct: 593 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 652 Query: 642 ----------------TGRIPDNIGVMRSIESLDFSANQLSGYIPQSMXXXXXXXXXXXX 685 +G IPD +G +R + LD S+N+L G IPQ+M Sbjct: 653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 712 Query: 686 XXXXXGEIPSSTQLQSFGGSSFADND-LCGAPLPNC 720 G IP Q ++F + F +N LCG PLP C Sbjct: 713 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 748
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query793
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-157
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-107
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-51
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-43
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-39
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  475 bits (1226), Expect = e-157
 Identities = 191/751 (25%), Positives = 291/751 (38%), Gaps = 103/751 (13%)

Query: 2   IPHQLGNLSNLQYLDLSGYNFKLHADTISWLSGLSLLKHLYISSVNLSKASDSLLVINSL 61
           +   L +L+ L+ L LS  +      ++S     + L  L +S  +LS    +L  + S 
Sbjct: 69  VSSSLLSLTGLESLFLSNSHI---NGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSC 125

Query: 62  PSLKELKLSFCKLHHFPPLSS-ANFSSLTTLDLSENEFQGQIPS---RLGNLTSLKYLDL 117
             LK L +S   L     +S     +SL  LDLS N   G              LK+L +
Sbjct: 126 SGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAI 185

Query: 118 SFNQFNSVVPGWLSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQTLLLSGNDELGGKIP 177
           S N+ +  V   +S+  +LEFL + SN     I  LG  + +++Q L +SGN +L G   
Sbjct: 186 SGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPFLG--DCSALQHLDISGN-KLSGDFS 240

Query: 178 TSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQL-GRF 236
            +     +LK  +              G         L+ L L   +  G + + L G  
Sbjct: 241 RAISTCTELKLLNISSNQFV-------GPIPPLPLKSLQYLSLAENKFTGEIPDFLSGAC 293

Query: 237 KGLNFLDLSNTTMDGSIPLSLGQIANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGN 296
             L  LDLS     G++P   G  + LE L LS N  +G +     + +  L        
Sbjct: 294 DTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV------ 347

Query: 297 SLIFKINPNWVPPFQLTGLGVRSCRLGPRFPLWLQSQKKLNDLYISSTRISAKIPRRFWN 356
                                                     L +S    S ++P    N
Sbjct: 348 ------------------------------------------LDLSFNEFSGELPESLTN 365

Query: 357 SIFQYWFLNISGNQMYGGVPKFDSPSMPLVTNLGSIFDLSNNALSGSIFHLICQGENFSK 416
                  L++S N   G +      +      L     L NN  +G I   +        
Sbjct: 366 LSASLLTLDLSSNNFSGPILPNLCQNPK--NTL-QELYLQNNGFTGKIPPTLSN----CS 418

Query: 417 NIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRL 476
            +    LS N+ SG IP    +  +LR L L  N   G +P  +  + +L +L L  N L
Sbjct: 419 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 478

Query: 477 SGIIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRL 536
           +G IP+  +N T L  + +  N L G IP W+G R   L IL L +N F G+ P +L   
Sbjct: 479 TGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDC 537

Query: 537 ASLQILDVAYNNLSGTIPRCINNFSAMATTD--SSDQSNDIFYASLGDEKIVEDALLVMK 594
            SL  LD+  N  +GTIP  +   S     +  +  +   I    +  E      LL  +
Sbjct: 538 RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ 597

Query: 595 GFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRS 654
           G   E  + L+     +I+   + G       N   +  L+ SYN+ +G IP  IG M  
Sbjct: 598 GIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY 657

Query: 655 IESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSS------------------ 696
           +  L+   N +SG IP  + +L  LN L+LS+N L+G IP +                  
Sbjct: 658 LFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS 717

Query: 697 ------TQLQSFGGSSFADND-LCGAPLPNC 720
                  Q ++F  + F +N  LCG PLP C
Sbjct: 718 GPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.47
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-80  Score=725.79  Aligned_cols=666  Identities=28%  Similarity=0.373  Sum_probs=430.9

Q ss_pred             CCcEEeCCCCCCCCCCC-CccccCCCCcccEEEcCCccCCCCCchhHhhCCCCCccEEEccCCCCCCCCCc--cCCCCCC
Q 003813           11 NLQYLDLSGYNFKLHAD-TISWLSGLSLLKHLYISSVNLSKASDSLLVINSLPSLKELKLSFCKLHHFPPL--SSANFSS   87 (793)
Q Consensus        11 ~L~~L~Ls~~~~~~~~~-~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~~~l~~   87 (793)
                      +++.|||+++.+..... ..+.+.++++|+.++++.+.+...++   .++.+++|++|+|++|.+++..+.  .++++++
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~---~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~  127 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS---GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSG  127 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCC---CCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTT
T ss_pred             cEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCch---hhccCCCCCEEECCCCcCCCcCCChHHHhCCCC
Confidence            45555555554421000 01124455555555555554433222   245555555555555555543333  4555555


Q ss_pred             CCEEECcCccCCCcccccc-cCCCCCCEEeCcCCcCccCCccc---ccCCCCCCEEEccCCccccccChhhhcCCCCCcE
Q 003813           88 LTTLDLSENEFQGQIPSRL-GNLTSLKYLDLSFNQFNSVVPGW---LSKLNDLEFLSLQSNRLQGNISSLGLENLTSIQT  163 (793)
Q Consensus        88 L~~L~Ls~n~i~~~~~~~~-~~l~~L~~L~Ls~n~l~~~~~~~---~~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~  163 (793)
                      |++|++++|.+.+..|..+ .++++|++|++++|.+++..|..   +.++++|++|++++|.+.+.++   +..+++|++
T Consensus       128 L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~---~~~l~~L~~  204 (768)
T 3rgz_A          128 LKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD---VSRCVNLEF  204 (768)
T ss_dssp             CCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB---CTTCTTCCE
T ss_pred             CCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC---cccCCcCCE
Confidence            5555555555554444443 55555555555555555554444   4555555555555555554333   245555555


Q ss_pred             EEcCCCCCCCCCCcccccCCCCCcEEEccCCcccccchhHHhhhccccCCCccEEEccCcccccccccccCCCCCCCEEe
Q 003813          164 LLLSGNDELGGKIPTSFGRFCKLKSFSTGFTNLSQDISEILGIFSACVANELESLDLGSCQIFGHMTNQLGRFKGLNFLD  243 (793)
Q Consensus       164 L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~  243 (793)
                      |++++|. +.+.+|. ++++++|++|++++|.+++.+|..+..+     ++|++|++++|++.+..|..  .+++|++|+
T Consensus       205 L~Ls~n~-l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l-----~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~  275 (768)
T 3rgz_A          205 LDVSSNN-FSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTC-----TELKLLNISSNQFVGPIPPL--PLKSLQYLS  275 (768)
T ss_dssp             EECCSSC-CCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTC-----SSCCEEECCSSCCEESCCCC--CCTTCCEEE
T ss_pred             EECcCCc-CCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcC-----CCCCEEECCCCcccCccCcc--ccCCCCEEE
Confidence            5555555 4444444 5555555555555555555555555554     55555555555555554443  455555555


Q ss_pred             CcCCcCCCCcchhhcCC-CCCCEEEccCCCCccccChhhhhcCCCCcEEECCCCeeeeecCCC-CCCcccccEEEccCcc
Q 003813          244 LSNTTMDGSIPLSLGQI-ANLEYLDLSKNELNGTVSEIHFVNLTKLVTFRANGNSLIFKINPN-WVPPFQLTGLGVRSCR  321 (793)
Q Consensus       244 L~~n~l~~~~~~~l~~l-~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~-~~~~~~L~~L~l~~~~  321 (793)
                      +++|.+++.+|..+... ++|++|++++|.+++.+|. .+.++++|++|++++|.+.+.++.. +..+++|++|++++|.
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~  354 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE  354 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCG-GGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSE
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccch-HHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCc
Confidence            55555555555555443 5555555555555554444 4555555555555555555544443 4555555555555555


Q ss_pred             CCCCCCcccccCC-CCCeEEeecCccccccChhHHhc-cccccEEEeeCccccccCCC-CCCCCCCccCCCCcEEEcccC
Q 003813          322 LGPRFPLWLQSQK-KLNDLYISSTRISAKIPRRFWNS-IFQYWFLNISGNQMYGGVPK-FDSPSMPLVTNLGSIFDLSNN  398 (793)
Q Consensus       322 ~~~~~~~~l~~~~-~L~~L~l~~n~i~~~~~~~~~~~-~~~L~~L~ls~n~l~~~~~~-~~~~~~~~~~~~l~~l~ls~n  398 (793)
                      +.+.+|.++..++ +|++|++++|++.+.+|..+... +++|++|++++|++++.+|. +..      ...++.+++++|
T Consensus       355 l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~------l~~L~~L~Ls~N  428 (768)
T 3rgz_A          355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN------CSELVSLHLSFN  428 (768)
T ss_dssp             EEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG------CTTCCEEECCSS
T ss_pred             cCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc------CCCCCEEECcCC
Confidence            5555565555555 66666666666665555544321 45566666666666655552 222      455666677777


Q ss_pred             cccccccchhhcccCCCCCccEEEccCCcccccCCCCccCCCCCCEEEccCCcccccCCCCCCCCCCccEEEccCCcccc
Q 003813          399 ALSGSIFHLICQGENFSKNIEFFQLSKNHFSGEIPDCWMNWPRLRMLNLRNNNFTGSLPMSIGTLSSLMSLNLRNNRLSG  478 (793)
Q Consensus       399 ~l~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~  478 (793)
                      ++++.+|..+..    +++|+.|++++|.+++.+|..+..+++|++|++++|++++.+|..+..+++|++|++++|++++
T Consensus       429 ~l~~~~p~~l~~----l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~  504 (768)
T 3rgz_A          429 YLSGTIPSSLGS----LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTG  504 (768)
T ss_dssp             EEESCCCGGGGG----CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             cccCcccHHHhc----CCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCC
Confidence            666666654433    6778888888888887788888888888888888888887778778888888888888888887


Q ss_pred             ccCccccCCCCCCEEeCCCCcccccCchhHHhhcccCcEEEccCccccccCCccccCCCCcCEEEcccC-----------
Q 003813          479 IIPTSFNNFTILEALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYN-----------  547 (793)
Q Consensus       479 ~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N-----------  547 (793)
                      .+|.++..+++|++|++++|+++|.+|..+. .+++|++|++++|+++|.+|..+.....+..+++..+           
T Consensus       505 ~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~  583 (768)
T 3rgz_A          505 EIPKWIGRLENLAILKLSNNSFSGNIPAELG-DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM  583 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEEECCGGGG-GCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSC
T ss_pred             cCChHHhcCCCCCEEECCCCcccCcCCHHHc-CCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccc
Confidence            7888888888888888888888877887776 6788888888888888888877766655554443331           


Q ss_pred             -----------ccccccCccccccccCccccCCCCCCccccccCCccchhhhhhhhhccchhhhhhhccceeEEEcccCc
Q 003813          548 -----------NLSGTIPRCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNN  616 (793)
Q Consensus       548 -----------~l~~~~p~~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~  616 (793)
                                 .+.+..+..+..++.+...+..                    .....|..+.....++.|+.|||++|+
T Consensus       584 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~--------------------~~~~~g~~~~~~~~l~~L~~LdLs~N~  643 (768)
T 3rgz_A          584 KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT--------------------SRVYGGHTSPTFDNNGSMMFLDMSYNM  643 (768)
T ss_dssp             CTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTT--------------------SCEEEEECCCSCSSSBCCCEEECCSSC
T ss_pred             cccccccccccccccccchhhhccccccccccc--------------------cceecccCchhhhccccccEEECcCCc
Confidence                       1122222222222222111110                    011223333444556778999999999


Q ss_pred             ceeeCccccccccCCceeeccCCcccccCCccccCcCCCCEEECCCCcCCCCCcccccCCCCCCeEEcccCcccccCCCC
Q 003813          617 FSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSS  696 (793)
Q Consensus       617 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~  696 (793)
                      ++|.+|.+++++++|++|+|++|+++|.+|+.|+++++|++|||++|+++|.+|..++.+++|++||+++|+++|+||.+
T Consensus       644 l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             CBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             ccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCcCCccccCC-CccCCCCCCCCCC
Q 003813          697 TQLQSFGGSSFADN-DLCGAPLPNCTKK  723 (793)
Q Consensus       697 ~~~~~~~~~~~~~n-~l~~~~~~~c~~~  723 (793)
                      +++.++...+|.|| +|||.|+..|...
T Consensus       724 ~~~~~~~~~~~~gN~~Lcg~~l~~C~~~  751 (768)
T 3rgz_A          724 GQFETFPPAKFLNNPGLCGYPLPRCDPS  751 (768)
T ss_dssp             SSGGGSCGGGGCSCTEEESTTSCCCCSC
T ss_pred             hhhccCCHHHhcCCchhcCCCCcCCCCC
Confidence            99999999999999 9999998888643



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 793
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 89.4 bits (220), Expect = 6e-20
 Identities = 69/288 (23%), Positives = 107/288 (37%), Gaps = 26/288 (9%)

Query: 438 NWPRLRMLNLRNNNFTG--SLPMSIGTLSSLMSLNLRNN-RLSGIIPTSFNNFTILEALD 494
              R+  L+L   N      +P S+  L  L  L +     L G IP +    T L  L 
Sbjct: 48  QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY 107

Query: 495 MGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASLQILDVAYNNLSGTIP 554
           +     V         +   L+ L+   N   G  P  +  L +L  +    N +SG IP
Sbjct: 108 ITHTN-VSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166

Query: 555 RCINNFSAMATTDSSDQSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISK 614
               +FS + T+ +  ++                             +  NL        
Sbjct: 167 DSYGSFSKLFTSMTISRNRLTGK---------------------IPPTFANLNLAFVDLS 205

Query: 615 NNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIGVMRSIESLDFSANQLSGYIPQSMS 674
            N        +                       +G+ +++  LD   N++ G +PQ ++
Sbjct: 206 RNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLT 265

Query: 675 NLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADND-LCGAPLPNCT 721
            L FL+ LN+S NNL GEIP    LQ F  S++A+N  LCG+PLP CT
Sbjct: 266 QLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT 313


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query793
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.67
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=8.5e-34  Score=293.57  Aligned_cols=260  Identities=30%  Similarity=0.553  Sum_probs=239.9

Q ss_pred             CCCccEEEccCCcccc--cCCCCccCCCCCCEEEccC-CcccccCCCCCCCCCCccEEEccCCccccccCccccCCCCCC
Q 003813          415 SKNIEFFQLSKNHFSG--EIPDCWMNWPRLRMLNLRN-NNFTGSLPMSIGTLSSLMSLNLRNNRLSGIIPTSFNNFTILE  491 (793)
Q Consensus       415 ~~~L~~L~L~~n~l~~--~~~~~~~~l~~L~~L~Ls~-n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~  491 (793)
                      ..+++.|+|++|.+++  .+|..++++++|++|+|++ |+++|.+|..|+++++|++|+|++|++.+..+..+..+.+|+
T Consensus        49 ~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~  128 (313)
T d1ogqa_          49 TYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLV  128 (313)
T ss_dssp             CCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCC
T ss_pred             cEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhc
Confidence            3478999999999987  5789999999999999997 899999999999999999999999999999999999999999


Q ss_pred             EEeCCCCcccccCchhHHhhcccCcEEEccCccccccCCccccCCCCc-CEEEcccCccccccCccccccccCccccCCC
Q 003813          492 ALDMGENELVGNIPTWMGERFSRLIILNLRSNKFHGDFPIQLCRLASL-QILDVAYNNLSGTIPRCINNFSAMATTDSSD  570 (793)
Q Consensus       492 ~L~L~~N~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L-~~L~Ls~N~l~~~~p~~~~~l~~L~~~~~~~  570 (793)
                      .+++++|.+.+.+|..+. .++.++++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+.++..        
T Consensus       129 ~l~l~~N~~~~~~p~~l~-~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~--------  199 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSIS-SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL--------  199 (313)
T ss_dssp             EEECCSSEEESCCCGGGG-GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC--------
T ss_pred             ccccccccccccCchhhc-cCcccceeecccccccccccccccccccccccccccccccccccccccccccc--------
Confidence            999999999999999887 79999999999999999999999888886 89999999999988877665432        


Q ss_pred             CCCccccccCCccchhhhhhhhhccchhhhhhhccceeEEEcccCcceeeCccccccccCCceeeccCCcccccCCcccc
Q 003813          571 QSNDIFYASLGDEKIVEDALLVMKGFLVEYKSILNLVRGIDISKNNFSGEVPVEVTNLQGLQSLNFSYNLFTGRIPDNIG  650 (793)
Q Consensus       571 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~  650 (793)
                                                           ..++++++.+.+.+|..+..+++|+.+++++|.+++.+| .++
T Consensus       200 -------------------------------------~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~  241 (313)
T d1ogqa_         200 -------------------------------------AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVG  241 (313)
T ss_dssp             -------------------------------------SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCC
T ss_pred             -------------------------------------ccccccccccccccccccccccccccccccccccccccc-ccc
Confidence                                                 468999999999999999999999999999999997766 589


Q ss_pred             CcCCCCEEECCCCcCCCCCcccccCCCCCCeEEcccCcccccCCCCCccCCcCCccccCC-CccCCCCCCCC
Q 003813          651 VMRSIESLDFSANQLSGYIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGGSSFADN-DLCGAPLPNCT  721 (793)
Q Consensus       651 ~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~~n-~l~~~~~~~c~  721 (793)
                      .+++|+.|+|++|+++|.+|..|+++++|++|||++|+|+|.+|....+..+....+.|| .+||.|++.|+
T Consensus       242 ~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         242 LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             CCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             cccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCCCCC
Confidence            999999999999999999999999999999999999999999999888888999999999 79999988774



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure