Citrus Sinensis ID: 003891


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
cHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHcccccEEEcccccccccccccccccccHHHcccccccccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHcccccEEcccccccccHHHHHHHHccccEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHccccEEEEcccccccccccEEEEccccEEEEEEccccccccccEEEEEEccccccccHHccHHHHHHcccccEEcccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHccEEcccccccccccHHHHHHccccEEEcccccHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccEcccccccccccccccccccccccccccccccccccccccc
MLVASYHkalsadpsykpAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALkidphyapayynLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERClavspnfeiaKNNMAIALTDlgtkvklegdinQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLgviykdrdnLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQClkidpdsrnagqNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYtswdntkdperplvigyvspdyfthSVSYFIeaplvyhdyqnYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTghtannklgmmacqpapvqvtwigypnttglptidyritdsladppetkQKHVEELIrlpecflcytpspeagpvcptpaltngfitfgsfnnlakitPKVLQVWARILCavpnsrlvvkckpfccdsvrhRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDisldtfpyagttttceslymgvpcvtmagsvhahnVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDlmskspvcdgqnfalglESTYRNMWHryckgdvpslKRMEMLQQQVvseepskfseptkiifakegspgsvmpngfnqaspsmlnlsnieeNGVQLNQHY
MLVASYHkalsadpsykPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTswdntkdperPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKadaktirfrekvmkkggiwrdiygiDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCavpnsrlvvKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVvseepskfsepTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGkmdaaaemiekaiaaNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYkvvvysavvkadakTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
****************KPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSL*********HVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVP******************************************************************
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPS*****************************************************************
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQ************EPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQV******************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query788 2.2.26 [Sep-21-2011]
O82039932 Probable UDP-N-acetylgluc N/A no 0.988 0.835 0.853 0.0
Q96301914 Probable UDP-N-acetylgluc yes no 0.960 0.828 0.872 0.0
Q8RVB2931 Probable UDP-N-acetylgluc N/A no 0.991 0.838 0.839 0.0
Q6YZI0927 Probable UDP-N-acetylgluc yes no 0.917 0.779 0.852 0.0
O82422944 Probable UDP-N-acetylgluc N/A no 0.914 0.763 0.853 0.0
Q8LP10918 Probable UDP-N-acetylgluc N/A no 0.969 0.832 0.807 0.0
Q9M8Y0977 Probable UDP-N-acetylgluc no no 0.883 0.712 0.281 8e-74
P565581036 UDP-N-acetylglucosamine-- yes no 0.616 0.469 0.271 7e-50
Q8CGY81046 UDP-N-acetylglucosamine-- yes no 0.616 0.464 0.271 7e-50
O152941046 UDP-N-acetylglucosamine-- yes no 0.616 0.464 0.271 8e-50
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function desciption
 Score = 1418 bits (3670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/790 (85%), Positives = 722/790 (91%), Gaps = 11/790 (1%)

Query: 5   SYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNL 64
           SY KAL ADPSYKPAAECLAIVLTD+GTSLKLAGN+Q+GIQKYYEA+KID HYAPAYYNL
Sbjct: 138 SYQKALKADPSYKPAAECLAIVLTDIGTSLKLAGNSQEGIQKYYEAIKIDSHYAPAYYNL 197

Query: 65  GVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPN 124
           GVVYSE+MQYD AL CYEKAA+ERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPN
Sbjct: 198 GVVYSEMMQYDMALNCYEKAAIERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPN 257

Query: 125 FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 184
           FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD
Sbjct: 258 FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 317

Query: 185 MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVV 244
           MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMAL+IKPNFSQSLNNLGVV
Sbjct: 318 MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALTIKPNFSQSLNNLGVV 377

Query: 245 YTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRN 304
           YTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+ISLAI+AYEQCLKIDPDSRN
Sbjct: 378 YTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPDSRN 437

Query: 305 AGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDY 364
           AGQNRLLAMNYINEG DDKL+EAHRDWG RFMRLY QY SWDN+KDPER LVIGYVSPDY
Sbjct: 438 AGQNRLLAMNYINEGSDDKLYEAHRDWGWRFMRLYQQYNSWDNSKDPERQLVIGYVSPDY 497

Query: 365 FTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKK 424
           FTHSVSYFIEAPL YHDY NYKVV+YSAVVKADAKT RFR+KV+KKGG+WRDIYGIDEKK
Sbjct: 498 FTHSVSYFIEAPLAYHDYANYKVVIYSAVVKADAKTNRFRDKVLKKGGVWRDIYGIDEKK 557

Query: 425 VAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLA 484
           V++M+REDK+DI++ELTGHTANNKLGMMAC+PAPVQVTWIGYPNTTGLPTIDYRITDS+A
Sbjct: 558 VSSMIREDKVDIMIELTGHTANNKLGMMACRPAPVQVTWIGYPNTTGLPTIDYRITDSMA 617

Query: 485 DPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQ 544
           DPP TKQKHVEEL+RLP+ FLCYTPSPEAGPV P PALTNGF+TFGSFNNLAKITPKVLQ
Sbjct: 618 DPPSTKQKHVEELVRLPDSFLCYTPSPEAGPVSPAPALTNGFVTFGSFNNLAKITPKVLQ 677

Query: 545 VWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAY 604
           VWARILCAVP+SRL+VKCKPF CDSVR RFLS LEQLGLE  RVDL+PLILLNHDHMQAY
Sbjct: 678 VWARILCAVPHSRLIVKCKPFGCDSVRQRFLSILEQLGLEPQRVDLVPLILLNHDHMQAY 737

Query: 605 SLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDE 664
           SLMDISLDTFPYAGTTTTCESLYMGVPCVTM GSVHAHNVGVSLL  VGL+ L+A+NEDE
Sbjct: 738 SLMDISLDTFPYAGTTTTCESLYMGVPCVTMGGSVHAHNVGVSLLKTVGLRKLVARNEDE 797

Query: 665 YVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSL 724
           YV+LA+QLASDVT+L+NLRMSLR+LM+KSP+CDG  F   LESTYR+MW RYC GDVPSL
Sbjct: 798 YVELAIQLASDVTSLSNLRMSLRELMAKSPLCDGAQFTQNLESTYRSMWRRYCDGDVPSL 857

Query: 725 KRME-------MLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSN 776
           +RME        L + VV EE P    E T+I  +K+   G +  NGF  +   + N S 
Sbjct: 858 RRMELLQQQQQTLAELVVPEESPVSPIEKTRISASKD---GPIKENGFTVSPALVYNSST 914

Query: 777 IEENGVQLNQ 786
           IEENGVQLNQ
Sbjct: 915 IEENGVQLNQ 924




Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway. OGTs catalyze the addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Probably acts by adding O-linked sugars to yet unknown proteins.
Petunia hybrida (taxid: 4102)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query788
225440809 914 PREDICTED: probable UDP-N-acetylglucosam 0.975 0.841 0.897 0.0
255579381 930 o-linked n-acetylglucosamine transferase 0.991 0.839 0.887 0.0
356500631 928 PREDICTED: probable UDP-N-acetylglucosam 0.992 0.842 0.877 0.0
256772634 916 putative SPINDLY protein [Rosa lucieae] 0.984 0.847 0.883 0.0
356505394 919 PREDICTED: probable UDP-N-acetylglucosam 0.973 0.834 0.868 0.0
224088480 934 predicted protein [Populus trichocarpa] 0.989 0.835 0.866 0.0
356570865 917 PREDICTED: probable UDP-N-acetylglucosam 0.983 0.845 0.872 0.0
356534448 929 PREDICTED: probable UDP-N-acetylglucosam 0.992 0.841 0.871 0.0
224140075 917 predicted protein [Populus trichocarpa] 0.969 0.833 0.882 0.0
449526080 925 PREDICTED: probable UDP-N-acetylglucosam 0.983 0.837 0.872 0.0
>gi|225440809|ref|XP_002281883.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Vitis vinifera] gi|297740152|emb|CBI30334.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1471 bits (3808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/778 (89%), Positives = 732/778 (94%)

Query: 5   SYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNL 64
           SY KAL  D SYKPAAECLAIVLTDLGTSLKLAGNTQ+GIQKYYEALKIDPHYAPAYYNL
Sbjct: 136 SYDKALRIDSSYKPAAECLAIVLTDLGTSLKLAGNTQEGIQKYYEALKIDPHYAPAYYNL 195

Query: 65  GVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPN 124
           GVVYSE+MQYDTAL CYEKAALERPMYAEAYCNMGVI+KNRGDLESAI CYERCLAVSPN
Sbjct: 196 GVVYSEMMQYDTALSCYEKAALERPMYAEAYCNMGVIFKNRGDLESAITCYERCLAVSPN 255

Query: 125 FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 184
           FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD
Sbjct: 256 FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 315

Query: 185 MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVV 244
           MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQ+ALSIKPNFSQSLNNLGVV
Sbjct: 316 MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQLALSIKPNFSQSLNNLGVV 375

Query: 245 YTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRN 304
           YTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+IS+AI+AYEQCLKIDPDSRN
Sbjct: 376 YTVQGKMDAAASMIEKAIVANPTYAEAYNNLGVLYRDAGNISMAIEAYEQCLKIDPDSRN 435

Query: 305 AGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDY 364
           AGQNRLLAMNYINEG+DDKLFEAHRDWG+RFMRLY QYTSWDN KDPERPLV+GYVSPDY
Sbjct: 436 AGQNRLLAMNYINEGNDDKLFEAHRDWGRRFMRLYPQYTSWDNPKDPERPLVVGYVSPDY 495

Query: 365 FTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKK 424
           FTHSVSYFIEAPLV HDY NYKVVVYSAVVKADAKTIRFR+KV+K+GG+WRDIYGIDEKK
Sbjct: 496 FTHSVSYFIEAPLVNHDYANYKVVVYSAVVKADAKTIRFRDKVLKRGGVWRDIYGIDEKK 555

Query: 425 VAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLA 484
           VA+MVREDK+DILVELTGHTANNKLGMMAC+PAPVQVTWIGYPNTTGLPTIDYRITDSLA
Sbjct: 556 VASMVREDKVDILVELTGHTANNKLGMMACRPAPVQVTWIGYPNTTGLPTIDYRITDSLA 615

Query: 485 DPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQ 544
           D P+T QKHVEEL+RLPECFLCY PSPEAGPV PTPAL+NGFITFGSFNNLAKITPKVLQ
Sbjct: 616 DLPDTSQKHVEELVRLPECFLCYMPSPEAGPVSPTPALSNGFITFGSFNNLAKITPKVLQ 675

Query: 545 VWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAY 604
           VWARILCAVPNSRLVVKCKPFCCDSVR RFLSTLEQLGLESLRVDLLPLILLNHDHMQAY
Sbjct: 676 VWARILCAVPNSRLVVKCKPFCCDSVRQRFLSTLEQLGLESLRVDLLPLILLNHDHMQAY 735

Query: 605 SLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDE 664
           +LMDISLDTFPYAGTTTTCESL+MGVPCVTMAGSVHAHNVGVSLL KVGL  L+AK EDE
Sbjct: 736 ALMDISLDTFPYAGTTTTCESLFMGVPCVTMAGSVHAHNVGVSLLNKVGLGRLVAKTEDE 795

Query: 665 YVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSL 724
           YVQLALQLASD+TAL+NLRMSLRDLMSKSPVC+G NFAL LESTYR+MW RYCKGDVPSL
Sbjct: 796 YVQLALQLASDITALSNLRMSLRDLMSKSPVCNGPNFALALESTYRSMWRRYCKGDVPSL 855

Query: 725 KRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGV 782
           +RME+LQQ+   E   K  EPTKI  +++ S GS+  NG NQ   SML  S  EENGV
Sbjct: 856 RRMEILQQENSEEPVVKLPEPTKITNSRDDSSGSIKTNGLNQVPSSMLKHSTSEENGV 913




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255579381|ref|XP_002530535.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223529939|gb|EEF31867.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356500631|ref|XP_003519135.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] gi|401721241|gb|AFP99901.1| putative UDP-N-acetylglucosamin [Glycine max] Back     alignment and taxonomy information
>gi|256772634|emb|CAX46402.1| putative SPINDLY protein [Rosa lucieae] Back     alignment and taxonomy information
>gi|356505394|ref|XP_003521476.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|224088480|ref|XP_002308458.1| predicted protein [Populus trichocarpa] gi|222854434|gb|EEE91981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356570865|ref|XP_003553604.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|356534448|ref|XP_003535766.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|224140075|ref|XP_002323412.1| predicted protein [Populus trichocarpa] gi|222868042|gb|EEF05173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449526080|ref|XP_004170042.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query788
TAIR|locus:2080722914 SPY "SPINDLY" [Arabidopsis tha 0.970 0.836 0.831 0.0
UNIPROTKB|Q749Z1585 GSU2601 "TPR domain/SEC-C moti 0.695 0.936 0.382 4.2e-102
TIGR_CMR|GSU_2601585 GSU_2601 "TPR domain/SEC-C mot 0.695 0.936 0.382 4.2e-102
UNIPROTKB|Q608I2699 MCA1509 "TPR domain protein" [ 0.781 0.881 0.319 3e-78
TAIR|locus:2103025977 SEC "secret agent" [Arabidopsi 0.458 0.369 0.286 2.7e-68
UNIPROTKB|A5D7G11036 OGT "OGT protein" [Bos taurus 0.607 0.462 0.263 4.5e-63
UNIPROTKB|F1RSV21046 OGT "UDP-N-acetylglucosamine-- 0.607 0.457 0.263 4.7e-63
UNIPROTKB|P814361046 OGT "UDP-N-acetylglucosamine-- 0.607 0.457 0.263 4.7e-63
UNIPROTKB|O152941046 OGT "UDP-N-acetylglucosamine-- 0.607 0.457 0.263 5.9e-63
MGI|MGI:13396391046 Ogt "O-linked N-acetylglucosam 0.607 0.457 0.263 9.3e-63
TAIR|locus:2080722 SPY "SPINDLY" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3432 (1213.2 bits), Expect = 0., P = 0.
 Identities = 640/770 (83%), Positives = 691/770 (89%)

Query:     5 SYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNL 64
             SY KAL AD SYKPAAECLAIVLTDLGTSLKLAGNTQ+GIQKYYEALKIDPHYAPAYYNL
Sbjct:   133 SYQKALMADASYKPAAECLAIVLTDLGTSLKLAGNTQEGIQKYYEALKIDPHYAPAYYNL 192

Query:    65 GVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPN 124
             GVVYSE+MQYD AL CYEKAALERPMYAEAYCNMGVIYKNRGDLE AI CYERCLAVSPN
Sbjct:   193 GVVYSEMMQYDNALSCYEKAALERPMYAEAYCNMGVIYKNRGDLEMAITCYERCLAVSPN 252

Query:   125 FEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 184
             FEIAKNNMAIALTDLGTKVKLEGD+ QGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD
Sbjct:   253 FEIAKNNMAIALTDLGTKVKLEGDVTQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFD 312

Query:   185 MAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVV 244
             MAIVFYELAFHFNPHCAEACNNLGV+YKDRDNLDKAVECYQMALSIKPNF+QSLNNLGVV
Sbjct:   313 MAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMALSIKPNFAQSLNNLGVV 372

Query:   245 YTVQGXXXXXXXXXXXXXXXNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRN 304
             YTVQG               NPTYAEA+NNLGVLYRDAG+I++AIDAYE+CLKIDPDSRN
Sbjct:   373 YTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITMAIDAYEECLKIDPDSRN 432

Query:   305 AGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDY 364
             AGQNRLLAMNYINEG DDKLFEAHRDWG RF RL+ QYTSWDN KDPERP+ IGY+SPD+
Sbjct:   433 AGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDNLKDPERPITIGYISPDF 492

Query:   365 FTHSVSYFIEAPLVYHDYQNYXXXXXXXXXXXXXXTIRFREKVMKKGGIWRDIYGIDEKK 424
             FTHSVSYFIEAPL +HDY  Y              T RFR+KV+KKGG+W+DIYGIDEKK
Sbjct:   493 FTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKVLKKGGVWKDIYGIDEKK 552

Query:   425 VAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLA 484
             +A+MVREDKIDILVELTGHTANNKLG MAC+PAPVQVTWIGYPNTTGLPT+DYRITDSLA
Sbjct:   553 IASMVREDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNTTGLPTVDYRITDSLA 612

Query:   485 DPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQ 544
             DPP+TKQK VEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+TFGSFNNLAKITPKVLQ
Sbjct:   613 DPPDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFVTFGSFNNLAKITPKVLQ 672

Query:   545 VWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAY 604
             VWARILCAVPNSRLVVKCKPFCCDS+R RFL+TLEQLGLES RVDLLPLIL NHDHMQAY
Sbjct:   673 VWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKRVDLLPLILFNHDHMQAY 732

Query:   605 SLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDE 664
             SLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGL HL+AKNEDE
Sbjct:   733 SLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLGHLVAKNEDE 792

Query:   665 YVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSL 724
             YVQL++ LASDVTAL+ LRMSLRDLM+ SPVC+G +FA+GLES YRNMW +YCKG+VPSL
Sbjct:   793 YVQLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVGLESAYRNMWKKYCKGEVPSL 852

Query:   725 KRMEMLQQQVVSEEP--SKFSEPTKIIFAKEGSPGSVMPNGFNQASPSML 772
             +RMEMLQ++V  ++P  SK   P+++    E +P S+  NG +   PS L
Sbjct:   853 RRMEMLQKEV-HDDPLISKDLGPSRVSVTGEATP-SLKANG-SAPVPSSL 899


GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=TAS
GO:0009938 "negative regulation of gibberellic acid mediated signaling pathway" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q749Z1 GSU2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2601 GSU_2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q608I2 MCA1509 "TPR domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2103025 SEC "secret agent" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G1 OGT "OGT protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSV2 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81436 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|O15294 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1339639 Ogt "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82422SPY_HORVU2, ., 4, ., 1, ., -0.85340.91490.7637N/Ano
O82039SPY_PETHY2, ., 4, ., 1, ., -0.85310.98850.8358N/Ano
Q8LP10SPY_EUSER2, ., 4, ., 1, ., -0.80720.96950.8322N/Ano
Q96301SPY_ARATH2, ., 4, ., 1, ., -0.87250.96060.8282yesno
Q6YZI0SPY_ORYSJ2, ., 4, ., 1, ., -0.85240.91750.7799yesno
Q8RVB2SPY_SOLLC2, ., 4, ., 1, ., -0.83900.99110.8388N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query788
COG3914620 COG3914, Spy, Predicted O-linked N-acetylglucosami 7e-95
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 1e-23
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-22
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-21
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-21
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 2e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-16
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-15
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-15
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-14
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-13
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-12
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-12
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-11
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-10
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-09
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 7e-09
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 5e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-08
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-07
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 8e-07
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-06
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-06
PRK12370553 PRK12370, PRK12370, invasion protein regulator; Pr 4e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 7e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 9e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-05
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 1e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 1e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-05
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 3e-05
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-05
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 6e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 8e-05
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 8e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 9e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 1e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 1e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 1e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 1e-04
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 2e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 3e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 3e-04
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 3e-04
pfam10373276 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding dom 4e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 5e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 6e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-04
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit Bcs 7e-04
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.003
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.003
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.003
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.004
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 0.004
>gnl|CDD|226428 COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  308 bits (791), Expect = 7e-95
 Identities = 166/562 (29%), Positives = 248/562 (44%), Gaps = 56/562 (9%)

Query: 184 DMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECY-QMALSIKPNFSQSLNNLG 242
            +A +   +    NP    A  NL    +       A+    ++A  + P+ ++ L +L 
Sbjct: 84  TLAFLAKRIPLSVNPENCPAVQNLAAALELDGLQFLALADISEIAEWLSPDNAEFLGHLI 143

Query: 243 VVYTVQ------GKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL--------- 287
             Y +       G+   A   +E+A+   P Y      L    ++  S            
Sbjct: 144 RFYQLGRYLKLLGRTAEAELALERAVDLLPKYPRVLGALMTARQEQCSWPEEAPTNLLSQ 203

Query: 288 ------AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQ 341
                         L  DP    A  N+LL +   N     +                  
Sbjct: 204 LALFLGIYGFSLAYLADDPLKNLAIANQLLKILSQNAPELVR------------------ 245

Query: 342 YTSWDNTKDPE-RPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS-AVVKADAK 399
           +   D       + L +GY+S D  +H+V + +     YHD   ++V  YS      DA 
Sbjct: 246 FPIRDENIKRNGKRLRVGYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDAL 305

Query: 400 TIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPV 459
             R    V K    W  I  +D+ ++A  +R D IDILV+L GHT + +  + A +PAP+
Sbjct: 306 QERISAAVEK----WYPIGRMDDAEIANAIRTDGIDILVDLDGHTVDTRCQVFAHRPAPI 361

Query: 460 QVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPT 519
           QV+W+GYP TTG P +DY I+D    PP  ++ + E+L RLP    CY P     PV P 
Sbjct: 362 QVSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP---QCYQPVDGFEPVTPP 418

Query: 520 PA-----LTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRF 574
           P+     L    + F  FNN  KITP+V  +W +IL AVPNS L++K        +  R 
Sbjct: 419 PSRAQLGLPEDAVVFCCFNNYFKITPEVFALWMQILSAVPNSVLLLKAGG-DDAEINARL 477

Query: 575 LSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVT 634
               E+ G++S R+  LP    N DH   Y + D+ LDT+PY G TT  ++L+MGVP +T
Sbjct: 478 RDLAEREGVDSERLRFLP-PAPNEDHRARYGIADLVLDTYPYGGHTTASDALWMGVPVLT 536

Query: 635 MAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSP 694
             G   A   G S+ T  G+  L+A +  +YV+ A+   SD      +R  L+     SP
Sbjct: 537 RVGEQFASRNGASIATNAGIPELVADSRADYVEKAVAFGSDRALRQQVRAELKRSRQTSP 596

Query: 695 VCDGQNFALGLESTYRNMWHRY 716
           + D + FA  LE+ Y  MW  Y
Sbjct: 597 LFDPKAFARKLETLYWGMWSEY 618


Length = 620

>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237080 PRK12370, PRK12370, invasion protein regulator; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|220721 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding domain Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 788
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 100.0
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.96
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG0547606 consensus Translocase of outer mitochondrial membr 99.92
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.86
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.86
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.86
PRK12370553 invasion protein regulator; Provisional 99.85
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
KOG1125579 consensus TPR repeat-containing protein [General f 99.84
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.83
KOG1129478 consensus TPR repeat-containing protein [General f 99.83
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.83
KOG2076895 consensus RNA polymerase III transcription factor 99.83
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.83
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.82
PRK14574822 hmsH outer membrane protein; Provisional 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
PRK11189296 lipoprotein NlpI; Provisional 99.81
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.8
KOG2003840 consensus TPR repeat-containing protein [General f 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.8
KOG1129478 consensus TPR repeat-containing protein [General f 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.79
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.77
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.77
PRK14574822 hmsH outer membrane protein; Provisional 99.76
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.76
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.76
KOG2003840 consensus TPR repeat-containing protein [General f 99.76
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
PLN02789320 farnesyltranstransferase 99.74
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.74
PLN02789320 farnesyltranstransferase 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.7
KOG2076895 consensus RNA polymerase III transcription factor 99.69
PLN032181060 maturation of RBCL 1; Provisional 99.69
PLN02949463 transferase, transferring glycosyl groups 99.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.66
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.65
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.65
PLN032181060 maturation of RBCL 1; Provisional 99.65
cd03796398 GT1_PIG-A_like This family is most closely related 99.63
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.63
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.63
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.62
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.61
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.6
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.6
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.6
cd03801374 GT1_YqgM_like This family is most closely related 99.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.58
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.56
cd03820348 GT1_amsD_like This family is most closely related 99.56
PLN03077857 Protein ECB2; Provisional 99.56
cd03822366 GT1_ecORF704_like This family is most closely rela 99.56
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.55
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.55
PRK15359144 type III secretion system chaperone protein SscB; 99.52
cd03807365 GT1_WbnK_like This family is most closely related 99.52
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.52
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.51
PRK15359144 type III secretion system chaperone protein SscB; 99.51
cd03813475 GT1_like_3 This family is most closely related to 99.5
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.5
cd04962371 GT1_like_5 This family is most closely related to 99.5
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.49
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.49
PLN03077857 Protein ECB2; Provisional 99.49
cd03812358 GT1_CapH_like This family is most closely related 99.48
cd03806419 GT1_ALG11_like This family is most closely related 99.48
cd03811353 GT1_WabH_like This family is most closely related 99.48
cd03818396 GT1_ExpC_like This family is most closely related 99.47
cd04951360 GT1_WbdM_like This family is most closely related 99.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.47
cd03821375 GT1_Bme6_like This family is most closely related 99.47
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.46
PRK10370198 formate-dependent nitrite reductase complex subuni 99.46
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.46
cd03817374 GT1_UGDG_like This family is most closely related 99.46
PRK10307412 putative glycosyl transferase; Provisional 99.43
KOG2376652 consensus Signal recognition particle, subunit Srp 99.43
cd03798377 GT1_wlbH_like This family is most closely related 99.43
PRK10370198 formate-dependent nitrite reductase complex subuni 99.42
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.42
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.41
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.41
KOG1915677 consensus Cell cycle control protein (crooked neck 99.4
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.39
cd03805392 GT1_ALG2_like This family is most closely related 99.39
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.39
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.39
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.38
cd03795357 GT1_like_4 This family is most closely related to 99.38
cd04949372 GT1_gtfA_like This family is most closely related 99.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.37
PLN02846462 digalactosyldiacylglycerol synthase 99.37
PLN02939977 transferase, transferring glycosyl groups 99.36
cd03808359 GT1_cap1E_like This family is most closely related 99.36
cd04946407 GT1_AmsK_like This family is most closely related 99.36
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.36
KOG1128777 consensus Uncharacterized conserved protein, conta 99.35
cd03823359 GT1_ExpE7_like This family is most closely related 99.35
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.35
cd03809365 GT1_mtfB_like This family is most closely related 99.34
cd03825365 GT1_wcfI_like This family is most closely related 99.34
KOG1128777 consensus Uncharacterized conserved protein, conta 99.34
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.34
cd03814364 GT1_like_2 This family is most closely related to 99.33
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.33
PLN00142815 sucrose synthase 99.33
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.32
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 99.32
KOG0553304 consensus TPR repeat-containing protein [General f 99.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.32
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.31
PLN02501794 digalactosyldiacylglycerol synthase 99.31
PRK04841903 transcriptional regulator MalT; Provisional 99.31
cd03802335 GT1_AviGT4_like This family is most closely relate 99.3
cd03819355 GT1_WavL_like This family is most closely related 99.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.3
PLN023161036 synthase/transferase 99.3
cd04955363 GT1_like_6 This family is most closely related to 99.3
KOG0553304 consensus TPR repeat-containing protein [General f 99.3
PRK04841903 transcriptional regulator MalT; Provisional 99.27
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.27
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.27
KOG1915677 consensus Cell cycle control protein (crooked neck 99.27
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.26
PRK00654466 glgA glycogen synthase; Provisional 99.25
KOG2376652 consensus Signal recognition particle, subunit Srp 99.25
cd03816415 GT1_ALG1_like This family is most closely related 99.24
PRK14098489 glycogen synthase; Provisional 99.22
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.21
PRK14099485 glycogen synthase; Provisional 99.2
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 99.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.19
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 99.17
PHA01633335 putative glycosyl transferase group 1 99.15
PHA01630331 putative group 1 glycosyl transferase 99.15
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.14
cd03794394 GT1_wbuB_like This family is most closely related 99.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.12
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.11
cd03804351 GT1_wbaZ_like This family is most closely related 99.11
PLN02605382 monogalactosyldiacylglycerol synthase 99.1
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.08
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.06
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.05
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.05
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.05
PRK10125405 putative glycosyl transferase; Provisional 99.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.05
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.02
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.01
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.01
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.0
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.99
KOG1941518 consensus Acetylcholine receptor-associated protei 98.97
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 98.97
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.97
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.96
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.96
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.96
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 98.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.92
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.91
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.9
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.9
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 98.89
KOG1941518 consensus Acetylcholine receptor-associated protei 98.89
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.89
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.87
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.87
COG3898531 Uncharacterized membrane-bound protein [Function u 98.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.85
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.83
PLN02275371 transferase, transferring glycosyl groups 98.82
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.82
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.8
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.79
KOG4648536 consensus Uncharacterized conserved protein, conta 98.79
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.78
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.78
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.77
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 98.77
PRK11906458 transcriptional regulator; Provisional 98.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.75
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.75
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.75
KOG4648536 consensus Uncharacterized conserved protein, conta 98.74
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.74
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.73
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.73
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.73
PRK11906458 transcriptional regulator; Provisional 98.73
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.72
PRK15331165 chaperone protein SicA; Provisional 98.69
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.69
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 98.68
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.67
PRK10803263 tol-pal system protein YbgF; Provisional 98.67
PRK15331165 chaperone protein SicA; Provisional 98.66
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.65
PRK10803263 tol-pal system protein YbgF; Provisional 98.63
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.63
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.62
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 98.6
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 98.6
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.55
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.53
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.52
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.47
PF12688120 TPR_5: Tetratrico peptide repeat 98.47
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.46
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 98.45
KOG4234271 consensus TPR repeat-containing protein [General f 98.45
COG3898531 Uncharacterized membrane-bound protein [Function u 98.45
KOG4234271 consensus TPR repeat-containing protein [General f 98.44
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.42
PF12688120 TPR_5: Tetratrico peptide repeat 98.41
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.41
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.4
KOG1586288 consensus Protein required for fusion of vesicles 98.4
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.39
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.39
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.36
COG4700251 Uncharacterized protein conserved in bacteria cont 98.35
PF1337173 TPR_9: Tetratricopeptide repeat 98.29
KOG1586288 consensus Protein required for fusion of vesicles 98.29
PF1337173 TPR_9: Tetratricopeptide repeat 98.27
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.27
KOG1585308 consensus Protein required for fusion of vesicles 98.26
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.25
PF13512142 TPR_18: Tetratricopeptide repeat 98.24
COG4700251 Uncharacterized protein conserved in bacteria cont 98.23
PF13512142 TPR_18: Tetratricopeptide repeat 98.23
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 98.17
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.16
KOG1585308 consensus Protein required for fusion of vesicles 98.15
KOG4507886 consensus Uncharacterized conserved protein, conta 98.14
KOG4555175 consensus TPR repeat-containing protein [Function 98.11
KOG4555175 consensus TPR repeat-containing protein [Function 98.11
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 98.08
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.05
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.05
KOG2471696 consensus TPR repeat-containing protein [General f 98.05
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 98.04
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.03
KOG2471696 consensus TPR repeat-containing protein [General f 98.03
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 98.02
TIGR03492396 conserved hypothetical protein. This protein famil 98.02
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.96
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.95
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 97.93
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.9
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 97.88
PLN02670472 transferase, transferring glycosyl groups 97.88
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 97.88
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.84
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.84
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.83
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.83
KOG1550552 consensus Extracellular protein SEL-1 and related 97.82
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.81
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.8
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.75
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.74
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.72
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 97.71
PLN03004451 UDP-glycosyltransferase 97.71
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.69
PLN02992481 coniferyl-alcohol glucosyltransferase 97.69
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.68
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.67
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.66
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.65
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.62
PLN02764453 glycosyltransferase family protein 97.61
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.61
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.6
PLN03007482 UDP-glucosyltransferase family protein 97.6
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.6
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.6
KOG1258577 consensus mRNA processing protein [RNA processing 97.57
PLN02210456 UDP-glucosyl transferase 97.57
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 97.56
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.54
PF1342844 TPR_14: Tetratricopeptide repeat 97.54
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.53
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 97.53
PLN02167475 UDP-glycosyltransferase family protein 97.52
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.51
PLN02554481 UDP-glycosyltransferase family protein 97.49
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 97.49
PF1342844 TPR_14: Tetratricopeptide repeat 97.48
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.47
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.46
PLN02208442 glycosyltransferase family protein 97.44
PLN02207468 UDP-glycosyltransferase 97.44
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.42
PLN02448459 UDP-glycosyltransferase family protein 97.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.42
PF1343134 TPR_17: Tetratricopeptide repeat 97.39
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 97.39
PF1343134 TPR_17: Tetratricopeptide repeat 97.38
PLN02562448 UDP-glycosyltransferase 97.38
KOG4507886 consensus Uncharacterized conserved protein, conta 97.38
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.36
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.34
PLN00414446 glycosyltransferase family protein 97.34
PLN00164480 glucosyltransferase; Provisional 97.33
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.33
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 97.31
PLN02173449 UDP-glucosyl transferase family protein 97.31
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.3
PLN03015470 UDP-glucosyl transferase 97.3
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 97.29
PLN02152455 indole-3-acetate beta-glucosyltransferase 97.28
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.27
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.27
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 97.24
KOG1550552 consensus Extracellular protein SEL-1 and related 97.23
PLN02555480 limonoid glucosyltransferase 97.23
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.2
PLN02534491 UDP-glycosyltransferase 97.19
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.17
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.17
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.13
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.07
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.05
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.98
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.91
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.91
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 96.91
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.87
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.84
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 96.82
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.77
TIGR00661321 MJ1255 conserved hypothetical protein. This model 96.74
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.7
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.68
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 96.58
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 96.55
KOG1258577 consensus mRNA processing protein [RNA processing 96.55
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 96.53
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.5
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.46
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 96.41
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.4
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 96.4
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.39
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.36
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.36
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.33
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.3
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 96.29
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.28
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 96.24
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.16
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 96.12
PRK11619644 lytic murein transglycosylase; Provisional 96.02
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 95.96
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.86
KOG20411189 consensus WD40 repeat protein [General function pr 95.85
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.83
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.78
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.76
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 95.66
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.55
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.52
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.48
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.4
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.33
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.26
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.23
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.2
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.19
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 95.17
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.16
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.09
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.07
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 95.06
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.99
COG1747711 Uncharacterized N-terminal domain of the transcrip 94.95
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.9
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.88
KOG20411189 consensus WD40 repeat protein [General function pr 94.85
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.82
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.8
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 94.73
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.68
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.65
PRK10941269 hypothetical protein; Provisional 94.64
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.6
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.55
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.44
COG4370412 Uncharacterized protein conserved in bacteria [Fun 94.44
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.36
PRK10941269 hypothetical protein; Provisional 94.36
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 94.2
COG1747711 Uncharacterized N-terminal domain of the transcrip 94.18
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.17
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.17
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 94.11
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.08
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.05
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.97
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.89
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.75
PRK14089347 ipid-A-disaccharide synthase; Provisional 93.69
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 93.69
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.61
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.57
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 93.55
KOG15381081 consensus Uncharacterized conserved protein WDR10, 93.54
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 93.49
COG4671400 Predicted glycosyl transferase [General function p 93.38
PRK10017426 colanic acid biosynthesis protein; Provisional 93.31
KOG3364149 consensus Membrane protein involved in organellar 93.31
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 93.29
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.19
PRK10117474 trehalose-6-phosphate synthase; Provisional 93.13
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 93.09
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 93.06
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.99
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.8
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.74
KOG0529421 consensus Protein geranylgeranyltransferase type I 92.7
KOG4814872 consensus Uncharacterized conserved protein [Funct 92.65
KOG2422665 consensus Uncharacterized conserved protein [Funct 92.44
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 92.24
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 92.24
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.24
KOG3364149 consensus Membrane protein involved in organellar 92.23
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 92.22
COG4976287 Predicted methyltransferase (contains TPR repeat) 92.18
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.14
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 92.12
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.99
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.8e-146  Score=1139.94  Aligned_cols=714  Identities=41%  Similarity=0.618  Sum_probs=676.6

Q ss_pred             HHHHHHHHHHcCCCChhhHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Q 003891            2 LVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCY   81 (788)
Q Consensus         2 Ai~~~~kaL~~~P~~~~a~~~la~~l~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~   81 (788)
                      |..+|.++++..|..+-+       |.++|-.+..+|+...|+..|+++++++|+..++|++||.+|.+.+.|++|+.+|
T Consensus       203 a~~cYlkAi~~qp~fAia-------wsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y  275 (966)
T KOG4626|consen  203 AKACYLKAIETQPCFAIA-------WSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCY  275 (966)
T ss_pred             hHHHHHHHHhhCCceeee-------ehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHH
Confidence            345566666666644333       6677888888999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHhhhhhhhcCCHHHHHHHHHHHHH
Q 003891           82 EKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALY  161 (788)
Q Consensus        82 ~kal~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~l~~lg~~~~~~g~~~~A~~~~~~al~  161 (788)
                      .+++.+.|+++.++.++|.+|+++|+.+-|+..|++++++.|+.++++.+++.++..+       |+..+|..+|.+++.
T Consensus       276 ~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~-------G~V~ea~~cYnkaL~  348 (966)
T KOG4626|consen  276 LRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDK-------GSVTEAVDCYNKALR  348 (966)
T ss_pred             HHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhc-------cchHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999888887777775       599999999999999


Q ss_pred             hCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHH
Q 003891          162 YNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNL  241 (788)
Q Consensus       162 ~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l  241 (788)
                      +.|+.+++.+++|.+|.++|++++|..+|+++++..|+...++.++|.+|.++|++++|+.+|++++.+.|..++++.++
T Consensus       349 l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~Nm  428 (966)
T KOG4626|consen  349 LCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNM  428 (966)
T ss_pred             hCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCChhhHHhHHHHhhhccCCCc
Q 003891          242 GVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHD  321 (788)
Q Consensus       242 a~~~~~~g~~~eA~~~l~kal~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~~al~l~p~~~~a~~~~lla~~~l~~g~~  321 (788)
                      |..|..+|+.+.|+++|.+|+..+|..++++.+||.+|...|+..+|++.|+.++++.|+.+++..|++.++.++..|.+
T Consensus       429 Gnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D  508 (966)
T KOG4626|consen  429 GNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTD  508 (966)
T ss_pred             chHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             -----hHHHHHHHHHHHH--Hhhh----------------------------------ccCCCCCCCCCCCCCCeeEeec
Q 003891          322 -----DKLFEAHRDWGKR--FMRL----------------------------------YSQYTSWDNTKDPERPLVIGYV  360 (788)
Q Consensus       322 -----~~~~~~~~~~~~~--~~~~----------------------------------~~~~~~~~~~~~~~~~lriGyv  360 (788)
                           .++++.+++|.+.  +...                                  .+++..|.+-+.+++|||||||
T Consensus       509 ~d~~~~kl~sivrdql~~~rlpsvhP~hsm~ypl~~~~~~aia~k~a~~c~~~~~~~~k~pyth~~~l~~~~~rlrIGYv  588 (966)
T KOG4626|consen  509 YDKRMKKLVSIVRDQLEKNRLPSVHPHHSMLYPLSHILRKAIAAKHANLCLDKVHVLGKPPYTHPDNLKVKEGRLRIGYV  588 (966)
T ss_pred             hHHHHHHHHHHHHHHHhhhcCCccCcccccccccchHHHHHHHHHHhhhhHHHHHhccCCCCCChhhCCCCcCceEEEee
Confidence                 7888888988843  2221                                  1356778888888999999999


Q ss_pred             cCCcccChhHHhhhhhhcccCCCceEEEEEeccccCChhhHHHHHHHhhhCCeEEEccCCCHHHHHHHHHhCCCcEEEeC
Q 003891          361 SPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVEL  440 (788)
Q Consensus       361 S~df~~H~v~~~~~~~l~~~dr~~fev~~Y~~~~~~D~~t~~~r~~~~~~~~~~~~~~~~~~~~~a~~i~~d~idilvdl  440 (788)
                      |+||++||+++||+.++.+|||+++|||||+.++.++  | .||.++.+.+++|.|+++++...+|..|++|+|||||.|
T Consensus       589 SsDFgnHp~Shlmqsv~gmHdr~kveVfcYals~~d~--t-~fR~kv~~e~ehf~Dls~i~~~kiA~~I~qD~I~ILvnl  665 (966)
T KOG4626|consen  589 SSDFGNHPTSHLMQSVPGMHDRSKVEVFCYALSVNDG--T-NFRDKVMKEAEHFVDLSQIPCNKIADKIRQDKIHILVNL  665 (966)
T ss_pred             cccccCCchHHHhccCcCcCCccceEEEEEEeecCCC--c-hHHHHHHhhccceeehhcCChHHHHHHHhhcCceEEEec
Confidence            9999999999999999999999999999999988654  3 389999999999999999999999999999999999999


Q ss_pred             CCCCCCCcccccccCCCCeEEecccCCCCCCCCCccEEEecCCCCCcCccCCCccceEEcCCCccccCCCC--------C
Q 003891          441 TGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSP--------E  512 (788)
Q Consensus       441 ~g~t~~~~~~~~a~r~Apvq~~~~g~~~ttg~~~~Dy~i~d~~~~p~~~~~~~~e~l~~lp~~~~~~~~~~--------~  512 (788)
                      .|||.|+|.++||+|||||||+|+|||+|||.++|||+|||.+++|++....|||||++||+||+|+++.+        .
T Consensus       666 nGyTkgarneifAlrPAPIQv~wlGyPgTtGa~~mDYiITDs~tsPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn  745 (966)
T KOG4626|consen  666 NGYTKGARNEIFALRPAPIQVMWLGYPGTTGATFMDYIITDSVTSPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPN  745 (966)
T ss_pred             cccccccccceeeccCCceeEEeecCCCCCCCceeeEEeecccCChHHHHHHHHHHHhhCCceEEecCcccccccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999876        6


Q ss_pred             CCCCCCCCCCCCCCeEEEecCCCCcCCHHHHHHHHHHHhHcCCcEEEEecCCCCCHHHHHHHHHHHHHcCCCCCcEEEcC
Q 003891          513 AGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLP  592 (788)
Q Consensus       513 ~~~~~~~~~~~~~~~~f~~~~~~~K~~~~~~~~~~~il~~~p~~~l~l~~~~~~~~~~~~~l~~~~~~~gi~~~rv~~~~  592 (788)
                      ..|+++.++||+|+|||||||+++||+|.++++|++||++||||+||++..|+.++   ++++..++++|++++||+|.+
T Consensus       746 ~kP~r~~y~Lp~d~vvf~~FNqLyKidP~~l~~W~~ILk~VPnS~LwllrfPa~ge---~rf~ty~~~~Gl~p~riifs~  822 (966)
T KOG4626|consen  746 NKPTRSQYGLPEDAVVFCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGE---QRFRTYAEQLGLEPDRIIFSP  822 (966)
T ss_pred             CCCCCCCCCCCCCeEEEeechhhhcCCHHHHHHHHHHHHhCCcceeEEEeccccch---HHHHHHHHHhCCCccceeecc
Confidence            66889999999999999999999999999999999999999999999999998665   799999999999999999999


Q ss_pred             CcCCcHHHHHhcccccEeecCCCCCCchhHHHHhhhCCceeecCCCccCccchhHHHhhhCCcccccCCHHHHHHHHHHH
Q 003891          593 LILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQL  672 (788)
Q Consensus       593 ~~~~~~~~~~~~~~~Dv~Ld~~~~~g~~t~~eal~~GvPvvt~~g~~~~~r~~~~~l~~~gl~~~ia~~~~~y~~~a~~l  672 (788)
                      ... .+||+.++..+||+|||++++|+||++|.||+|||+|||+|+++++||++|+|..+|++++|+.+.+||+++||+|
T Consensus       823 va~-k~eHvrr~~LaDv~LDTplcnGhTTg~dvLw~GvPmVTmpge~lAsrVa~Sll~~~Gl~hliak~~eEY~~iaV~L  901 (966)
T KOG4626|consen  823 VAA-KEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGVPMVTMPGETLASRVAASLLTALGLGHLIAKNREEYVQIAVRL  901 (966)
T ss_pred             ccc-hHHHHHhhhhhhhcccCcCcCCcccchhhhccCCceeecccHHHHHHHHHHHHHHcccHHHHhhhHHHHHHHHHHh
Confidence            887 6999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCHHHHHHHHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHhcCCCCCchhhhhhhhcccc
Q 003891          673 ASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVS  736 (788)
Q Consensus       673 ~~d~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~  736 (788)
                      ++|.+.++.+|.++|..+..||+||..+|+..||++|.+||.+||.|++|..+||+.+|++..+
T Consensus       902 atd~~~L~~lr~~l~~~r~~splfd~~q~~~~LE~~y~~MW~~y~~G~~p~h~~me~~~e~~hd  965 (966)
T KOG4626|consen  902 ATDKEYLKKLRAKLRKARASSPLFDTKQYAKGLERLYLQMWKKYCSGEVPDHRRMENLQEEPHD  965 (966)
T ss_pred             hcCHHHHHHHHHHHHHHhcCCCccCchHHHHHHHHHHHHHHHHhccCCCCchHHHhccccCcCC
Confidence            9999999999999999999999999999999999999999999999999999999999998765



>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query788
2vsn_A568 Structure And Topological Arrangement Of An O-Glcna 2e-28
2vsy_A568 Xanthomonas Campestris Putative Ogt (Xcc0866), Apos 3e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 3e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 3e-23
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 3e-27
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 5e-24
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-14
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-19
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-18
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-16
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-12
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 8e-15
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-13
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 5e-10
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-11
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 1e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 4e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-08
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 6e-08
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 2e-06
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 3e-06
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 3e-06
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 4e-06
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 5e-06
3q3e_A631 Crystal Structure Of The Actinobacillus Pleuropneum 9e-06
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 7e-05
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 9e-05
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 1e-04
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 5e-04
>pdb|2VSN|A Chain A, Structure And Topological Arrangement Of An O-Glcnac Transferase Homolog: Insight Into Molecular Control Of Intracellular Glycosylation Length = 568 Back     alignment and structure

Iteration: 1

Score = 124 bits (311), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 99/355 (27%), Positives = 153/355 (43%), Gaps = 16/355 (4%) Query: 354 PLVIGYVSPDYFTHSVSYFIEAPL-VYHDYQNYXXXXXXXXXXXXXXTIRFREKVMKKGG 412 PL +G+VS + H A Q T+R R + + Sbjct: 205 PLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTR---LAQAS 261 Query: 413 IWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGL 472 D+ + A +R ID+L +L G + + A +PAPVQV W+ YP T+G Sbjct: 262 TLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGA 321 Query: 473 PTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTN-GF----I 527 P +DY + D+ A PP + + E ++RL F PS + V P+ T G + Sbjct: 322 PWMDYVLGDAFALPPALEPFYSEHVLRLQGAF---QPSDTSRVVAEPPSRTQCGLPEQGV 378 Query: 528 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 587 FNN K+ P+ + +L VP+S L + P D+ R + G+++ R Sbjct: 379 VLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADA---RLRAFAHAQGVDAQR 435 Query: 588 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 647 + +P L + ++ Y D+ LDT PY TT ++L+ G P +T G A V S Sbjct: 436 LVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGS 494 Query: 648 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFA 702 L +GL + ++ +V A+ LASD AL L + L S V FA Sbjct: 495 LNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFA 549
>pdb|2VSY|A Chain A, Xanthomonas Campestris Putative Ogt (Xcc0866), Apostructure Length = 568 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|3Q3E|A Chain A, Crystal Structure Of The Actinobacillus Pleuropneumoniae Hmw1c Glycosyltransferase Length = 631 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query788
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 0.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-28
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-27
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-16
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-134
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 1e-123
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-107
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-85
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-84
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-81
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-51
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-42
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-55
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-46
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-28
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-32
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-75
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-66
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-63
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-59
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-49
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-30
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-24
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-66
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-60
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-60
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-36
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-67
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-65
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-64
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-63
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-59
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-49
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-23
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-67
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-60
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-59
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-41
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-25
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-66
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-65
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-54
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-50
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-34
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-38
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-50
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-64
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-63
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-57
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-51
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-49
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-49
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-42
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-26
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-63
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-60
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-55
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-53
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-18
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-60
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-46
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-59
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-50
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-50
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-36
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-27
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-58
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-24
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-16
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-14
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-40
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-52
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-29
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-53
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-50
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-25
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-51
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-49
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-48
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-46
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-43
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-42
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-37
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-36
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-34
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-41
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-30
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-31
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-27
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-40
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-28
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-40
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-37
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-33
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-36
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 8e-29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-32
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-30
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-20
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-28
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-20
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-20
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-13
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-27
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-23
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 6e-20
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-19
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-26
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-24
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-23
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-21
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-17
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-12
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-13
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-22
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-21
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-20
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-12
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-18
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-13
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-20
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-19
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 7e-19
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 5e-14
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 1e-09
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 9e-20
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-16
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-14
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-10
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 5e-19
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-19
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-18
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-15
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 7e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 2e-12
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-13
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-12
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-12
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-10
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 6e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 6e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-08
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-10
3q49_B137 STIP1 homology and U box-containing protein 1; E3 6e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-11
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 9e-09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-08
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 2e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 7e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 9e-07
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-08
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 3e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 8e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 7e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 4e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 6e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-04
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 4e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 2e-04
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score =  555 bits (1432), Expect = 0.0
 Identities = 125/571 (21%), Positives = 207/571 (36%), Gaps = 43/571 (7%)

Query: 183 FDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLG 242
               ++    A    P    A   L        +        Q  L++ P   +++  LG
Sbjct: 5   GPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLG 64

Query: 243 VVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDS 302
            V   Q +   AA ++++A  A P +      LG    DAG    A  AY +  ++ P+ 
Sbjct: 65  RVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEE 124

Query: 303 RNAGQNRLLAMNYINEGH-------------------------------DDKLFEAHRDW 331
                  L     + +                                   +     R  
Sbjct: 125 PYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTR 184

Query: 332 GKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS 391
            +      S           + PL +G+VS  +  H       A       +   + ++ 
Sbjct: 185 AQAIAA--SVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHL 242

Query: 392 -AVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLG 450
            A    D  T+R R   + +     D+  +     A  +R   ID+L +L G     +  
Sbjct: 243 FATSGDDGSTLRTR---LAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPE 299

Query: 451 MMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPS 510
           + A +PAPVQV W+ YP T+G P +DY + D+ A PP  +  + E ++RL   F     S
Sbjct: 300 VFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTS 359

Query: 511 PEAG--PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCD 568
                 P      L    +    FNN  K+ P+ +     +L  VP+S L +   P    
Sbjct: 360 RVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGP---G 416

Query: 569 SVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYM 628
               R  +     G+++ R+  +P  L +  ++  Y   D+ LDT PY   TT  ++L+ 
Sbjct: 417 EADARLRAFAHAQGVDAQRLVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWT 475

Query: 629 GVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRD 688
           G P +T  G   A  V  SL   +GL  +   ++  +V  A+ LASD  AL  L   +  
Sbjct: 476 GCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDV 535

Query: 689 LMSKSPVCDGQNFALGLESTYRNMWHRYCKG 719
           L   S V     FA    +  + +  R+   
Sbjct: 536 LRRASGVFHMDGFADDFGALLQALARRHGWL 566


>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Length = 631 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query788
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 100.0
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 100.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.98
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.98
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.88
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.88
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.88
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.87
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.86
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.84
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.83
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.83
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.82
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.82
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.81
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.8
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.8
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.8
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.79
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.78
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.77
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.75
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.75
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.73
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.73
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.72
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.69
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.69
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.67
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.66
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.66
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.66
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.65
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.64
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.64
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.64
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.63
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.62
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.61
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.6
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.58
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.58
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.57
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.57
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.54
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.54
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 99.53
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.52
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.52
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.51
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.49
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.48
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.47
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.46
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.46
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.46
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.45
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.45
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.44
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 99.43
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.42
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.42
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.41
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.41
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.38
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.38
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.36
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 99.36
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.36
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.36
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.36
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.36
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.35
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.34
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.34
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.34
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.34
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 99.33
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.33
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.32
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.32
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.32
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.31
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.31
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.31
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.31
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.3
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.28
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.25
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.25
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.22
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.22
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.21
3k9i_A117 BH0479 protein; putative protein binding protein, 99.18
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.18
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 99.18
3k9i_A117 BH0479 protein; putative protein binding protein, 99.17
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 99.17
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.09
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.06
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.03
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.02
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.0
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 99.0
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.95
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 98.94
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.92
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 98.88
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 98.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.83
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.83
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 98.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.82
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.81
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.8
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 98.8
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 98.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.77
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.77
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.75
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 98.74
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.73
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 98.71
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.67
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.62
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 98.61
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 98.55
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 98.54
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.51
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.4
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.39
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 98.37
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.3
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.29
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 98.28
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.24
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.2
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.18
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 98.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.17
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 98.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.12
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.03
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 98.03
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 97.93
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 97.88
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 97.82
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 97.81
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 97.8
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 97.8
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.72
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 97.7
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.56
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 97.45
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.39
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.39
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 97.24
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.09
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.94
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.92
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 96.73
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.67
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.53
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.52
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 96.32
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.28
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.75
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.74
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.68
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.43
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.23
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.2
3tov_A349 Glycosyl transferase family 9; structural genomics 94.97
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.86
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 94.57
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.55
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 94.37
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.23
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 94.21
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 93.8
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 93.66
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 93.31
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.2
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.16
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 92.65
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.5
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 92.39
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 91.75
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.67
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.59
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 91.3
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.19
2gj4_A824 Glycogen phosphorylase, muscle form; transferase; 91.13
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.02
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.8
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.56
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.39
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.31
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 82.29
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-117  Score=1042.41  Aligned_cols=583  Identities=28%  Similarity=0.422  Sum_probs=515.2

Q ss_pred             HHHHHHhhhhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHH
Q 003891          133 AIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYK  212 (788)
Q Consensus       133 a~~l~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~  212 (788)
                      +.++.++|.++..+|++++|+++|+++++++|++..+++++|.+|..+|++++|++.|+++++++|++..+++++|.++.
T Consensus         9 a~al~nLG~~~~~~G~~~eAi~~~~kAl~l~P~~~~a~~nLg~~l~~~g~~~eA~~~~~~Al~l~P~~~~a~~nLg~~l~   88 (723)
T 4gyw_A            9 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLK   88 (723)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Confidence            34556667777778899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Q 003891          213 DRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAY  292 (788)
Q Consensus       213 ~~g~~~eA~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~eA~~~l~kal~~~p~~~~~~~~la~~~~~~g~~~eA~~~~  292 (788)
                      .+|++++|+++|+++++++|++..++.++|.+|..+|++++|++.|+++++++|+++.++.++|.+|..+|++++|.+.|
T Consensus        89 ~~g~~~~A~~~~~kAl~l~P~~~~a~~~Lg~~~~~~g~~~eAi~~~~~Al~l~P~~~~a~~~L~~~l~~~g~~~~A~~~~  168 (723)
T 4gyw_A           89 EMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERM  168 (723)
T ss_dssp             HTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHTTCCTTHHHHH
T ss_pred             HcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHhhhhhHHHhcccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCChhhHH----hHHHHhhhccCCCchHHHHHHHHHHHHHhh----hc-cCCCCCCCCCCCCCCeeEeeccCC
Q 003891          293 EQCLKIDPDSRNAGQ----NRLLAMNYINEGHDDKLFEAHRDWGKRFMR----LY-SQYTSWDNTKDPERPLVIGYVSPD  363 (788)
Q Consensus       293 ~~al~l~p~~~~a~~----~~lla~~~l~~g~~~~~~~~~~~~~~~~~~----~~-~~~~~~~~~~~~~~~lriGyvS~d  363 (788)
                      ++++++.|+......    .......+........  ...+++......    .. ++.....+.+.++++|||||+|+|
T Consensus       169 ~kal~l~~~~~~~~~l~~~~~~~~l~~~~~~~~~~--aia~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~klrIGyvS~d  246 (723)
T 4gyw_A          169 KKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRK--AIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSD  246 (723)
T ss_dssp             HHHHHHHHHHHHTTCCCSSCTTGGGGSCCCHHHHH--HHHHHHHHHHHHHHHTTTCCCCCCCCSSTTTTTCEEEEEEESC
T ss_pred             HHHHHhChhHHhhccCcccchhhhhhhhcCHHHHH--HHHHHHHHhhhhhhhcccCccccCccccccccccceeeeechh
Confidence            999998776433210    0001111111111111  122233322211    11 122223344567899999999999


Q ss_pred             cccChhHHhhhhhhcccCCCceEEEEEecccc-CChhhHHHHHHHhhhCCeEEEccCC-CHHHHHHHHHhCCCcEEEeCC
Q 003891          364 YFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVK-ADAKTIRFREKVMKKGGIWRDIYGI-DEKKVAAMVREDKIDILVELT  441 (788)
Q Consensus       364 f~~H~v~~~~~~~l~~~dr~~fev~~Y~~~~~-~D~~t~~~r~~~~~~~~~~~~~~~~-~~~~~a~~i~~d~idilvdl~  441 (788)
                      |++|||++|+.+++++||+++|||++|++++. .|..+.+++..    +++|+++.++ ++.+++++|++|+|||||||+
T Consensus       247 f~~H~v~~~~~~~~~~~d~~~fei~~y~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~d~~~a~~i~~d~iDIlidl~  322 (723)
T 4gyw_A          247 FGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAE----ANHFIDLSQIPCNGKAADRIHQDGIHILVNMN  322 (723)
T ss_dssp             SSSSHHHHHHTTHHHHSCTTTEEEEEEESSCCCSCHHHHHHHHH----SSEEEEGGGCCCHHHHHHHHHHTTCSEEEESC
T ss_pred             hccCcHHHHHHHHHHHhccCceeEEEEEcCCCCccHHHHHHHHh----hccccccccCCcHHHHHHHHHhccceeEEecc
Confidence            99999999999999999999999999998864 35555555553    5899999998 689999999999999999999


Q ss_pred             CCCCCCcccccccCCCCeEEecccCCCCCCCCCccEEEecCCCCCcCccCCCccceEEcCCCccccCCCCCCC-------
Q 003891          442 GHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAG-------  514 (788)
Q Consensus       442 g~t~~~~~~~~a~r~Apvq~~~~g~~~ttg~~~~Dy~i~d~~~~p~~~~~~~~e~l~~lp~~~~~~~~~~~~~-------  514 (788)
                      |||.++|+.||++|||||||+|||||+|||+++|||+|+|.+++|++.+.+|||||+|||++|+|++|....|       
T Consensus       323 g~t~~~r~~i~a~r~APvQv~~lG~p~TtG~~~iDY~i~D~~~~P~~~~~~ysEklirLP~~~~~~d~~~~~p~~~~~~~  402 (723)
T 4gyw_A          323 GYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV  402 (723)
T ss_dssp             SSBTTCCTHHHHTCCSSEEEECSSCSSCCCCTTCCEEEECTTTSCGGGGGGCSSEEEECSSCSCCCCHHHHCGGGSSCEE
T ss_pred             CCCCCCcchhhhcCCCCceeeeccCCCCCCCCcCCEEEeCCCCCCchhhhcceeeeeeCCCccccCCccccccccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999986321000       


Q ss_pred             --------------------------------------------------------------------------------
Q 003891          515 --------------------------------------------------------------------------------  514 (788)
Q Consensus       515 --------------------------------------------------------------------------------  514 (788)
                                                                                                      
T Consensus       403 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~p~~p~~~~~~~~~~~~~~~~~~~~~~  482 (723)
T 4gyw_A          403 IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITIN  482 (723)
T ss_dssp             ECCC---CCCSSSEEEECTTHHHHHHTSSSCEEEC-----------------CEEEECSSHHHHHHHHHHHHTCCEEEET
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------CCCCCCCCCCCCeEEEecCCCCcCCHHHHHHHHHHHhHcCCcEEEEecCCC
Q 003891          515 -----------------------------PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPF  565 (788)
Q Consensus       515 -----------------------------~~~~~~~~~~~~~~f~~~~~~~K~~~~~~~~~~~il~~~p~~~l~l~~~~~  565 (788)
                                                   +.+..++|+++.|||||||+++||+|+++++|++||++||+|+|||+..+.
T Consensus       483 g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~R~~~gLp~~~v~f~~fN~~~Ki~p~~~~~W~~IL~~vP~S~L~Ll~~~~  562 (723)
T 4gyw_A          483 GFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPA  562 (723)
T ss_dssp             TEEEEETTCHHHHCHHHHHTSSCCCSEEEEEGGGGTCCTTSEEEECCSCGGGCCHHHHHHHHHHHHHCSSEEEEEEETTG
T ss_pred             ccccccccccccccccccccccccccccccchhhcCCCCCCEEEEeCCccccCCHHHHHHHHHHHHhCCCCeEEEEeCcH
Confidence                                         012345799999999999999999999999999999999999999987652


Q ss_pred             CCHHHHHHHHHHHHHcCCCCCcEEEcCCcCCcHHHHHhcccccEeecCCCCCCchhHHHHhhhCCceeecCCCccCccch
Q 003891          566 CCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVG  645 (788)
Q Consensus       566 ~~~~~~~~l~~~~~~~gi~~~rv~~~~~~~~~~~~~~~~~~~Dv~Ld~~~~~g~~t~~eal~~GvPvvt~~g~~~~~r~~  645 (788)
                         ..+.++++.++++||+++||+|.+..+ ..+|++.|+.+||+|||||||||||++|||||||||||++|.+|+||+|
T Consensus       563 ---~~~~~l~~~~~~~gi~~~r~~f~~~~~-~~~~l~~~~~~Di~LDt~p~~g~tT~~eal~~GvPvvt~~g~~~~sR~~  638 (723)
T 4gyw_A          563 ---VGEPNIQQYAQNMGLPQNRIIFSPVAP-KEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVA  638 (723)
T ss_dssp             ---GGHHHHHHHHHHTTCCGGGEEEEECCC-HHHHHHHGGGCSEEECCSSSCCSHHHHHHHHTTCCEEBCCCSSGGGTHH
T ss_pred             ---HHHHHHHHHHHhcCCCcCeEEECCCCC-HHHHHHHhCCCeEEeCCCCcCCHHHHHHHHHcCCCEEEccCCCccHhHH
Confidence               456789999999999999999999987 7999999999999999999999999999999999999999999999999


Q ss_pred             hHHHhhhCCcccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHhcCCCCCch
Q 003891          646 VSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLK  725 (788)
Q Consensus       646 ~~~l~~~gl~~~ia~~~~~y~~~a~~l~~d~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~p~~~  725 (788)
                      +|||+++|++|||+.|+++||++|++|++|++.|+++|++||+++.+|||||.++|+++||++|++||+|||+|++|..+
T Consensus       639 ~s~l~~~gl~e~ia~~~~~Y~~~a~~la~d~~~l~~lr~~l~~~~~~s~l~d~~~~~~~le~a~~~~w~r~~~G~~p~~~  718 (723)
T 4gyw_A          639 ASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHM  718 (723)
T ss_dssp             HHHHHHHTCGGGBCSSHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSSTTCHHHHHHHHHHHHHHHHHHHHTTCCCCCB
T ss_pred             HHHHHHcCCcccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhCcCcCHHHHHHHHHHHHHHHHHHHHcCCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999875



>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 788
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-44
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-38
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-36
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-36
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-30
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-19
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-39
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-36
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-22
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-22
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-28
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.003
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-26
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-16
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 9e-07
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-26
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-24
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-25
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-24
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-20
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-15
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-14
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-11
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 7e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-18
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.002
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 8e-18
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 5e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 8e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-15
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-15
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 9e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-14
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-12
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 6e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-06
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-13
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-11
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-09
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 7e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-12
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-11
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 5e-11
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 5e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-10
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 6e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 5e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-07
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 5e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 6e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 7e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 8e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-08
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 4e-07
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 0.001
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 6e-08
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 1e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 3e-06
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 3e-04
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 5e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 6e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.001
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.002
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.004
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.002
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  162 bits (411), Expect = 2e-44
 Identities = 73/240 (30%), Positives = 124/240 (51%), Gaps = 7/240 (2%)

Query: 44  IQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYK 103
              Y +A++  P++A A+ NLG V++   +   A+  +EKA    P + +AY N+G + K
Sbjct: 155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK 214

Query: 104 NRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYN 163
                + A+A Y R L++SPN  +   N+A    + G        I+  +  Y++A+   
Sbjct: 215 EARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQG-------LIDLAIDTYRRAIELQ 267

Query: 164 WHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVEC 223
            H+ DA  NL  A  E      A   Y  A    P  A++ NNL  I +++ N+++AV  
Sbjct: 268 PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRL 327

Query: 224 YQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAG 283
           Y+ AL + P F+ + +NL  V   QGK+  A    ++AI  +PT+A+AY+N+G   ++  
Sbjct: 328 YRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query788
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.98
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.79
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.73
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.57
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.55
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.55
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.52
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.51
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.4
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.38
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.32
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.31
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.28
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.27
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.25
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.23
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.2
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.19
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.02
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 99.0
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.91
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 98.87
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.86
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.85
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.78
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.68
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.55
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.47
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.98
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.77
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 97.58
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 97.51
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 97.43
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.29
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 97.28
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 96.97
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 96.62
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.53
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 96.39
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.29
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 95.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.73
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 94.95
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.82
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 92.43
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 85.46
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2e-31  Score=287.56  Aligned_cols=302  Identities=28%  Similarity=0.385  Sum_probs=273.5

Q ss_pred             HHHHHHHHHHcCCCChhhHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Q 003891            2 LVASYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCY   81 (788)
Q Consensus         2 Ai~~~~kaL~~~P~~~~a~~~la~~l~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~   81 (788)
                      |++.|+++++.+|++..+       +..+|.++...|++++|+..|+++++.+|+++.++..+|.+|..+|++++|+..+
T Consensus        18 A~~~~~~~l~~~p~~~~~-------~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~   90 (388)
T d1w3ba_          18 AERHCMQLWRQEPDNTGV-------LLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHY   90 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHH-------HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCHHH-------HHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccc
Confidence            789999999999999887       6777888888999999999999999999999999999999999999999999998


Q ss_pred             HHHHHhC--------------------------------------------------------------------CCCHH
Q 003891           82 EKAALER--------------------------------------------------------------------PMYAE   93 (788)
Q Consensus        82 ~kal~~~--------------------------------------------------------------------p~~~~   93 (788)
                      .++.+.+                                                                    |++..
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  170 (388)
T d1w3ba_          91 RHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAV  170 (388)
T ss_dssp             HHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhH
Confidence            8776543                                                                    34556


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHhhhhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHH
Q 003891           94 AYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNL  173 (788)
Q Consensus        94 ~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~l~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l  173 (788)
                      ++..+|.++...|++++|...++++++.+|++..++..+       |.++...|++++|+..++++....+.....+..+
T Consensus       171 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l-------~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l  243 (388)
T d1w3ba_         171 AWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINL-------GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL  243 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHH-------HHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             HHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHH-------hhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHH
Confidence            788889999999999999999999999999987655544       4555557799999999999999999999999999


Q ss_pred             HHHHHHcCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHH
Q 003891          174 GVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDA  253 (788)
Q Consensus       174 a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~e  253 (788)
                      |.++...|++++|+..|+++++.+|++..++..+|.++...|++++|+..+++++...|.+...+..++.++...|++++
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  323 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEE  323 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCChhhHHhHHHHhhhccCC
Q 003891          254 AAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEG  319 (788)
Q Consensus       254 A~~~l~kal~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~~al~l~p~~~~a~~~~lla~~~l~~g  319 (788)
                      |++.|+++++++|+++.+++.+|.+|..+|++++|+++|+++++++|++..++.++  +..|...|
T Consensus       324 A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~l--g~~~~~~~  387 (388)
T d1w3ba_         324 AVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNM--GNTLKEMQ  387 (388)
T ss_dssp             HHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHH--HHHHHHTC
T ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHH--HHHHHHcC
Confidence            99999999999999999999999999999999999999999999999999988774  44444433



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure