Citrus Sinensis ID: 003918

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780------
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
cccccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHcHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccc
ccccHHccccHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHcccccHHHHHHHccHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccc
maiskelypseddlLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVknlpithpeyetLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRalcalpvtqhDRIWEIYLRFVeqegipietSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVlnddqfysikgktKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKmakpdlsveeeeddeehgsaededirlDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLlrqnphnveQWHRRVKifegnptkqiltyteavrtvdpmkavgkpHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRvaadgnepvqMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVkifkyphvKDIWVTYLSKFVKRYGKTKLERARELFENAVetapadavkPLYLQYAKLEEDYGLAKRAMKVYDQatkavpnheklgMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFasqfadprsdtefwNRWHEFevnhgnedTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
maiskelypseddLLYEEELLRNPFSLKLWWRYLVAKreapfkkrFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLrfveqegipietsLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLAsvlnddqfysiKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEeeeddeehgsaededirlDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRrvkifegnptkqiLTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRrataepsvevrrrvaadgnepvqmklhkslRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKifkyphvkdIWVTYLSKFVKRYGKTKLERARELFEnavetapadavkPLYLQYAKLEEDYGLAKRAMKVYDQAtkavpnheklGMYEIYIARAAEIFGVPKTREIYEQAiesglpdkdvKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEvnhgnedtfREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
MAISKelypseddllyeeellRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVeeeeddeehgsaededIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
*************LLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV****************************RLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMR*********************VQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFL****
****KELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPS**
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAK******************DEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
*AISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQVIYFSFLLLLWIFLPSKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query786 2.2.26 [Sep-21-2011]
Q9DCD2 855 Pre-mRNA-splicing factor yes no 0.907 0.833 0.548 0.0
Q99PK0 855 Pre-mRNA-splicing factor yes no 0.907 0.833 0.548 0.0
Q9HCS7 855 Pre-mRNA-splicing factor yes no 0.907 0.833 0.545 0.0
Q54Z08850 Pre-mRNA-splicing factor yes no 0.912 0.843 0.477 0.0
Q4WVF4839 Pre-mRNA-splicing factor yes no 0.921 0.862 0.474 0.0
Q7SAK5829 Pre-mRNA-splicing factor N/A no 0.918 0.870 0.475 0.0
Q5BH69851 Pre-mRNA-splicing factor yes no 0.922 0.851 0.463 0.0
Q52DF3832 Pre-mRNA-splicing factor N/A no 0.919 0.868 0.468 0.0
Q9P7R9790 Pre-mRNA-splicing factor yes no 0.904 0.9 0.441 0.0
P0CO081031 Pre-mRNA-splicing factor yes no 0.650 0.495 0.481 1e-147
>sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=2 SV=1 Back     alignment and function desciption
 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/753 (54%), Positives = 542/753 (71%), Gaps = 40/753 (5%)

Query: 20  LLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPI 79
           ++RN FS+K W RY+  K+ AP  +   +YERALK LP SYKLW+ YL  R + VK+  +
Sbjct: 28  IMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCV 87

Query: 80  THPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDR 139
           T P YE +NN  ERA V MHKMPR+W+ Y + L  Q  +T  RRTFDRAL ALP+TQH R
Sbjct: 88  TDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSR 147

Query: 140 IWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLND 199
           IW +YLRF+    +P ET++R YRR+LK  P   E++IE+L  S    EAA+RLA+V+ND
Sbjct: 148 IWPLYLRFLRSHPLP-ETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVND 206

Query: 200 DQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYY 259
           ++F S  GK+ ++LW ELCDL++ +  ++  LNVDAIIRGG+ +FTD++G+LW SLADYY
Sbjct: 207 ERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYY 266

Query: 260 IRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEE 319
           IR   FEKARD++EE + TV+TVRDF+ +FDSY+QFEE M++AKM          E   E
Sbjct: 267 IRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKM----------ETASE 316

Query: 320 HGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLR 379
            G  E++D+                         D++LRLAR E L++RRP L NSVLLR
Sbjct: 317 LGREEEDDV-------------------------DLELRLARFEQLISRRPLLLNSVLLR 351

Query: 380 QNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDI 439
           QNPH+V +WH+RV + +G P + I TYTEAV+TVDP KA GKPHTLWVAFAK YE    +
Sbjct: 352 QNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQL 411

Query: 440 ANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRV 499
            +ARVI +KA +VN+K VD LAS+WC+  E+ELRH+N+  AL+L+R+ATA P+   RR  
Sbjct: 412 DDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALKLLRKATALPA---RRAE 468

Query: 500 AADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLL 559
             DG+EPVQ +++KSL++W+   DLEESLG  +ST+AVY+RILDLRIATPQI+INYA+ L
Sbjct: 469 YFDGSEPVQNRVYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFL 528

Query: 560 EEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAP 619
           EEHKYFE++F+ YERG+ +FK+P+V DIW TYL+KF+ RYG  KLERAR+LFE A++  P
Sbjct: 529 EEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFISRYGGRKLERARDLFEQALDGCP 588

Query: 620 ADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKT 679
               K LYL YA+LEE++GLA+ AM VYD+AT+AV   ++  M+ IYI RAAEI+GV  T
Sbjct: 589 PKYAKTLYLLYAQLEEEWGLARHAMAVYDRATRAVEPAQQYDMFNIYIKRAAEIYGVTHT 648

Query: 680 REIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIYVFASQFADPRSDTEFWNRW 739
           R IY++AIE  L D+  + MCL++A++E  LGEIDRAR IY F SQ  DPR+   FW  W
Sbjct: 649 RGIYQKAIEV-LSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTW 707

Query: 740 HEFEVNHGNEDTFREMLRIKRSVSASYSQVIYF 772
            +FEV HGNEDT REMLRI+RSV A+Y+  + F
Sbjct: 708 KDFEVRHGNEDTIREMLRIRRSVQATYNTQVNF 740
Involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Mus musculus (taxid: 10090)
>sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 Back     alignment and function description
>sp|Q54Z08|SYF1_DICDI Pre-mRNA-splicing factor SYF1 OS=Dictyostelium discoideum GN=xab2 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVF4|SYF1_ASPFU Pre-mRNA-splicing factor syf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf1 PE=3 SV=1 Back     alignment and function description
>sp|Q7SAK5|SYF1_NEUCR Pre-mRNA-splicing factor syf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=syf-1 PE=3 SV=1 Back     alignment and function description
>sp|Q5BH69|SYF1_EMENI Pre-mRNA-splicing factor syf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf1 PE=3 SV=1 Back     alignment and function description
>sp|Q52DF3|SYF1_MAGO7 Pre-mRNA-splicing factor SYF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF1 PE=3 SV=2 Back     alignment and function description
>sp|Q9P7R9|SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf3 PE=1 SV=1 Back     alignment and function description
>sp|P0CO08|SYF1_CRYNJ Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYF1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
449433880 912 PREDICTED: pre-mRNA-splicing factor SYF1 0.977 0.842 0.876 0.0
255560840 916 XPA-binding protein, putative [Ricinus c 0.974 0.836 0.876 0.0
224076810 908 predicted protein [Populus trichocarpa] 0.974 0.843 0.868 0.0
356555040 918 PREDICTED: pre-mRNA-splicing factor SYF1 0.978 0.837 0.861 0.0
147766668 920 hypothetical protein VITISV_003952 [Viti 0.980 0.838 0.853 0.0
356549407 919 PREDICTED: pre-mRNA-splicing factor SYF1 0.978 0.836 0.860 0.0
357446341 925 Pre-mRNA-splicing factor SYF1 [Medicago 0.977 0.830 0.831 0.0
15241911 917 pre-mRNA-splicing factor SYF1 [Arabidops 0.978 0.838 0.829 0.0
297808885 928 hypothetical protein ARALYDRAFT_489660 [ 0.978 0.828 0.816 0.0
168038187 911 predicted protein [Physcomitrella patens 0.970 0.837 0.707 0.0
>gi|449433880|ref|XP_004134724.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1408 bits (3645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/772 (87%), Positives = 730/772 (94%), Gaps = 4/772 (0%)

Query: 1   MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSY 60
           M+IS++LYPS+DDLLYEEELLRNPFSLKLWWRYL+A+ EAPFKKRF+IYERALKALPGSY
Sbjct: 1   MSISQDLYPSQDDLLYEEELLRNPFSLKLWWRYLIARAEAPFKKRFIIYERALKALPGSY 60

Query: 61  KLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITK 120
           KLW+AYL ERL +V+NLPITH +YETLNNTFERALVTMHKMPRIWIMYL+TLT+QK +T+
Sbjct: 61  KLWYAYLRERLDLVRNLPITHSQYETLNNTFERALVTMHKMPRIWIMYLQTLTNQKLVTR 120

Query: 121 ARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFL 180
            RRTFDRALCALPVTQHDRIWE YL FV Q+GIPIETSLRVYRRYLKYDP+HIED IEFL
Sbjct: 121 TRRTFDRALCALPVTQHDRIWEPYLVFVSQKGIPIETSLRVYRRYLKYDPTHIEDLIEFL 180

Query: 181 VKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGG 240
           V S LWQEAAE LASVLNDDQFYSIKGKTKHRLWLELCDLLT HATE+SGLNVDAIIRGG
Sbjct: 181 VNSNLWQEAAENLASVLNDDQFYSIKGKTKHRLWLELCDLLTRHATEVSGLNVDAIIRGG 240

Query: 241 IRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV 300
           IRKFTDEVGRLWTSLA+YYIRR L EKARDIFEEGM TVVTVRDFSVIFDSYSQFEE M+
Sbjct: 241 IRKFTDEVGRLWTSLAEYYIRRNLHEKARDIFEEGMTTVVTVRDFSVIFDSYSQFEESML 300

Query: 301 SAKMAKPDLSVEEEEDDEEHG---SAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDL 357
           + KM   DLS +EE++ +E+G     E+EDIRLDV+LS+++F KK+L GFWL+D  D+DL
Sbjct: 301 AHKMENMDLS-DEEDEVQENGLEEEEEEEDIRLDVDLSVSKFEKKILQGFWLYDDNDIDL 359

Query: 358 RLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMK 417
           RLARL+HLM+RRPELANSVLLRQNPHNVEQWHRR+K+FEGNPT+QILTYTEAVRTVDPMK
Sbjct: 360 RLARLDHLMDRRPELANSVLLRQNPHNVEQWHRRIKLFEGNPTRQILTYTEAVRTVDPMK 419

Query: 418 AVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNF 477
           AVGKPHTLWVAFAKLYE +KD+ NARVIFDKAVQVNYKTVD+LASIWCEWAEMELRHKNF
Sbjct: 420 AVGKPHTLWVAFAKLYEAHKDLPNARVIFDKAVQVNYKTVDNLASIWCEWAEMELRHKNF 479

Query: 478 KGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAV 537
           KGALELMRRATAEPSVEV+R+VAADGNEPVQMK+HKSLRLWTFYVDLEESLG LESTRAV
Sbjct: 480 KGALELMRRATAEPSVEVKRKVAADGNEPVQMKVHKSLRLWTFYVDLEESLGTLESTRAV 539

Query: 538 YERILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVK 597
           YERILDLRIATPQIIINYALLLEEHKYFEDAF+VYERGVKIFKYPHVKDIWVTYLSKFVK
Sbjct: 540 YERILDLRIATPQIIINYALLLEEHKYFEDAFKVYERGVKIFKYPHVKDIWVTYLSKFVK 599

Query: 598 RYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNH 657
           RYGKTKLERARELFE+AVETAPAD+V+PLYLQYAKLEED+GLAKRAMKVYDQATKAVPN+
Sbjct: 600 RYGKTKLERARELFEHAVETAPADSVRPLYLQYAKLEEDHGLAKRAMKVYDQATKAVPNN 659

Query: 658 EKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRAR 717
           EKL MYEIYIARAAEIFGVPKTREIYEQAIESGLPD+DVK MCLKYAELEKSLGEIDRAR
Sbjct: 660 EKLSMYEIYIARAAEIFGVPKTREIYEQAIESGLPDQDVKTMCLKYAELEKSLGEIDRAR 719

Query: 718 GIYVFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQV 769
           GIYVFASQFADPRSD  FWN+WHEFEV HGNEDTFREMLRIKRSVSASYSQ 
Sbjct: 720 GIYVFASQFADPRSDLNFWNKWHEFEVQHGNEDTFREMLRIKRSVSASYSQT 771

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255560840|ref|XP_002521433.1| XPA-binding protein, putative [Ricinus communis] gi|223539332|gb|EEF40923.1| XPA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224076810|ref|XP_002305003.1| predicted protein [Populus trichocarpa] gi|222847967|gb|EEE85514.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356555040|ref|XP_003545847.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Glycine max] Back     alignment and taxonomy information
>gi|147766668|emb|CAN65069.1| hypothetical protein VITISV_003952 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356549407|ref|XP_003543085.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Glycine max] Back     alignment and taxonomy information
>gi|357446341|ref|XP_003593448.1| Pre-mRNA-splicing factor SYF1 [Medicago truncatula] gi|355482496|gb|AES63699.1| Pre-mRNA-splicing factor SYF1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|15241911|ref|NP_198226.1| pre-mRNA-splicing factor SYF1 [Arabidopsis thaliana] gi|7682783|gb|AAF67364.1| Hypothetical protein T32B20.g [Arabidopsis thaliana] gi|332006447|gb|AED93830.1| pre-mRNA-splicing factor SYF1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297808885|ref|XP_002872326.1| hypothetical protein ARALYDRAFT_489660 [Arabidopsis lyrata subsp. lyrata] gi|297318163|gb|EFH48585.1| hypothetical protein ARALYDRAFT_489660 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|168038187|ref|XP_001771583.1| predicted protein [Physcomitrella patens subsp. patens] gi|162677139|gb|EDQ63613.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
TAIR|locus:2184236 917 AT5G28740 [Arabidopsis thalian 0.977 0.837 0.805 0.0
DICTYBASE|DDB_G0277977850 xab2 "TPR-like helical domain- 0.519 0.48 0.498 3.2e-199
ZFIN|ZDB-GENE-040426-685 851 xab2 "XPA binding protein 2" [ 0.534 0.493 0.602 2e-145
MGI|MGI:1914689 855 Xab2 "XPA binding protein 2" [ 0.530 0.487 0.599 9.5e-137
RGD|621217 855 Xab2 "XPA binding protein 2" [ 0.530 0.487 0.599 9.5e-137
UNIPROTKB|F6RY07 855 XAB2 "Uncharacterized protein" 0.530 0.487 0.597 4.1e-136
UNIPROTKB|F1SCH5 855 XAB2 "Uncharacterized protein" 0.530 0.487 0.597 5.2e-136
UNIPROTKB|F5H315 852 XAB2 "Pre-mRNA-splicing factor 0.530 0.489 0.594 8.5e-136
UNIPROTKB|Q9HCS7 855 XAB2 "Pre-mRNA-splicing factor 0.530 0.487 0.594 8.5e-136
UNIPROTKB|E2RPV4 855 XAB2 "Uncharacterized protein" 0.530 0.487 0.594 1.4e-135
TAIR|locus:2184236 AT5G28740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3256 (1151.2 bits), Expect = 0., P = 0.
 Identities = 619/768 (80%), Positives = 675/768 (87%)

Query:     1 MAISKXXXXXXXXXXXXXXXXRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSY 60
             MAISK                RN FSLKLWWRYL+AK E+PFKKRF+IYERALKALPGSY
Sbjct:     1 MAISKDLYPSQEDLLYEEELLRNQFSLKLWWRYLIAKAESPFKKRFIIYERALKALPGSY 60

Query:    61 KLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITK 120
             KLW+AYL ERL IV+NLP+THP+Y++LNNTFER LVTMHKMPRIW+MYL+TLT Q+ IT+
Sbjct:    61 KLWYAYLRERLDIVRNLPVTHPQYDSLNNTFERGLVTMHKMPRIWVMYLQTLTVQQLITR 120

Query:   121 ARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFL 180
              RRTFDRALCALPVTQHDRIWE YL FV Q GIPIETSLRVYRRYL YDPSHIE+FIEFL
Sbjct:   121 TRRTFDRALCALPVTQHDRIWEPYLVFVSQNGIPIETSLRVYRRYLMYDPSHIEEFIEFL 180

Query:   181 VKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGG 240
             VKS+ WQE+AERLASVLNDD+FYSIKGKTKH+LWLELC+LL  HA  ISGLNVDAIIRGG
Sbjct:   181 VKSERWQESAERLASVLNDDKFYSIKGKTKHKLWLELCELLVHHANVISGLNVDAIIRGG 240

Query:   241 IRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV 300
             IRKFTDEVG LWTSLADYYIR+ L EKARDI+EEGMM VVTVRDFSVIFD YS+FEE  V
Sbjct:   241 IRKFTDEVGMLWTSLADYYIRKNLLEKARDIYEEGMMKVVTVRDFSVIFDVYSRFEESTV 300

Query:   301 SAKMAKPDLSVXXXXXXXXXXXXXXXXIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLA 360
             + KM     S                 +RL+ NLS+ E  +K+LNGFWL+D  DVDLRLA
Sbjct:   301 AKKMEMMSSSDEEDENEENGVEDDEEDVRLNFNLSVKELQRKILNGFWLNDDNDVDLRLA 360

Query:   361 RLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVG 420
             RLE LMNRRP LANSVLLRQNPHNVEQWHRRVKIFEGN  KQILTYTEAVRTVDPMKAVG
Sbjct:   361 RLEELMNRRPALANSVLLRQNPHNVEQWHRRVKIFEGNAAKQILTYTEAVRTVDPMKAVG 420

Query:   421 KPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGA 480
             KPHTLWVAFAKLYE +KD+ N RVIFDKAVQVNYKTVDHLAS+WCEWAEMELRHKNFKGA
Sbjct:   421 KPHTLWVAFAKLYENHKDLVNTRVIFDKAVQVNYKTVDHLASVWCEWAEMELRHKNFKGA 480

Query:   481 LELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYER 540
             LELMRRATA P+VEVRRRVAADGNEPVQMKLH+SLRLW+FYVDLEESLG LESTRAVYE+
Sbjct:   481 LELMRRATAVPTVEVRRRVAADGNEPVQMKLHRSLRLWSFYVDLEESLGTLESTRAVYEK 540

Query:   541 ILDLRIATPQIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYG 600
             ILDLRIATPQII+NYA LLEE+KYFEDAF+VYERGVKIFKYPHVKDIWVTYL+KFVKRYG
Sbjct:   541 ILDLRIATPQIIMNYAFLLEENKYFEDAFKVYERGVKIFKYPHVKDIWVTYLTKFVKRYG 600

Query:   601 KTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKL 660
             KTKLERARELFE+AV  AP+DAV+ LYLQYAKLEEDYGLAKRAMKVY++ATK VP  +KL
Sbjct:   601 KTKLERARELFEHAVSMAPSDAVRTLYLQYAKLEEDYGLAKRAMKVYEEATKKVPEGQKL 660

Query:   661 GMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIY 720
              MYEIYI+RAAEIFGVP+TREIYEQAIESGLP KDVK MC+K+AELE+SLGEIDRAR +Y
Sbjct:   661 EMYEIYISRAAEIFGVPRTREIYEQAIESGLPHKDVKIMCIKFAELERSLGEIDRARALY 720

Query:   721 VFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASYSQ 768
              ++SQFADPRSD EFWN+WHEFEV HGNEDT+REMLRIKRSVSASYSQ
Sbjct:   721 KYSSQFADPRSDPEFWNKWHEFEVQHGNEDTYREMLRIKRSVSASYSQ 768
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
DICTYBASE|DDB_G0277977 xab2 "TPR-like helical domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-685 xab2 "XPA binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914689 Xab2 "XPA binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621217 Xab2 "XPA binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6RY07 XAB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCH5 XAB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5H315 XAB2 "Pre-mRNA-splicing factor SYF1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCS7 XAB2 "Pre-mRNA-splicing factor SYF1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPV4 XAB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6BQ23SYF1_DEBHANo assigned EC number0.31380.91340.8447yesno
Q4WVF4SYF1_ASPFUNo assigned EC number0.47400.92110.8629yesno
Q9DCD2SYF1_MOUSENo assigned EC number0.54840.90710.8339yesno
Q9HCS7SYF1_HUMANNo assigned EC number0.54580.90710.8339yesno
Q6CAR6SYF1_YARLINo assigned EC number0.37270.87530.9347yesno
Q99PK0SYF1_RATNo assigned EC number0.54840.90710.8339yesno
Q5BH69SYF1_EMENINo assigned EC number0.46310.92230.8519yesno
Q54Z08SYF1_DICDINo assigned EC number0.47760.91220.8435yesno
Q9P7R9SYF1_SCHPONo assigned EC number0.44150.90450.9yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
COG5107660 COG5107, RNA14, Pre-mRNA 3'-end processing (cleava 0.001
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 38.5 bits (90), Expect = 0.001
 Identities = 25/107 (23%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 550 QIIINYALLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARE 609
           + ++N   L  +   +++A   YE+ +++   P   D +   L+    + G  K E A E
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALELD--PDNADAY-YNLAAAYYKLG--KYEEALE 55

Query: 610 LFENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPN 656
            +E A+E  P +A    Y          G  + A++ Y++A +  PN
Sbjct: 56  DYEKALELDPDNA--KAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100

Length = 100
>gnl|CDD|227438 COG5107, RNA14, Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 786
KOG2047835 consensus mRNA splicing factor [RNA processing and 100.0
KOG1915677 consensus Cell cycle control protein (crooked neck 100.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 100.0
KOG1915 677 consensus Cell cycle control protein (crooked neck 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG2047835 consensus mRNA splicing factor [RNA processing and 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PLN03077 857 Protein ECB2; Provisional 99.98
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.94
KOG2076895 consensus RNA polymerase III transcription factor 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
PLN03218 1060 maturation of RBCL 1; Provisional 99.93
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.92
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG2076895 consensus RNA polymerase III transcription factor 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.86
PRK14574 822 hmsH outer membrane protein; Provisional 99.86
KOG1126638 consensus DNA-binding cell division cycle control 99.86
KOG1126638 consensus DNA-binding cell division cycle control 99.85
KOG2003840 consensus TPR repeat-containing protein [General f 99.85
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.85
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.84
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.83
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.81
KOG2003840 consensus TPR repeat-containing protein [General f 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
KOG1258577 consensus mRNA processing protein [RNA processing 99.8
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.79
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.79
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.79
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.78
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.76
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.73
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.73
PRK12370553 invasion protein regulator; Provisional 99.73
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.71
PRK12370553 invasion protein regulator; Provisional 99.71
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.71
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.71
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.71
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.7
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.7
PRK11189296 lipoprotein NlpI; Provisional 99.68
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.67
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.66
KOG1129478 consensus TPR repeat-containing protein [General f 99.66
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.65
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.65
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.64
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.63
KOG1125579 consensus TPR repeat-containing protein [General f 99.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.63
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.62
KOG1129478 consensus TPR repeat-containing protein [General f 99.61
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.59
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.58
KOG1125579 consensus TPR repeat-containing protein [General f 99.58
KOG1258577 consensus mRNA processing protein [RNA processing 99.57
PLN02789320 farnesyltranstransferase 99.55
PLN02789320 farnesyltranstransferase 99.54
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.53
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.52
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.49
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.46
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.39
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.38
KOG2376652 consensus Signal recognition particle, subunit Srp 99.36
PRK15359144 type III secretion system chaperone protein SscB; 99.32
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.31
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.31
PRK10370198 formate-dependent nitrite reductase complex subuni 99.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.28
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.27
PRK15359144 type III secretion system chaperone protein SscB; 99.27
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.22
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.22
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.21
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.21
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.2
PRK10370198 formate-dependent nitrite reductase complex subuni 99.2
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.17
KOG1128777 consensus Uncharacterized conserved protein, conta 99.16
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.16
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.14
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.13
KOG1128777 consensus Uncharacterized conserved protein, conta 99.13
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.05
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 99.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.96
PRK04841903 transcriptional regulator MalT; Provisional 98.94
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.92
KOG0553304 consensus TPR repeat-containing protein [General f 98.92
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.91
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.89
KOG0553304 consensus TPR repeat-containing protein [General f 98.87
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.87
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.81
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.81
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.77
PRK04841 903 transcriptional regulator MalT; Provisional 98.76
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.72
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.66
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.66
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.65
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.65
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.63
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.58
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.57
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.57
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.55
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.55
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.53
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.49
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.49
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.49
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.48
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.47
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.46
COG3898531 Uncharacterized membrane-bound protein [Function u 98.45
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.42
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.38
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.38
PRK11906458 transcriptional regulator; Provisional 98.38
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.37
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.37
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.35
PRK11906458 transcriptional regulator; Provisional 98.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.34
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.34
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.32
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.31
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.31
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.27
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.27
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.25
PRK15331165 chaperone protein SicA; Provisional 98.22
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.19
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.19
PRK10803263 tol-pal system protein YbgF; Provisional 98.17
PRK15331165 chaperone protein SicA; Provisional 98.17
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.17
COG4700251 Uncharacterized protein conserved in bacteria cont 98.16
COG4700251 Uncharacterized protein conserved in bacteria cont 98.16
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.15
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.12
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.09
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.07
PF12688120 TPR_5: Tetratrico peptide repeat 98.07
PRK10803263 tol-pal system protein YbgF; Provisional 98.07
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.06
KOG2471696 consensus TPR repeat-containing protein [General f 98.04
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.04
PF12688120 TPR_5: Tetratrico peptide repeat 98.03
PF1337173 TPR_9: Tetratricopeptide repeat 98.0
PF1337173 TPR_9: Tetratricopeptide repeat 97.99
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.86
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.84
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.79
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.77
KOG1941518 consensus Acetylcholine receptor-associated protei 97.77
PF1342844 TPR_14: Tetratricopeptide repeat 97.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.69
PF1342844 TPR_14: Tetratricopeptide repeat 97.68
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.68
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.68
KOG4234271 consensus TPR repeat-containing protein [General f 97.61
KOG1585308 consensus Protein required for fusion of vesicles 97.6
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.52
PF1343134 TPR_17: Tetratricopeptide repeat 97.52
PF13512142 TPR_18: Tetratricopeptide repeat 97.51
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.49
KOG4555175 consensus TPR repeat-containing protein [Function 97.45
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.43
KOG4234271 consensus TPR repeat-containing protein [General f 97.43
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.42
PF13512142 TPR_18: Tetratricopeptide repeat 97.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.38
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.34
KOG4648536 consensus Uncharacterized conserved protein, conta 97.31
KOG2471696 consensus TPR repeat-containing protein [General f 97.29
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.28
KOG4555175 consensus TPR repeat-containing protein [Function 97.26
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.25
KOG1585308 consensus Protein required for fusion of vesicles 97.24
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.22
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.21
PF1343134 TPR_17: Tetratricopeptide repeat 97.13
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.06
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.04
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.01
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.92
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.8
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.8
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.8
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 96.76
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.76
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.75
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.73
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.72
KOG1586288 consensus Protein required for fusion of vesicles 96.67
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.67
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 96.6
KOG1586288 consensus Protein required for fusion of vesicles 96.59
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.56
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.56
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.54
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.49
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.43
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.41
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.39
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 96.39
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.38
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.37
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.23
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.19
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.17
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.14
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.02
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 95.84
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.79
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.78
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.77
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.76
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.69
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 95.63
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 95.6
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.54
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.51
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 95.45
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.42
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.39
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.35
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.28
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.13
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.12
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.05
KOG2300 629 consensus Uncharacterized conserved protein [Funct 95.01
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.82
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 94.79
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 94.44
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.41
KOG4507886 consensus Uncharacterized conserved protein, conta 94.41
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.35
KOG4507 886 consensus Uncharacterized conserved protein, conta 94.34
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.27
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.26
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.02
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.68
KOG2422665 consensus Uncharacterized conserved protein [Funct 93.19
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 93.09
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.99
KOG1550552 consensus Extracellular protein SEL-1 and related 92.75
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.68
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.29
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.2
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 92.01
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 91.9
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 91.71
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.46
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.33
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.05
PRK10941269 hypothetical protein; Provisional 90.61
KOG1550552 consensus Extracellular protein SEL-1 and related 90.56
KOG1463411 consensus 26S proteasome regulatory complex, subun 90.45
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.07
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.05
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.03
PF1304150 PPR_2: PPR repeat family 90.01
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 89.72
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.53
PRK10941269 hypothetical protein; Provisional 89.48
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.2
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.13
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.92
KOG3364149 consensus Membrane protein involved in organellar 88.85
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 88.33
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 88.22
PF1304150 PPR_2: PPR repeat family 87.32
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.1
KOG3364149 consensus Membrane protein involved in organellar 87.04
KOG4014248 consensus Uncharacterized conserved protein (conta 86.81
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.79
PF1285434 PPR_1: PPR repeat 86.61
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.53
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.24
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 86.11
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.07
KOG2300629 consensus Uncharacterized conserved protein [Funct 85.31
KOG20411189 consensus WD40 repeat protein [General function pr 84.86
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 84.75
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.69
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.86
PF1285434 PPR_1: PPR repeat 83.32
COG3629280 DnrI DNA-binding transcriptional activator of the 82.13
PF1286294 Apc5: Anaphase-promoting complex subunit 5 81.92
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 81.42
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.31
KOG0529421 consensus Protein geranylgeranyltransferase type I 81.2
PF1286294 Apc5: Anaphase-promoting complex subunit 5 80.97
KOG4814 872 consensus Uncharacterized conserved protein [Funct 80.93
COG3629280 DnrI DNA-binding transcriptional activator of the 80.85
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 80.75
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.53
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-83  Score=648.46  Aligned_cols=735  Identities=62%  Similarity=1.053  Sum_probs=692.5

Q ss_pred             CcccCCCCCCCcchHhHHHHhhCCCChHhHHHHHHHHHcCChhhHHHHHHHHHHhCCCCHHHHHHHHHHHHHhccCCCCC
Q 003918            1 MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPIT   80 (786)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~l~~~p~~~~~w~~~~~~~~~~~~~~~~~~~~~al~~~P~~~~~w~~~~~~~~~~~~~~~~~   80 (786)
                      +.++..++++.-|+-||..|.+||.+.+.|..|+.+..+.+..+...+|||||+.+|.|..+|..|++.....+.++|.+
T Consensus         1 ~~~n~dl~~~~EDvpfEeEilRnp~svk~W~RYIe~k~~sp~k~~~~lYERal~~lp~sykiW~~YL~~R~~~vk~~~~T   80 (835)
T KOG2047|consen    1 VIENVDLNFENEDVPFEEEILRNPFSVKCWLRYIEHKAGSPDKQRNLLYERALKELPGSYKIWYDYLKARRAQVKHLCPT   80 (835)
T ss_pred             CCCCccccccccccchHHHHHcCchhHHHHHHHHHHHccCChHHHHHHHHHHHHHCCCchHHHHHHHHHHHHHhhccCCC
Confidence            35678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHcCCcHHHHHHHHHHHHhhCCCCcchhhHHHHHHHHHhcCCChHHHHH
Q 003918           81 HPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLR  160 (786)
Q Consensus        81 ~~~~~~A~~~~~~al~~~p~~~~~w~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~w~~~~~~~~~~~~~~~~A~~  160 (786)
                      ...|......|++++-...+.|.+|+.|+.+.+.++++...++.|.+||...|..+|..+|..|+.+..+.+-+ +.++.
T Consensus        81 ~~~~~~vn~c~er~lv~mHkmpRIwl~Ylq~l~~Q~~iT~tR~tfdrALraLpvtqH~rIW~lyl~Fv~~~~lP-ets~r  159 (835)
T KOG2047|consen   81 DPAYESVNNCFERCLVFMHKMPRIWLDYLQFLIKQGLITRTRRTFDRALRALPVTQHDRIWDLYLKFVESHGLP-ETSIR  159 (835)
T ss_pred             ChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHhcchHHHHHHHHHHHHHhCchHhhccchHHHHHHHHhCCCh-HHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999 99999


Q ss_pred             HHHHHHccCCCCHHHHHHHHHhcCCHHHHHHHHHHHhcCCCccccCCCcchHHHHHHHHHHhcccccccCCcHHHHHHhh
Q 003918          161 VYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGG  240 (786)
Q Consensus       161 ~~~~~l~~~p~~~~~~~~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (786)
                      +|+|.|+..|...+.|+.++...+++++|.+.|..+++++.|.++.++.+.++|..++++..++++.+.+..++++++.+
T Consensus       160 vyrRYLk~~P~~~eeyie~L~~~d~~~eaa~~la~vln~d~f~sk~gkSn~qlw~elcdlis~~p~~~~slnvdaiiR~g  239 (835)
T KOG2047|consen  160 VYRRYLKVAPEAREEYIEYLAKSDRLDEAAQRLATVLNQDEFVSKKGKSNHQLWLELCDLISQNPDKVQSLNVDAIIRGG  239 (835)
T ss_pred             HHHHHHhcCHHHHHHHHHHHHhccchHHHHHHHHHhcCchhhhhhcccchhhHHHHHHHHHHhCcchhcccCHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCchhHHHHHHHHHHHHhhccHHHHHHHHHHHhhccCchhcHHHHHHHHHHHHHHHHHHHhcCCCCCCccccccccc
Q 003918          241 IRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEH  320 (786)
Q Consensus       241 ~~~~p~~~~~~~~~la~~y~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (786)
                      +.++|+..+.+|.+||++|.+.|.+++|+.+|++++....+..+|..+|..|.+|++..+...|+ ........      
T Consensus       240 i~rftDq~g~Lw~SLAdYYIr~g~~ekarDvyeeai~~v~tvrDFt~ifd~Ya~FEE~~~~~~me-~a~~~~~n------  312 (835)
T KOG2047|consen  240 IRRFTDQLGFLWCSLADYYIRSGLFEKARDVYEEAIQTVMTVRDFTQIFDAYAQFEESCVAAKME-LADEESGN------  312 (835)
T ss_pred             cccCcHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhheehhhHHHHHHHHHHHHHHHHHHHHh-hhhhcccC------
Confidence            99999999999999999999999999999999999999999999999999999999988877776 21100000      


Q ss_pred             CCcchhhhHhhhhhhHHHHHHhHhcccccCccchHHHHHHHHHhhhhhchhhhhhhhhhcCCCCHHHHHHHHHhhcCCch
Q 003918          321 GSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPT  400 (786)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~~~~~  400 (786)
                                                  -.+..++..+++.++.++++++.+++++++++||++++.|+.+..+++|+..
T Consensus       313 ----------------------------~ed~~dl~~~~a~~e~lm~rr~~~lNsVlLRQn~~nV~eW~kRV~l~e~~~~  364 (835)
T KOG2047|consen  313 ----------------------------EEDDVDLELHMARFESLMNRRPLLLNSVLLRQNPHNVEEWHKRVKLYEGNAA  364 (835)
T ss_pred             ----------------------------hhhhhhHHHHHHHHHHHHhccchHHHHHHHhcCCccHHHHHhhhhhhcCChH
Confidence                                        0245678899999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhccCCCccCCCcHHHHHHHHHHHHHcCChhHHHHHHHHHHhccCCChhhHHHHHHHHHHHHHhccCHHHH
Q 003918          401 KQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGA  480 (786)
Q Consensus       401 ~a~~~~~~al~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~a~~~~~~g~~~~A  480 (786)
                      +.+..|.+|+++++|...++....+|..+|++|...|+.+.|+.+|+++++.+-..+++++.+|..+|++++++.+++.|
T Consensus       365 ~~i~tyteAv~~vdP~ka~Gs~~~Lw~~faklYe~~~~l~~aRvifeka~~V~y~~v~dLa~vw~~waemElrh~~~~~A  444 (835)
T KOG2047|consen  365 EQINTYTEAVKTVDPKKAVGSPGTLWVEFAKLYENNGDLDDARVIFEKATKVPYKTVEDLAEVWCAWAEMELRHENFEAA  444 (835)
T ss_pred             HHHHHHHHHHHccCcccCCCChhhHHHHHHHHHHhcCcHHHHHHHHHHhhcCCccchHHHHHHHHHHHHHHHhhhhHHHH
Confidence            99999999999999998888889999999999999999999999999999999888999999999999999999999999


Q ss_pred             HHHHHHHhcCCchHHhhhhhccCChhHHHHhhhcHHHHHHHHHHHHHcCChHHHHHHHHHHHhhccCCHHHHHHHHHHHH
Q 003918          481 LELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLE  560 (786)
Q Consensus       481 ~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~  560 (786)
                      +++++++..+|....  ...++...+++.+++++..+|..|++++...|-++..+.+|++++.+.--.|++..++|.++.
T Consensus       445 l~lm~~A~~vP~~~~--~~~yd~~~pvQ~rlhrSlkiWs~y~DleEs~gtfestk~vYdriidLriaTPqii~NyAmfLE  522 (835)
T KOG2047|consen  445 LKLMRRATHVPTNPE--LEYYDNSEPVQARLHRSLKIWSMYADLEESLGTFESTKAVYDRIIDLRIATPQIIINYAMFLE  522 (835)
T ss_pred             HHHHHhhhcCCCchh--hhhhcCCCcHHHHHHHhHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhcCCHHHHHHHHHHHH
Confidence            999999999887322  233667779999999999999999999999999999999999999999999999999999999


Q ss_pred             HcccHHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhhCCccCcHHHHHHHHHHHHHcCCH
Q 003918          561 EHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEEDYGLA  640 (786)
Q Consensus       561 ~~g~~~~A~~~~~~al~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~a~~~~~~g~~  640 (786)
                      .+..++++.++|+|.+.+|+-|.-.++|+.|+..+..+++..+++.||.+|++|++..|+.....+++.|+.++...|..
T Consensus       523 eh~yfeesFk~YErgI~LFk~p~v~diW~tYLtkfi~rygg~klEraRdLFEqaL~~Cpp~~aKtiyLlYA~lEEe~GLa  602 (835)
T KOG2047|consen  523 EHKYFEESFKAYERGISLFKWPNVYDIWNTYLTKFIKRYGGTKLERARDLFEQALDGCPPEHAKTIYLLYAKLEEEHGLA  602 (835)
T ss_pred             hhHHHHHHHHHHHcCCccCCCccHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhhHH
Confidence            99999999999999999999999999999999999999888899999999999999999877788999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCchhhHHHHHHHHHHHhcChhHHHHHHHHHHHhcCCChhHHHHHHHHHHHHHHcCChHHHHHHH
Q 003918          641 KRAMKVYDQATKAVPNHEKLGMYEIYIARAAEIFGVPKTREIYEQAIESGLPDKDVKAMCLKYAELEKSLGEIDRARGIY  720 (786)
Q Consensus       641 ~~A~~~~~~~l~~~p~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~p~~~~~~~~~~~~~~~~~~g~~~~A~~~~  720 (786)
                      .+|.++|+++....+......+|..++......-+....|++|++||+. .|+.....+.+.+++++.+.|.+++|+.+|
T Consensus       603 r~amsiyerat~~v~~a~~l~myni~I~kaae~yGv~~TR~iYekaIe~-Lp~~~~r~mclrFAdlEtklGEidRARaIy  681 (835)
T KOG2047|consen  603 RHAMSIYERATSAVKEAQRLDMYNIYIKKAAEIYGVPRTREIYEKAIES-LPDSKAREMCLRFADLETKLGEIDRARAIY  681 (835)
T ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhCCcccHHHHHHHHHh-CChHHHHHHHHHHHHHhhhhhhHHHHHHHH
Confidence            9999999999998888788899999999888888999999999999999 999888999999999999999999999999


Q ss_pred             HHHHccCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhhh-hhhHHHHH
Q 003918          721 VFASQFADPRSDTEFWNRWHEFEVNHGNEDTFREMLRIKRSVSASY-SQVIYFSF  774 (786)
Q Consensus       721 ~~al~~~~p~~~~~~~~~~~~~~~~~G~~~~a~~~~~~~~~~~~~~-~~~~~~~~  774 (786)
                      ..+.+.++|..++++|..|-.|+.++||.+..++++++.|.+...| .++.+++.
T Consensus       682 a~~sq~~dPr~~~~fW~twk~FEvrHGnedT~keMLRikRsvqa~yn~~~~~~a~  736 (835)
T KOG2047|consen  682 AHGSQICDPRVTTEFWDTWKEFEVRHGNEDTYKEMLRIKRSVQATYNTDVNSMAH  736 (835)
T ss_pred             HhhhhcCCCcCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHhhhhhHHHHHH
Confidence            9999999999999999999999999999999999999999999999 45555443

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-35
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 8e-28
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-14
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 7e-33
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 4e-15
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 6e-15
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 8e-05
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 5e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-26
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-24
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 9e-13
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-07
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-22
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-16
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 9e-07
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 6e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
 Score =  139 bits (351), Expect = 4e-35
 Identities = 83/625 (13%), Positives = 190/625 (30%), Gaps = 120/625 (19%)

Query: 48  IYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIM 107
           + E+ L+  P     W   + E           +   +    T+ER +       R W +
Sbjct: 1   MAEKKLEENPYDLDAWSILIRE---------AQNQPIDKARKTYERLVAQFPSSGRFWKL 51

Query: 108 YLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLK 167
           Y+E     K   K  + F R L  +    H  +W+ YL +V +    + +      +   
Sbjct: 52  YIEAEIKAKNYDKVEKLFQRCLMKVL---HIDLWKCYLSYVRETKGKLPSYKEKMAQAYD 108

Query: 168 YDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATE 227
           +    I   I      ++W +                         +L+  + + ++A  
Sbjct: 109 FALDKIGMEIM---SYQIWVDYIN----------------------FLKGVEAVGSYAEN 143

Query: 228 ISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSV 287
                V  + + G       + +LW     Y     +    + I +         RD+  
Sbjct: 144 QRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDR-------SRDYMN 196

Query: 288 IFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGF 347
                 ++E +M           ++         +   E  ++D+     ++ K   N  
Sbjct: 197 ARRVAKEYETVM---------KGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKS--NPL 245

Query: 348 WLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYT 407
              D           + L+ +R   A    L    H+ + W+   +  E +         
Sbjct: 246 RTED-----------QTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQS--------- 285

Query: 408 EAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEW 467
                            L      +         A  I+++A+    K    L   +  +
Sbjct: 286 ---------------SKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLL---YFAY 327

Query: 468 AEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEES 527
           A+ E     ++    +  R                    + ++      ++  Y+     
Sbjct: 328 ADYEESRMKYEKVHSIYNRL-------------------LAIEDIDPTLVYIQYMKFARR 368

Query: 528 LGNLESTRAVYERILDLRIATPQIIINYALLLEEH-KYFEDAFRVYERGVKIFKYPHVKD 586
              ++S R ++++  +       + +  AL+     K    AF+++E G+K  KY  + +
Sbjct: 369 AEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLK--KYGDIPE 426

Query: 587 IWVTYLSKFVKRYGKTKLERARELFENAVE--TAPADAVKPLYLQYAKLEEDYGLAKRAM 644
             + Y+  ++    +      R LFE  +   + P +    ++ ++   E + G     +
Sbjct: 427 YVLAYI-DYLSHLNED--NNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASIL 483

Query: 645 KVYDQATKAVPNHEKLGMYEIYIAR 669
           KV  +   A     +     + + R
Sbjct: 484 KVEKRRFTAFREEYEGKETALLVDR 508
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Length = 202 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.93
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.93
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.87
3u4t_A272 TPR repeat-containing protein; structural genomics 99.87
3u4t_A272 TPR repeat-containing protein; structural genomics 99.85
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.85
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.81
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.8
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.79
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.79
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.78
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.77
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.77
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.76
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.75
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.75
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.75
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.75
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.74
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.74
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.72
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.71
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.7
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.69
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.68
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.68
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.67
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.67
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.62
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.62
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.62
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.62
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.61
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.61
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.61
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.61
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.59
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.59
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.59
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.59
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.57
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.57
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.54
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.54
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.54
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.51
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.44
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.35
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.35
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.33
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.31
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.3
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.3
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.29
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.26
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.21
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.2
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.19
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.18
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.17
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.13
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.11
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.11
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.1
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.1
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.07
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.03
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.03
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.02
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.02
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.01
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.99
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.99
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.97
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.96
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.96
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.93
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.92
3k9i_A117 BH0479 protein; putative protein binding protein, 98.92
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.92
3k9i_A117 BH0479 protein; putative protein binding protein, 98.9
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.89
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.86
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.85
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.84
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.83
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.8
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.8
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.68
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.54
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.52
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.52
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.51
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.51
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.49
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.31
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.24
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.22
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.2
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.16
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.16
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.72
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.7
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.48
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.4
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.37
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.14
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.11
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 96.89
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.78
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.74
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 96.51
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 96.36
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 96.29
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.09
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 95.9
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 95.85
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.76
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 95.75
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.84
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.7
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.56
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.44
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.3
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.3
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.18
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.38
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.5
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.47
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.72
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.21
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.15
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.04
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.37
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.32
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.47
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.08
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.75
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.43
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 80.68
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.5
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
Probab=100.00  E-value=7.7e-35  Score=326.45  Aligned_cols=147  Identities=23%  Similarity=0.479  Sum_probs=123.1

Q ss_pred             HhHHHHhhCCCChHhHHHHHHHHHcCChhhHHHHHHHHHHhCCCCHHHHHHHHHHHHHhccCCCCCchhHHHHHHHHHHH
Q 003918           15 LYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERA   94 (786)
Q Consensus        15 ~~~~~l~~~p~~~~~w~~~~~~~~~~~~~~~~~~~~~al~~~P~~~~~w~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~a   94 (786)
                      .|+++|..||.+.++|..++.....+++++++.+|+++++.+|.+..+|..|+.++...        |++++|+.+|++|
T Consensus         1 ~le~al~~~P~~~~~w~~l~~~~~~~~~~~a~~~~e~al~~~P~~~~~w~~~~~~~~~~--------~~~~~a~~~~~ra   72 (530)
T 2ooe_A            1 MAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKA--------KNYDKVEKLFQRC   72 (530)
T ss_dssp             CHHHHHHHCTTCHHHHHHHHHHHHSSCHHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHT--------TCHHHHHHHHHHH
T ss_pred             ChhhHhhhCCCCHHHHHHHHHHHHhCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHhc--------CCHHHHHHHHHHH
Confidence            37899999999999999999987788999999999999999999999999999999876        8999999999999


Q ss_pred             HHhcCCCHHHHHHHHHHHHc-CCcHHHHH----HHHHHHHhhCCCC-cchhhHHHHHHHHHh---------cCCChHHHH
Q 003918           95 LVTMHKMPRIWIMYLETLTS-QKFITKAR----RTFDRALCALPVT-QHDRIWEIYLRFVEQ---------EGIPIETSL  159 (786)
Q Consensus        95 l~~~p~~~~~w~~~~~~~~~-~~~~~~A~----~~~~~al~~~p~~-~~~~~w~~~~~~~~~---------~~~~~~~A~  159 (786)
                      +..+| ++.+|..|+.+... .++++.|+    .+|++++...+.+ .+..+|..++.++..         .|+. +.|+
T Consensus        73 l~~~p-~~~lw~~~~~~~~~~~~~~~~a~~~~~~~~~~al~~~g~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~-~~a~  150 (530)
T 2ooe_A           73 LMKVL-HIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRI-TAVR  150 (530)
T ss_dssp             TTTCC-CHHHHHHHHHHHHHHTTTSTTHHHHHHHHHHHHHHHTTTSTTCHHHHHHHHHHHHHSCCCSSTTHHHHH-HHHH
T ss_pred             HhcCC-ChHHHHHHHHHHHHHccchhhHHHHHHHHHHHHHHHCCCCcccHHHHHHHHHHHhcCCCcccHHHHhHH-HHHH
Confidence            99999 78999999987764 46666555    4899998865432 247899999998865         4556 7777


Q ss_pred             HHHHHHHccCCCC
Q 003918          160 RVYRRYLKYDPSH  172 (786)
Q Consensus       160 ~~~~~~l~~~p~~  172 (786)
                      .+|+++++ .|.+
T Consensus       151 ~~y~~al~-~P~~  162 (530)
T 2ooe_A          151 RVYQRGCV-NPMI  162 (530)
T ss_dssp             HHHHHHTT-SCCT
T ss_pred             HHHHHHHh-chhh
Confidence            77777777 5653
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 786
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 3e-21
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 3e-11
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 7e-11
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 92.7 bits (229), Expect = 3e-21
 Identities = 48/270 (17%), Positives = 91/270 (33%), Gaps = 35/270 (12%)

Query: 513 KSLRLWTFYVDLEESLGNLES--------TRAVYERILDLRIATPQIIINYALLLEEH-- 562
           + + +W  Y+  E+S                  YE+ L +    P I    A  LE+   
Sbjct: 6   QQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSK 65

Query: 563 ------------KYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERAREL 610
                        + ++A  +YER +          ++  Y      R    K E+   +
Sbjct: 66  LLAEKGDMNNAKLFSDEAANIYERAISTLL-KKNMLLYFAYADYEESRM---KYEKVHSI 121

Query: 611 FENAVETAPADAVKPLYLQYAKLEEDYGLAKRAMKVYDQATKAVPNHEKLGMYEIYIARA 670
           +   +     D    +Y+QY K        K    ++ +A +          + +Y+  A
Sbjct: 122 YNRLLAIEDIDPTL-VYIQYMKFARRAEGIKSGRMIFKKAREDARTR-----HHVYVTAA 175

Query: 671 AEIFGVPKTREIYEQAIESGL-PDKDVKAMCLKYAELEKSLGEIDRARGIYVFA--SQFA 727
              +   K + +  +  E GL    D+    L Y +    L E +  R ++     S   
Sbjct: 176 LMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSL 235

Query: 728 DPRSDTEFWNRWHEFEVNHGNEDTFREMLR 757
            P    E W R+  FE N G+  +  ++ +
Sbjct: 236 PPEKSGEIWARFLAFESNIGDLASILKVEK 265
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.87
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.87
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.86
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.72
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.7
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.57
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.54
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.27
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.23
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.23
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.21
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.2
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.16
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.1
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.06
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.05
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.0
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.93
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.93
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.92
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.9
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.84
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.8
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.8
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.4
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.36
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.36
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.36
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.35
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.24
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.82
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.13
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.99
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.97
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.95
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.77
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.07
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.19
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 89.18
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=4e-28  Score=257.27  Aligned_cols=371  Identities=14%  Similarity=0.214  Sum_probs=226.7

Q ss_pred             hhHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHcCCcHHHHHHHHHHHHhhCCCCcchhhHHHHHHHHHhcCCChHHHHHH
Q 003918           82 PEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRV  161 (786)
Q Consensus        82 ~~~~~A~~~~~~al~~~p~~~~~w~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~w~~~~~~~~~~~~~~~~A~~~  161 (786)
                      |++++|+..|+++++.+|+++.+|..++.++...|++++|...|+++++.+|.+  ...|..++.++...|++ ++|+..
T Consensus        13 G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~--~~a~~~l~~~~~~~g~~-~~A~~~   89 (388)
T d1w3ba_          13 GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL--AEAYSNLGNVYKERGQL-QEAIEH   89 (388)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHHTCH-HHHHHH
T ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC--HHHHHHHHHHhhhhccc-cccccc
Confidence            778888888888888888888888888888888888888888888888888854  67777777777777888 888888


Q ss_pred             HHHHHccCCCCHHHHHHH---HHhcCCHHHHHHHHHHHhcCCCccccCCCcchHHHHHHHHHHhcccccccCCcHHHHHH
Q 003918          162 YRRYLKYDPSHIEDFIEF---LVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIR  238 (786)
Q Consensus       162 ~~~~l~~~p~~~~~~~~~---~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (786)
                      +.++++.+|.........   ....+....+.......                                          
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------------------  127 (388)
T d1w3ba_          90 YRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSA------------------------------------------  127 (388)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHH------------------------------------------
T ss_pred             cccccccccccccccccccccccccccccccccccccc------------------------------------------
Confidence            888887777765322110   00000000000000000                                          


Q ss_pred             hhhhccCchhHHHHHHHHHHHHhhccHHHHHHHHHHHhhccCchhcHHHHHHHHHHHHHHHHHHHhcCCCCCCccccccc
Q 003918          239 GGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDE  318 (786)
Q Consensus       239 ~~~~~~p~~~~~~~~~la~~y~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (786)
                        ....+.. .......+......+....+...+.+.                                           
T Consensus       128 --~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------------------  161 (388)
T d1w3ba_         128 --LQYNPDL-YCVRSDLGNLLKALGRLEEAKACYLKA-------------------------------------------  161 (388)
T ss_dssp             --HHHCTTC-THHHHHHHHHHHTTSCHHHHHHHHHHH-------------------------------------------
T ss_pred             --ccccccc-ccccccccccccccchhhhhHHHHHHh-------------------------------------------
Confidence              0000000 111111111111122222222222221                                           


Q ss_pred             ccCCcchhhhHhhhhhhHHHHHHhHhcccccCccchHHHHHHHHHhhhhhchhhhhhhhhhcCCCCHHHHHHHHHhhc--
Q 003918          319 EHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFE--  396 (786)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~--  396 (786)
                                                                                 +..+|.+...+..++..+.  
T Consensus       162 -----------------------------------------------------------~~~~~~~~~~~~~l~~~~~~~  182 (388)
T d1w3ba_         162 -----------------------------------------------------------IETQPNFAVAWSNLGCVFNAQ  182 (388)
T ss_dssp             -----------------------------------------------------------HHHCTTCHHHHHHHHHHHHTT
T ss_pred             -----------------------------------------------------------hccCcchhHHHHhhccccccc
Confidence                                                                       3334445555544444443  


Q ss_pred             CCchhHHHHHHHHHhccCCCccCCCcHHHHHHHHHHHHHcCChhHHHHHHHHHHhccCCChhhHHHHHHHHHHHHHhccC
Q 003918          397 GNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKN  476 (786)
Q Consensus       397 ~~~~~a~~~~~~al~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~a~~~~~~g~  476 (786)
                      |++++|...+++++. .+|     .++.+|..+|.++...|++++|+..|+++...+|...    ..+..++.++.+.|+
T Consensus       183 ~~~~~A~~~~~~al~-~~p-----~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~----~~~~~l~~~~~~~~~  252 (388)
T d1w3ba_         183 GEIWLAIHHFEKAVT-LDP-----NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHA----VVHGNLACVYYEQGL  252 (388)
T ss_dssp             TCHHHHHHHHHHHHH-HCT-----TCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCH----HHHHHHHHHHHHTTC
T ss_pred             CcHHHHHHHHHHHHH-hCc-----ccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHH----HHHHHHHHHHHHCCC
Confidence            566666777777663 455     4566677777777777777777777777776666665    666666666667777


Q ss_pred             HHHHHHHHHHHhcCCchHHhhhhhccCChhHHHHhhhcHHHHHHHHHHHHHcCChHHHHHHHHHHHhhccCCHHHHHHHH
Q 003918          477 FKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYA  556 (786)
Q Consensus       477 ~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~  556 (786)
                      +++|+..|+++++..|                    +++.+|..++.++...|++++|+..|++++...|.++..+..++
T Consensus       253 ~~~A~~~~~~al~~~p--------------------~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~  312 (388)
T d1w3ba_         253 IDLAIDTYRRAIELQP--------------------HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLA  312 (388)
T ss_dssp             HHHHHHHHHHHHHTCS--------------------SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCC--------------------CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHH
Confidence            7777777777777666                    56666666777777777777777777777777777777777777


Q ss_pred             HHHHHcccHHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhhCCccCcHHHHHHHHHHHHH
Q 003918          557 LLLEEHKYFEDAFRVYERGVKIFKYPHVKDIWVTYLSKFVKRYGKTKLERARELFENAVETAPADAVKPLYLQYAKLEED  636 (786)
Q Consensus       557 ~~~~~~g~~~~A~~~~~~al~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~a~~~~~  636 (786)
                      .++...|++++|+..|+++++.  +|+++.+|..++..+.   ..|++++|+..|+++++.+|+  +..+|.++|.++.+
T Consensus       313 ~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~---~~g~~~~A~~~~~~al~l~P~--~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         313 NIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQ---QQGKLQEALMHYKEAIRISPT--FADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHH---TTTCCHHHHHHHHHHHTTCTT--CHHHHHHHHHHHHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHH---HcCCHHHHHHHHHHHHHhCCC--CHHHHHHHHHHHHH
Confidence            7777777777777777777765  5666666666544333   446677777777777777776  55666777776666


Q ss_pred             cCC
Q 003918          637 YGL  639 (786)
Q Consensus       637 ~g~  639 (786)
                      .|+
T Consensus       386 ~~D  388 (388)
T d1w3ba_         386 MQD  388 (388)
T ss_dssp             TCC
T ss_pred             cCC
Confidence            554
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure