Citrus Sinensis ID: 003944

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780----
MRGTLANYKENLNKIALDVHYDDDGEELKIYDSRNVDDMSVSDRRDSHSFANSKSVSWSPVSNGFESPHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYSRITENV
ccccHHHHHHHHHHHHHHccccccccHHccccccccccccccHHHHcHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHccc
ccHHHHHHHHHHHHHccccccccHHHHHcccccccccccccHHHHHcccccccHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHcHcccccccEEEEEEccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHccccc
MRGTLANYKENLNKIAldvhydddgeelkiydsrnvddmsvsdrrdshsfansksvswspvsngfesphdpeIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFrngnskassnginipkgsgdlspsrqhKLTAQvknrhaghqlqngfskqdgvsngshALQTEVVQSSKMQGKEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSlkmdkdktSIEITEMRKELNGKLSELRRLQMELNrredgdanDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRkssnekifpdaseypsrldgkmvssesfpgkeEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLnrmsvdsdflvDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAqqgagkgvvrgvlglpgrlvggiiggsqadANAKMASENQIYGLTFFLRKLKKERGENllkiwpdprkIYMEEVELLQRLaplqslgfQDRIYLLAKILipcplkeifgsWNILIQSSQQFLSHHQRAILASQDYSRITENV
MRGTLANYKENLnkialdvhydddgeelkiydsrnvddmsvSDRRDShsfansksvswspvsngfesphdpEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFRNGNSKASSNGINIpkgsgdlspsRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNesfqdelkslkmdkdktsiEITEMrkelngklsELRRLQMElnrredgdandvvENLKRVVATlekennslkmekTELVAALeknrkssnekifpdaseypsrldgKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIekaqeesekmdedSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKnadqraevsrsekEEILvklshsekmlaegkgrankleednaKLRLAVEqsmtrlnrmsvdsdflvDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYGLTFFLRKLKKERGenllkiwpdprKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAilasqdysritenv
MRGTLANYKENLNKIALDVHYDDDGEELKIYdsrnvddmsvsdrrdshsFANSKSVSWSPVSNGFESPHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEVVQSSKMQGkekeladlleekNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHlerelalareesaklseYLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQgagkgvvrgvlglpgrlvggiiggSQADANAKMASENQIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYSRITENV
**********NLNKIALDVHYDD******************************************************************IKALSVNYAALLKE****ISRLNGEYGLLKQNLDAT*************************************************************************************************************************************************************************************************************************************************************************************************************************RAQILHLENVLKQTL******************EIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLE**************************************************************************RMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAIL************
***T*AN********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************F**********************************************YLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYSRI****
MRGTLANYKENLNKIALDVHYDDDGEELKIYDSRNVDDM****************************PHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEV**********KELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDASEYPSRL********************QKLEKDLKETCSERDKALQELTRLKQHLIEK************KIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYL**************EEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYSRITENV
*RGTLAN*K**LNKIALDVHYDD*********************************SWSPVSNGFESPHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLKQNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGS************QIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGTLANYKENLNKIALDVHYDDDGEELKIYDSRNVDDMSVSDRRDSHSFANSKSVSWSPVSNGFESPHDPExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFSKQDGVSNGSHALQTEVVQSSKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEDGDANDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKQTLAKQEEFKMMNHSEIQKSKEIxxxxxxxxxxxxxxxxxxxxxLLNLQTALGQYFAEIEAKGHLERExxxxxxxxxxxxxxxxxxxxxAEVSRSEKEEILVKLSHSEKMxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYGLTFFLRKLKKERGENLLKIWPDPRKIYMEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRAILASQDYSRITENV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query784 2.2.26 [Sep-21-2011]
Q8VYU6725 Golgin candidate 4 OS=Ara yes no 0.835 0.903 0.578 0.0
Q84WU4712 Golgin candidate 3 OS=Ara no no 0.831 0.915 0.567 0.0
>sp|Q8VYU6|GOGC4_ARATH Golgin candidate 4 OS=Arabidopsis thaliana GN=GC4 PE=2 SV=1 Back     alignment and function desciption
 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/704 (57%), Positives = 523/704 (74%), Gaps = 49/704 (6%)

Query: 1   MRGTLANYKENLNKIALDVHYDDDGEE--LKIYDSRNVDDMSVSDRRDSHSFANSKSVSW 58
           M  ++AN KENLNKIA DVH DD+ ++  L IY S N      +DRR+S+ F  S+S   
Sbjct: 1   MWSSVANLKENLNKIAHDVHDDDEDDDEDLTIYGSTN----GGTDRRNSNGFRYSRS--- 53

Query: 59  SPVSNGFESPHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLL 118
            P++NGFESP +PEIERYKAEI +LQ+SE+EIKALSVNYAALLKEKE+QISRLN E G L
Sbjct: 54  -PMANGFESPVNPEIERYKAEINKLQKSESEIKALSVNYAALLKEKEDQISRLNQENGSL 112

Query: 119 KQNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGF 178
           KQNL +TNAAL   R   S+AS+N  N  KG+GD SP+R  +     KNR+   Q+ NG 
Sbjct: 113 KQNLTSTNAALKESRLDLSRASNN--NAIKGNGDHSPNRSQRSPTNWKNRN---QMNNGI 167

Query: 179 -SKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLAAERAAYESQTRQLRMEL 237
            SK +G  N S +             KEKE A++LEE+ RS+A+ +A           EL
Sbjct: 168 ASKPNGTENDSES-----------HKKEKEFAEMLEERTRSMASAQA----------REL 206

Query: 238 EQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQ 297
           E++R K A++Q+ LQEE++ NE+F++EL+SL++DK+KT +E  ++R+EL+ KL+E+R+LQ
Sbjct: 207 EKEREKSANLQILLQEERKQNETFKEELQSLRLDKEKTLMESNKVRRELDAKLAEIRQLQ 266

Query: 298 MELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFP---- 353
           M+LN  E        ENLK V   LEKENN LK++++EL AALE ++KS++ K+FP    
Sbjct: 267 MKLNGGEQHAFGISRENLKEVNKALEKENNELKLKRSELEAALEASQKSTSRKLFPKSTE 326

Query: 354 DASEYPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEK 413
           D S + S LD +   +  FPGKE+ME+SLQ+LEK+L+E   E+DKA QEL RLKQHL+EK
Sbjct: 327 DLSRHLSSLDEEKAGT--FPGKEDMEKSLQRLEKELEEARREKDKARQELKRLKQHLLEK 384

Query: 414 AQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEI 473
             EESEKMDEDS++I+ELR+ NEYQR+QIL LE  L+QT+A QEE K  +  EI+KSK I
Sbjct: 385 ETEESEKMDEDSRLIDELRQTNEYQRSQILGLEKALRQTMANQEEIKSSSDLEIRKSKGI 444

Query: 474 IDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYL 533
           I+ LN KLANC+RTI++KNVELLNLQTALGQY+AEIEAK H ERELA+A+E++ KLS  L
Sbjct: 445 IEDLNQKLANCLRTIDSKNVELLNLQTALGQYYAEIEAKEHFERELAVAKEDAMKLSARL 504

Query: 534 KNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNRMS 593
           K+ D++ E S+ EKEEI  K+ H+E + AE K R +K+E+DNAK+R  +EQSMTRLNRMS
Sbjct: 505 KDVDEQLESSKKEKEEITSKVLHAENIAAEWKNRVSKVEDDNAKVRRVLEQSMTRLNRMS 564

Query: 594 VDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQG-AGKGVVR 652
           +DSDFLVDRRIVIKLLVTYFQRNHS+EVLDLMVRMLGFS+E+KQRIG+AQQG AGKGVVR
Sbjct: 565 MDSDFLVDRRIVIKLLVTYFQRNHSREVLDLMVRMLGFSEEEKQRIGLAQQGAAGKGVVR 624

Query: 653 GVLGLPGRLVGGIIGGSQ--ADANAKMASENQIYG---LTFFLR 691
           GVLG PGRLVGGI+GG     D++  MAS+NQ +    + F L+
Sbjct: 625 GVLGFPGRLVGGILGGGGGSPDSHPNMASDNQSFADMWVEFLLK 668
Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84WU4|GOGC3_ARATH Golgin candidate 3 OS=Arabidopsis thaliana GN=GC3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query784
225454379790 PREDICTED: golgin candidate 4-like isofo 0.868 0.862 0.667 0.0
297745365729 unnamed protein product [Vitis vinifera] 0.890 0.957 0.653 0.0
359489673776 PREDICTED: golgin candidate 4-like isofo 0.855 0.864 0.666 0.0
255541734755 Structural maintenance of chromosome 1 p 0.836 0.868 0.650 0.0
224130406729 predicted protein [Populus trichocarpa] 0.859 0.924 0.644 0.0
224067944734 predicted protein [Populus trichocarpa] 0.866 0.925 0.639 0.0
356560312783 PREDICTED: golgin candidate 4-like [Glyc 0.850 0.851 0.604 0.0
356522556782 PREDICTED: golgin candidate 3-like [Glyc 0.850 0.852 0.620 0.0
356566931758 PREDICTED: golgin candidate 3-like [Glyc 0.830 0.858 0.594 0.0
356531937758 PREDICTED: golgin candidate 3-like [Glyc 0.798 0.825 0.611 0.0
>gi|225454379|ref|XP_002279017.1| PREDICTED: golgin candidate 4-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/706 (66%), Positives = 570/706 (80%), Gaps = 25/706 (3%)

Query: 1   MRGTLANYKENLNKIALDVHYDDDGEELKIYDSR-NVDDMSVSDRRDSHSFANSKSVSWS 59
           M  T+AN KENLNKIALDVH DDD EEL+I+      +D SVSDRR SH +A+S      
Sbjct: 1   MWSTIANLKENLNKIALDVH-DDDDEELQIHAPVVAAEDPSVSDRRFSHKYAHS------ 53

Query: 60  PVSNGFESPHDPEIERYKAEIKRLQESEAEIKALSVNYAALLKEKEEQISRLNGEYGLLK 119
              NG +S ++ EIE+YKAEIKRLQESEAEIKALS+NYAALLK+KE+QIS+L+ E G LK
Sbjct: 54  ---NGIDSAYNSEIEQYKAEIKRLQESEAEIKALSINYAALLKDKEDQISKLSKENGSLK 110

Query: 120 QNLDATNAALNAFRNGNSKASSNGINIPKGSGDLSPSRQHKLTAQVKNRHAGHQLQNGFS 179
            NLD+TNA L+A R+ NS+ S+N ++  KGSGD SPSRQHKLTAQVK R  G+Q+ NG  
Sbjct: 111 HNLDSTNAVLSASRSENSRTSTNSLHALKGSGDQSPSRQHKLTAQVKGRSTGNQMHNGVV 170

Query: 180 KQDGVSNG-SHALQTEVVQS------SKMQGKEKELADLLEEKNRSLAAERAAYESQTRQ 232
           KQDG+SNG +HA+Q +  QS      S ++G EKELADLLEEKNRSLAA +A +E Q +Q
Sbjct: 171 KQDGLSNGIAHAVQPDAAQSKMETKNSNLKGNEKELADLLEEKNRSLAALQATHELQIKQ 230

Query: 233 LRMELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSE 292
           LRMEL+++R+K  ++ LKLQEE +LN SF ++L SLKMDK+KTS+E+ ++R ELN K S 
Sbjct: 231 LRMELDKERDKLKNINLKLQEENKLNHSFLEDLNSLKMDKEKTSMEMNKIRSELNEKRSV 290

Query: 293 LRRLQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIF 352
           ++RLQMELNRRE+ +AND+VE+LK V+A LEKEN+ LK EK E+  AL  ++K+S +KI 
Sbjct: 291 IQRLQMELNRREEEEANDMVESLKGVIANLEKENSCLKREKDEMEVALRMSKKASTDKIS 350

Query: 353 PDASE----YPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQ 408
           PD S+    + S L+ ++ SS SFPGKEEM+ SLQ++E+DLKE C ERDKALQELTRLKQ
Sbjct: 351 PDVSDASEKHFSSLNEQVNSSGSFPGKEEMQISLQQVERDLKEACQERDKALQELTRLKQ 410

Query: 409 HLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQ 468
           HL+EK  EESEKMDEDSKIIEELR+NNEYQRAQIL+LE  LKQ +A+Q+E KM+N SE+Q
Sbjct: 411 HLLEKESEESEKMDEDSKIIEELRQNNEYQRAQILNLEKALKQAIARQDEIKMLNSSELQ 470

Query: 469 KSKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAK 528
           KSKEIID LN KLA+ M T++AKNVELLNLQTALGQY+AE+EAK  LER+LA AREESAK
Sbjct: 471 KSKEIIDDLNKKLASYMCTLDAKNVELLNLQTALGQYYAEMEAKERLERDLAHAREESAK 530

Query: 529 LSEYLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTR 588
           LSE LK+A Q+AE+S+ EKEEIL KLS +E ML EGK R NKLEEDN KLR A+EQSM R
Sbjct: 531 LSELLKDASQQAELSKREKEEILAKLSQAETMLGEGKSRVNKLEEDNMKLRRALEQSMIR 590

Query: 589 LNRMSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGK 648
           LNRMS+DSD+ VDRRIV+KLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIG+AQQG GK
Sbjct: 591 LNRMSMDSDYFVDRRIVVKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGVAQQGTGK 650

Query: 649 GVVRGVLGLPGRLVGGIIGGSQADANAKMASENQIYG---LTFFLR 691
           GVVRGVLGLPGRLVGGI+GGS  +A A +ASENQ +    + F L+
Sbjct: 651 GVVRGVLGLPGRLVGGILGGSSGEAQANVASENQSFADLWVDFLLK 696

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297745365|emb|CBI40445.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489673|ref|XP_003633963.1| PREDICTED: golgin candidate 4-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541734|ref|XP_002511931.1| Structural maintenance of chromosome 1 protein, putative [Ricinus communis] gi|223549111|gb|EEF50600.1| Structural maintenance of chromosome 1 protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224130406|ref|XP_002320829.1| predicted protein [Populus trichocarpa] gi|222861602|gb|EEE99144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224067944|ref|XP_002302611.1| predicted protein [Populus trichocarpa] gi|222844337|gb|EEE81884.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560312|ref|XP_003548437.1| PREDICTED: golgin candidate 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356522556|ref|XP_003529912.1| PREDICTED: golgin candidate 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356566931|ref|XP_003551678.1| PREDICTED: golgin candidate 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356531937|ref|XP_003534532.1| PREDICTED: golgin candidate 3-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query784
TAIR|locus:2082782712 GDAP1 "GRIP-related ARF-bindin 0.586 0.646 0.557 3.3e-127
TAIR|locus:2062984725 GC4 "AT2G46180" [Arabidopsis t 0.788 0.852 0.459 1.8e-126
DICTYBASE|DDB_G0346831 1369 DDB_G0346831 [Dictyostelium di 0.517 0.296 0.194 3e-18
UNIPROTKB|F1SQ111411 EEA1 "Uncharacterized protein" 0.641 0.356 0.215 8.7e-15
SGD|S000002764944 SPC110 "Inner plaque spindle p 0.686 0.569 0.219 3.7e-14
DICTYBASE|DDB_G02872911738 abpD "interaptin" [Dictyosteli 0.683 0.308 0.209 8.2e-14
UNIPROTKB|J9P2D71364 EEA1 "Uncharacterized protein" 0.633 0.364 0.220 2.1e-13
UNIPROTKB|Q150751411 EEA1 "Early endosome antigen 1 0.632 0.351 0.223 2.2e-13
UNIPROTKB|F1PZD31411 EEA1 "Uncharacterized protein" 0.633 0.352 0.220 2.2e-13
ZFIN|ZDB-GENE-041111-270 1398 eea1 "early endosome antigen 1 0.621 0.348 0.207 5.9e-13
TAIR|locus:2082782 GDAP1 "GRIP-related ARF-binding domain-containing protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1249 (444.7 bits), Expect = 3.3e-127, P = 3.3e-127
 Identities = 261/468 (55%), Positives = 337/468 (72%)

Query:   236 ELEQQRNKFADVQLKLQEEQRLNESFQDELKSLKMDKDKTSIEITEMRKELNGKLSELRR 295
             EL ++R K  D QL LQEE++ +ESF++EL+S+++DK+KTS+EI++MR EL+ KL E++ 
Sbjct:   200 ELAKEREKLRDFQLSLQEERKRSESFKEELESMRLDKNKTSMEISKMRSELDAKLLEIKH 259

Query:   296 LQMELNRREDGDANDVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDA 355
             LQM+L  +E       +E+LK V   LEKENN LK++++EL AALE++RK +N K+FPDA
Sbjct:   260 LQMKLTGQESHAIGPGMEHLKEVNKALEKENNELKLKRSELEAALEESRKLTNSKVFPDA 319

Query:   356 SE----YPSRLDGKMVSSESFPGKEEMEQSLQKLEKDLKETCSERDKALQELTRLKQHLI 411
             +E    +PS LD +    ESFPGKEEMEQSLQ+LE DLKET  ERDKA QEL RLKQHL+
Sbjct:   320 TESLTRHPSTLDKE--KPESFPGKEEMEQSLQRLEMDLKETQRERDKARQELKRLKQHLL 377

Query:   412 EKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSK 471
             EK  EESEKMDEDS++IEELR+ NEYQR+QI HLE  LKQ ++ QE+ ++ N ++I+K K
Sbjct:   378 EKETEESEKMDEDSRLIEELRQTNEYQRSQISHLEKSLKQAISNQEDNRLSNDNQIRKLK 437

Query:   472 EIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHXXXXXXXXXXXXXXXXX 531
             + +D LN KL NC+RTIE+KNVELLNLQTALGQY+AEIEAK H                 
Sbjct:   438 DTVDDLNQKLTNCLRTIESKNVELLNLQTALGQYYAEIEAKEHFERELAMAKDELMKLSA 497

Query:   532 YLKNADQRAEVSRSEKEEILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNR 591
              LK++D+R E S  EKE++  KL H+EK+ AE K R  K+EEDNAK+R  +EQSMTRLNR
Sbjct:   498 RLKDSDERLESSNKEKEDVTSKLLHAEKVAAEWKNRVTKVEEDNAKVRRVLEQSMTRLNR 557

Query:   592 MSVDSDFLVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQXXXXXXX 651
             MS++SD+LVDRRIVIKLLVTYFQ+NH+KEVLDLMVRMLGFS+EDK+RIG A+Q       
Sbjct:   558 MSMESDYLVDRRIVIKLLVTYFQKNHNKEVLDLMVRMLGFSEEDKERIGAAKQGGGKGVV 617

Query:   652 XXXXXXXXXXXXXXXXXSQADANAKMASENQIYGLTF--FLRKLKKER 697
                                A+ +A  AS+NQ +   +  FL K  +ER
Sbjct:   618 RGVLGFPGRFVGGILGGKSAELHANAASDNQSFADLWVDFLLKDAEER 665
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0007030 "Golgi organization" evidence=ISS
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
TAIR|locus:2062984 GC4 "AT2G46180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0346831 DDB_G0346831 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQ11 EEA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
SGD|S000002764 SPC110 "Inner plaque spindle pole body (SPB) component" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287291 abpD "interaptin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2D7 EEA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15075 EEA1 "Early endosome antigen 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZD3 EEA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-270 eea1 "early endosome antigen 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYU6GOGC4_ARATHNo assigned EC number0.57810.83540.9034yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query784
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-09
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-09
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-09
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-07
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 8e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 5e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 1e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 2e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 0.001
pfam05483787 pfam05483, SCP-1, Synaptonemal complex protein 1 ( 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.003
COG5185622 COG5185, HEC1, Protein involved in chromosome segr 0.003
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 0.004
TIGR00606 1311 TIGR00606, rad50, rad50 0.004
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 0.004
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 66.3 bits (162), Expect = 5e-11
 Identities = 93/390 (23%), Positives = 162/390 (41%), Gaps = 55/390 (14%)

Query: 204  KEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESFQD 263
            + K  +   + + + L  E A  E+Q  +L  EL+  +N+   ++  L+E +R  E  + 
Sbjct: 657  RNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELER 716

Query: 264  ELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATLE 323
            +L+ LK +      E+ +++  L     EL  L+ EL      +  + +E L+  + +LE
Sbjct: 717  QLEELKRELAALEEELEQLQSRLEELEEELEELEEELE-----ELQERLEELEEELESLE 771

Query: 324  KENNSLKMEKTEL---VAALEKNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGKEEMEQ 380
            +    LK E  EL     AL++  +   E++                        EE E+
Sbjct: 772  EALAKLKEEIEELEEKRQALQEELEELEEEL------------------------EEAER 807

Query: 381  SLQKLEKDLKETCSERDKALQELTRLKQ---HLIEKAQEESEKMDEDSKIIEELRENNEY 437
             L  LE++L+     R++  QE+  L++    L EK  E  E+++E  K +EEL+E  E 
Sbjct: 808  RLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEE 867

Query: 438  QRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRTIEAKNVELLN 497
              A+   LE+ LK+   ++EE            +E +  L ++LA     IE     L  
Sbjct: 868  LEAEKEELEDELKELEEEKEEL-----------EEELRELESELAELKEEIEKLRERLEE 916

Query: 498  LQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEEI----LVK 553
            L+  L +   E+      E E  L  E    L   L+   +R E        +    + +
Sbjct: 917  LEAKLERLEVELP-----ELEEELEEEYEDTLETELEREIERLEEEIEALGPVNLRAIEE 971

Query: 554  LSHSEKMLAEGKGRANKLEEDNAKLRLAVE 583
                E+   E K +   LEE   KL   +E
Sbjct: 972  YEEVEERYEELKSQREDLEEAKEKLLEVIE 1001

Length = 1163
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 784
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 100.0
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 100.0
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.97
KOG0933 1174 consensus Structural maintenance of chromosome pro 99.95
KOG0996 1293 consensus Structural maintenance of chromosome pro 99.92
KOG0018 1141 consensus Structural maintenance of chromosome pro 99.89
KOG0964 1200 consensus Structural maintenance of chromosome pro 99.88
PRK02224 880 chromosome segregation protein; Provisional 99.87
PRK03918 880 chromosome segregation protein; Provisional 99.83
PRK01156 895 chromosome segregation protein; Provisional 99.83
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.8
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 99.79
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 99.71
PHA02562562 46 endonuclease subunit; Provisional 99.66
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 99.49
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.46
TIGR00618 1042 sbcc exonuclease SbcC. This family is based on the 99.45
PRK10869553 recombination and repair protein; Provisional 99.43
KOG0979 1072 consensus Structural maintenance of chromosome pro 99.42
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 99.38
PRK10246 1047 exonuclease subunit SbcC; Provisional 99.35
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.28
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.2
PRK02224880 chromosome segregation protein; Provisional 99.16
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 99.15
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.15
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.12
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.11
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 99.11
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.06
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.03
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 99.02
PRK01156895 chromosome segregation protein; Provisional 98.94
PRK03918880 chromosome segregation protein; Provisional 98.93
PF10174775 Cast: RIM-binding protein of the cytomatrix active 98.92
PF10174775 Cast: RIM-binding protein of the cytomatrix active 98.91
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.9
PF00038312 Filament: Intermediate filament protein; InterPro: 98.89
PRK04863 1486 mukB cell division protein MukB; Provisional 98.88
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.83
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 98.79
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.77
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.73
KOG09331174 consensus Structural maintenance of chromosome pro 98.72
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.71
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 98.7
KOG0971 1243 consensus Microtubule-associated protein dynactin 98.7
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 98.66
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 98.64
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.64
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.57
PRK00064361 recF recombination protein F; Reviewed 98.56
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 98.56
PF00038312 Filament: Intermediate filament protein; InterPro: 98.55
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 98.53
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.52
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 98.51
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 98.51
KOG0971 1243 consensus Microtubule-associated protein dynactin 98.51
KOG0964 1200 consensus Structural maintenance of chromosome pro 98.5
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 98.49
KOG0977546 consensus Nuclear envelope protein lamin, intermed 98.48
PRK14079349 recF recombination protein F; Provisional 98.48
PRK04778569 septation ring formation regulator EzrA; Provision 98.47
KOG0996 1293 consensus Structural maintenance of chromosome pro 98.46
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 98.45
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 98.44
cd03239178 ABC_SMC_head The structural maintenance of chromos 98.44
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.42
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 98.41
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 98.41
PRK04778569 septation ring formation regulator EzrA; Provision 98.31
KOG0977546 consensus Nuclear envelope protein lamin, intermed 98.29
PRK04863 1486 mukB cell division protein MukB; Provisional 98.29
PF13514 1111 AAA_27: AAA domain 98.24
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.24
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 98.23
PHA02562562 46 endonuclease subunit; Provisional 98.19
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 98.16
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 98.12
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.1
COG4477570 EzrA Negative regulator of septation ring formatio 98.07
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 98.07
COG5185622 HEC1 Protein involved in chromosome segregation, i 98.05
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 98.05
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 98.01
TIGR00611365 recf recF protein. All proteins in this family for 97.99
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 97.99
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.99
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.96
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.91
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.9
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 97.87
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 97.87
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 97.83
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 97.77
PRK11637428 AmiB activator; Provisional 97.74
KOG0963629 consensus Transcription factor/CCAAT displacement 97.73
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 97.72
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 97.7
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 97.68
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 97.68
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.63
KOG4673961 consensus Transcription factor TMF, TATA element m 97.6
KOG0963629 consensus Transcription factor/CCAAT displacement 97.58
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.57
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 97.56
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathw 97.51
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 97.51
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 97.47
KOG4673961 consensus Transcription factor TMF, TATA element m 97.44
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.44
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.43
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 97.39
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.38
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 97.38
COG4372499 Uncharacterized protein conserved in bacteria with 97.35
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 97.32
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.31
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.29
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.2
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 97.2
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 97.19
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 97.17
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.16
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.14
PF1037519 GRAB: GRIP-related Arf-binding domain ; InterPro: 97.14
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 97.07
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 97.05
PF1355562 AAA_29: P-loop containing region of AAA domain 97.05
PRK11281 1113 hypothetical protein; Provisional 96.99
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.95
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 96.94
PF13166712 AAA_13: AAA domain 96.93
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.93
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 96.9
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.88
KOG0980980 consensus Actin-binding protein SLA2/Huntingtin-in 96.86
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.84
COG4372499 Uncharacterized protein conserved in bacteria with 96.82
KOG0979 1072 consensus Structural maintenance of chromosome pro 96.79
KOG4809654 consensus Rab6 GTPase-interacting protein involved 96.77
PRK09039343 hypothetical protein; Validated 96.76
PRK09039343 hypothetical protein; Validated 96.74
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.58
PF15066527 CAGE1: Cancer-associated gene protein 1 family 96.48
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.48
KOG1003205 consensus Actin filament-coating protein tropomyos 96.47
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.42
PF05010207 TACC: Transforming acidic coiled-coil-containing p 96.38
PF0146546 GRIP: GRIP domain; InterPro: IPR000237 The GRIP (g 96.35
KOG0018 1141 consensus Structural maintenance of chromosome pro 96.32
COG4477570 EzrA Negative regulator of septation ring formatio 96.24
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.22
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 96.18
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 96.14
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.11
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 96.1
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 96.07
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 96.05
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.05
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.03
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 95.94
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.91
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 95.83
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.82
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 95.76
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 95.72
PRK11281 1113 hypothetical protein; Provisional 95.72
PF15066527 CAGE1: Cancer-associated gene protein 1 family 95.66
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.63
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 95.61
PLN02939 977 transferase, transferring glycosyl groups 95.57
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 95.5
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.43
PF05911769 DUF869: Plant protein of unknown function (DUF869) 95.27
PRK10929 1109 putative mechanosensitive channel protein; Provisi 95.22
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.14
KOG4809654 consensus Rab6 GTPase-interacting protein involved 95.07
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 95.03
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.01
KOG1003205 consensus Actin filament-coating protein tropomyos 94.92
PF135141111 AAA_27: AAA domain 94.86
smart0075546 Grip golgin-97, RanBP2alpha,Imh1p and p230/golgin- 94.77
TIGR00634563 recN DNA repair protein RecN. All proteins in this 94.76
PRK10698222 phage shock protein PspA; Provisional 94.65
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.64
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.49
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 94.46
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.19
PRK10869553 recombination and repair protein; Provisional 94.17
COG2433652 Uncharacterized conserved protein [Function unknow 94.08
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 94.06
TIGR02977219 phageshock_pspA phage shock protein A. Members of 94.02
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.92
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 93.91
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.81
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 93.73
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 93.64
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 93.58
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 93.53
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 93.53
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 93.5
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.49
PF13870177 DUF4201: Domain of unknown function (DUF4201) 93.28
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.25
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 93.16
PRK102461047 exonuclease subunit SbcC; Provisional 93.08
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 93.06
KOG0249 916 consensus LAR-interacting protein and related prot 93.0
PF15254861 CCDC14: Coiled-coil domain-containing protein 14 92.68
PRK10929 1109 putative mechanosensitive channel protein; Provisi 92.68
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.45
COG5185622 HEC1 Protein involved in chromosome segregation, i 92.24
COG1106371 Predicted ATPases [General function prediction onl 92.23
PF05010207 TACC: Transforming acidic coiled-coil-containing p 91.91
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.91
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.9
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 91.83
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 91.8
PF15397258 DUF4618: Domain of unknown function (DUF4618) 91.76
KOG1937521 consensus Uncharacterized conserved protein [Funct 91.7
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.48
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.48
KOG4302660 consensus Microtubule-associated protein essential 91.39
COG2433652 Uncharacterized conserved protein [Function unknow 91.38
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.31
KOG0249 916 consensus LAR-interacting protein and related prot 91.2
PF10186302 Atg14: UV radiation resistance protein and autopha 91.1
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 91.09
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 91.08
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.04
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 90.66
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 90.64
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 89.98
PLN02939 977 transferase, transferring glycosyl groups 89.87
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 89.86
COG3950440 Predicted ATP-binding protein involved in virulenc 89.53
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 89.04
PRK14737186 gmk guanylate kinase; Provisional 88.86
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.7
PF10186302 Atg14: UV radiation resistance protein and autopha 88.54
KOG4807593 consensus F-actin binding protein, regulates actin 88.47
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 88.35
KOG1937521 consensus Uncharacterized conserved protein [Funct 87.93
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 87.7
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 87.69
COG3206458 GumC Uncharacterized protein involved in exopolysa 87.62
KOG4438446 consensus Centromere-associated protein NUF2 [Cell 87.45
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 87.13
PF15254861 CCDC14: Coiled-coil domain-containing protein 14 87.0
KOG4603201 consensus TBP-1 interacting protein [Signal transd 86.68
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 86.67
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 86.66
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 86.52
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 86.52
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.51
KOG4403575 consensus Cell surface glycoprotein STIM, contains 86.23
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 86.08
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 86.07
PF13870177 DUF4201: Domain of unknown function (DUF4201) 85.79
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 85.73
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 85.5
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 85.14
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 85.01
PRK10884206 SH3 domain-containing protein; Provisional 84.93
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 84.66
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 84.54
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 84.53
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 84.4
COG3883265 Uncharacterized protein conserved in bacteria [Fun 84.28
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 84.14
PF15450531 DUF4631: Domain of unknown function (DUF4631) 84.0
PF13175415 AAA_15: AAA ATPase domain 83.98
KOG4403575 consensus Cell surface glycoprotein STIM, contains 83.96
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 83.95
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 83.45
COG4026290 Uncharacterized protein containing TOPRIM domain, 83.42
PF11398373 DUF2813: Protein of unknown function (DUF2813); In 83.37
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 83.06
PF13166712 AAA_13: AAA domain 82.95
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 82.8
KOG2991330 consensus Splicing regulator [RNA processing and m 82.12
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 82.1
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 82.06
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 82.02
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 81.92
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 81.85
COG3910233 Predicted ATPase [General function prediction only 81.75
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 81.59
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 81.38
PRK00409782 recombination and DNA strand exchange inhibitor pr 81.27
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.23
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 81.13
COG4185187 Uncharacterized protein conserved in bacteria [Fun 81.13
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 80.85
PF15294278 Leu_zip: Leucine zipper 80.78
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 80.76
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 80.39
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 80.39
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 80.2
PRK1542279 septal ring assembly protein ZapB; Provisional 80.16
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-38  Score=396.82  Aligned_cols=433  Identities=23%  Similarity=0.254  Sum_probs=294.8

Q ss_pred             hhhhhhccCCCCCcchh-hHHHHhhhcccccccccccCCCcccCCCCCCCC-C-------------------------cc
Q 003944          106 EQISRLNGEYGLLKQNL-DATNAALNAFRNGNSKASSNGINIPKGSGDLSP-S-------------------------RQ  158 (784)
Q Consensus       106 ~~~~~~~g~NGSgKsni-d~~~f~L~~~~~~~~ra~~~~dli~~~~~~~~p-~-------------------------r~  158 (784)
                      ..+.-++|||||||||| |||+||||..|+++|||++++||||+|++.++| +                         ||
T Consensus        24 ~~~t~IvGPNGSGKSNI~DAi~fVLG~~s~k~lRa~~~~DlIf~g~~~r~~~~~A~V~l~fdN~d~~~~~~~~ei~v~Rr  103 (1163)
T COG1196          24 PGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRASKMSDLIFAGSGNRKPANYAEVELTFDNSDNTLPLEYEEISVTRR  103 (1163)
T ss_pred             CCCeEEECCCCCchHHHHHHHHHHhCcchhhhhhccCCcceeeCCCCCCCCCCceEEEEEEeCCCCcCCcccceEEEEEE
Confidence            34566899999999999 999999999999999999999999999998777 3                         77


Q ss_pred             cccccccCCCCccceeccC--CccchhhchhhhccCCccccccccccchhHHhhhcHHHhHHHH---HHHHHHHHHHHHH
Q 003944          159 HKLTAQVKNRHAGHQLQNG--FSKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLA---AERAAYESQTRQL  233 (784)
Q Consensus       159 ~k~~~~~~~~~s~~~~~Ng--~~~~~~~~~l~~~~i~p~gyn~vmqgd~t~~~~m~e~err~i~---a~~a~~e~ei~~l  233 (784)
                      ++..    |. | +||+||  |+++||+++++.+||.|++|++|+||+|++|+.|.|.+||.|+   ||+..|+..+.++
T Consensus       104 i~r~----g~-S-~Y~INg~~~~~~dI~~l~~~~gi~~~~~~iV~QG~V~~i~~~kp~err~iiEEaaGv~~y~~r~~ea  177 (1163)
T COG1196         104 IYRD----GE-S-EYYINGEKVRLKDIQDLLADSGIGKESYSIVSQGKVEEIINAKPEERRKLIEEAAGVSKYKERKEEA  177 (1163)
T ss_pred             EEEc----CC-c-EEEECCcEeeHHHHHHHHHhcCCCCCCCceeecccHHHHHcCCHHHHHHHHHHHhchHHHHHHHHHH
Confidence            7664    66 6 899999  9999999999999999999999999999999999999999999   9999999999999


Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHhhHhHHHH----HHhhhhcccccHHHHHHHHHHHHhHHHHHHHHHHHHhhhhcCCch
Q 003944          234 RMELEQQRNKFADVQLKLQEEQRLNESFQDE----LKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDAN  309 (784)
Q Consensus       234 ~~ELe~~~ekle~l~~~LeE~~~~le~Lkee----l~~le~~~ek~~~Ei~~L~~EL~ele~EL~~LqeeL~~~e~e~~~  309 (784)
                      ...|+...++++++...+.+.+.+++.|+.+    .+|+.+..+....+...+..++..+..++..+..++...+.    
T Consensus       178 ~~~L~~~~~nl~~~~~~~~el~~~l~~L~~q~~~a~~y~~l~~e~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~----  253 (1163)
T COG1196         178 ERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELRKELEELEEELSRLEE----  253 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
Confidence            9999999999999999999999999999997    77888877888888888899999999999999999875444    


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccCCCCCCCCcccccccccCCCCCchHHHHHHHHHHHHHH
Q 003944          310 DVVENLKRVVATLEKENNSLKMEKTELVAALEKNRKSSNEKIFPDASEYPSRLDGKMVSSESFPGKEEMEQSLQKLEKDL  389 (784)
Q Consensus       310 ~tieeLq~eieeL~kei~eLe~ei~eLe~eLe~~~~e~~~~L~~~i~E~~~kI~~e~Ek~~~l~~keeLE~~Ie~Le~EL  389 (784)
                       .++.++..+.....++..++.++.++..++........ .+..                    ...+++..+..+...+
T Consensus       254 -~~~~~~~~~~~~~~~i~~~~~~~~e~~~~~~~~~~~~~-~~~~--------------------~~~~le~~~~~~~~~~  311 (1163)
T COG1196         254 -ELEELQEELEEAEKEIEELKSELEELREELEELQEELL-ELKE--------------------EIEELEGEISLLRERL  311 (1163)
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHH--------------------HHHHHHHHHHHHHHHH
Confidence             77788888888888888888888888888887743332 1000                    1124444444444444


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhchHHHHh
Q 003944          390 KETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNEYQRAQILHLENVLKQTLAKQEEFKMMNHSEIQK  469 (784)
Q Consensus       390 eele~e~~ka~~EL~rLr~eL~e~E~e~qe~ld~~sk~I~EL~~~~e~lr~eL~~lEreLk~l~~~~e~l~~~n~~eI~~  469 (784)
                      ..+..........+..++..+.........    ......++......+...+...+..+..              ....
T Consensus       312 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~e~~~~~~~~~~~~~e~~~~~~~--------------~~~~  373 (1163)
T COG1196         312 EELENELEELEERLEELKEKIEALKEELEE----RETLLEELEQLLAELEEAKEELEEKLSA--------------LLEE  373 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHhHHHHHHHHHHHHHHHHHHHHHHHHH--------------Hhhh
Confidence            444444444444444444444333221100    0001112222222222222222222211              1123


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 003944          470 SKEIIDGLNNKLANCMRTIEAKNVELLNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEE  549 (784)
Q Consensus       470 l~eqieeLkeeLe~l~~eLe~~n~El~nLq~eLeqlq~eiEa~erle~El~~LreEie~L~~eLkeak~eie~l~~Elee  549 (784)
                      ....+..++.++..+..++...+.++..++..++.++..++.   +...+..+..++..+..++...+.++..+..++..
T Consensus       374 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~i~~l~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  450 (1163)
T COG1196         374 LEELFEALREELAELEAELAEIRNELEELKREIESLEERLER---LSERLEDLKEELKELEAELEELQTELEELNEELEE  450 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHH
Confidence            444555566666666666666666666666666655443333   44444445555555555555555555555555555


Q ss_pred             HHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 003944          550 ILVKLSHSEKMLAEGKGRANKLEEDNAKLRLAVEQSMTRLNR  591 (784)
Q Consensus       550 l~ekL~~lE~~l~dlK~ei~kL~~eie~L~kaLdkAl~rl~~  591 (784)
                      +...+..+...+.+++.++..++..+..+...+..+-.++..
T Consensus       451 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  492 (1163)
T COG1196         451 LEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDR  492 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            555555555555555555444555555555544444444443

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10375 GRAB: GRIP-related Arf-binding domain ; InterPro: IPR019459 The GRIP-related Arf-binding (GRAB) domain is located towards the C terminus of Rud3 type proteins Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF01465 GRIP: GRIP domain; InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>smart00755 Grip golgin-97, RanBP2alpha,Imh1p and p230/golgin-245 Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1106 Predicted ATPases [General function prediction only] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF15450 DUF4631: Domain of unknown function (DUF4631) Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query784
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-15
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-05
2xs1_A704 Programmed cell death 6-interacting protein; prote 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 92.6 bits (229), Expect = 2e-19
 Identities = 90/613 (14%), Positives = 191/613 (31%), Gaps = 155/613 (25%)

Query: 204 KEKELADLLEEKNRSLAAERAAYESQTRQLRMELEQQRNKFADVQLKLQEEQRLNESF-Q 262
            ++E+  ++  K+           S T +L   L  ++ +   VQ  ++E  R+N  F  
Sbjct: 47  SKEEIDHIIMSKDA---------VSGTLRLFWTLLSKQEEM--VQKFVEEVLRINYKFLM 95

Query: 263 DELKSLKMDKDKTSIEITEMRKELNGKLSELRRLQMELNRREDGDANDVVENLKRVVATL 322
             +K+ +      +    E R  L        +    ++R +          L++ +  L
Sbjct: 96  SPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYN--VSRLQP------YLKLRQALLEL 147

Query: 323 EKENNSL--KME---KTELVAALEKNRKSSNEKIFPDASEYPSRLD-GKMVSSESFPGKE 376
               N L   +    KT +   +  + K   +        +   L+     S E+     
Sbjct: 148 RPAKNVLIDGVLGSGKTWVALDVCLSYKV--QCKMDFKIFW---LNLKNCNSPET----- 197

Query: 377 EMEQSLQKLEKDLKETCSERDKALQELTRLKQHLIEKAQEESEKMDEDSKIIEELRENNE 436
            +E  LQKL         + D      +    ++  +      +       +  L ++  
Sbjct: 198 VLEM-LQKL-------LYQIDPNWTSRSDHSSNIKLRIHSIQAE-------LRRLLKSKP 242

Query: 437 YQRAQILHLENVLKQTLAKQEEFKMMNHSEIQKSKEIIDGLNNKLANCMRT-IEAKNVEL 495
           Y+   +L L NV                    ++ +  +  N     C +  +  +  ++
Sbjct: 243 YENC-LLVLLNV--------------------QNAKAWNAFNLS---C-KILLTTRFKQV 277

Query: 496 LNLQTALGQYFAEIEAKGHLERELALAREESAKLSEYLKNADQRAEVSRSEKEEI--LVK 553
            +  +A       ++        + L  +E   L   LK  D R +    E         
Sbjct: 278 TDFLSAATTTHISLD-----HHSMTLTPDEVKSL--LLKYLDCRPQDLPREVLTTNPRR- 329

Query: 554 LSHSEKMLAEGKGRANKLEEDNA-KLRLAVEQSMTRLN---------RMSVDSDFLVDRR 603
           LS   + + +G    +  +  N  KL   +E S+  L          R+SV   F     
Sbjct: 330 LSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSV---FPPSAH 386

Query: 604 IVIKLLVTYFQRNHSKEVLDLMVRMLGFSDEDKQRIGMAQQGAGKGVVRGVLGLPGRLVG 663
           I   LL   +      +V+ ++ ++  +S  +KQ                 + +P     
Sbjct: 387 IPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQP------------KESTISIPSI--- 431

Query: 664 GIIGGSQADANAKMASENQI-------YGLTFFLRKLKKERGENLLKIWPDPRKIY---- 712
                   +   K+ +E  +       Y         K    ++L+  + D +  Y    
Sbjct: 432 ------YLELKVKLENEYALHRSIVDHY------NIPKTFDSDDLIPPYLD-QYFYSHIG 478

Query: 713 --MEEVELLQRLAPLQSLGFQDRIYLLAKILIPCPLKEIFGSWNILIQSSQQFLSHHQRA 770
             ++ +E  +R+   + + F D  +L  KI          GS    +Q  + +  +    
Sbjct: 479 HHLKNIEHPERMTLFRMV-FLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPY---- 533

Query: 771 ILASQDYSRITEN 783
                    I +N
Sbjct: 534 ---------ICDN 537
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query784
3kta_A182 Chromosome segregation protein SMC; structural mai 99.48
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.33
1e69_A322 Chromosome segregation SMC protein; structural mai 99.32
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.29
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.26
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 99.19
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 99.01
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 98.92
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 98.9
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 98.82
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.77
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.09
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 97.82
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.61
4aby_A415 DNA repair protein RECN; hydrolase, double strand 97.53
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.37
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.24
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.21
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.11
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.94
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.74
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 96.58
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.98
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.38
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.34
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 94.86
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.79
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 94.39
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 94.08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.04
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 93.99
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 93.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.58
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 93.38
1upt_B60 Golgi autoantigen, golgin subfamily A member 4; hy 93.25
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 92.8
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 92.43
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 91.45
2v4h_A110 NF-kappa-B essential modulator; transcription, met 91.25
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 90.57
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 90.25
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 90.19
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.19
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 90.15
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 90.03
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 89.94
3l4q_C170 Phosphatidylinositol 3-kinase regulatory subunit b 89.39
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 88.91
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.72
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 88.53
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 88.29
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 87.63
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 87.32
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 86.97
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 85.68
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 85.5
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.35
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 85.06
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 84.27
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 83.19
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 82.83
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 82.53
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 82.33
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 82.09
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 82.04
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 81.92
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 81.56
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 81.08
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 80.56
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 80.22
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 80.11
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
Probab=99.48  E-value=1.5e-14  Score=141.89  Aligned_cols=126  Identities=19%  Similarity=0.163  Sum_probs=91.9

Q ss_pred             hhhhccCCCCCcchh-hHHHHhhhcccccccccccCCCcccCCCCCCCCC--c--------------------ccccccc
Q 003944          108 ISRLNGEYGLLKQNL-DATNAALNAFRNGNSKASSNGINIPKGSGDLSPS--R--------------------QHKLTAQ  164 (784)
Q Consensus       108 ~~~~~g~NGSgKsni-d~~~f~L~~~~~~~~ra~~~~dli~~~~~~~~p~--r--------------------~~k~~~~  164 (784)
                      +.-++|||||||||| |||.++|+..+.+..|+.++.++|+.|.....|.  .                    .+.++..
T Consensus        28 ~~~i~G~NGsGKStll~ai~~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~v~~~f~~~~~~~~~~~~~~~i~r~~~  107 (182)
T 3kta_A           28 FTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVY  107 (182)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHHTTCCCTGGGTCSSGGGGBCCCC----CCSCEEEEEEEECTTCCSSSSSSEEEEEEEEC
T ss_pred             cEEEECCCCCCHHHHHHHHHHHHcCCcccccccccchheeecccccCCCCceEEEEEEEeCCCcccccCCcEEEEEEEEE
Confidence            667899999999999 9999999999999999999999999875322210  0                    1111111


Q ss_pred             cCCCCccceeccC--CccchhhchhhhccCCccccccccccchhHHhhhcHHHhHHHH---HHHHHHHHHHHHHHH
Q 003944          165 VKNRHAGHQLQNG--FSKQDGVSNGSHALQTEVVQSSKMQGKEKELADLLEEKNRSLA---AERAAYESQTRQLRM  235 (784)
Q Consensus       165 ~~~~~s~~~~~Ng--~~~~~~~~~l~~~~i~p~gyn~vmqgd~t~~~~m~e~err~i~---a~~a~~e~ei~~l~~  235 (784)
                      .++. + .|++||  ++..++.+++...|+.|+.++++.||++++|+.|+|.+|+.++   +|...|+.+++++..
T Consensus       108 ~~~~-~-~~~i~g~~~~~~~~~~~l~~~~l~~~~~~~~~qg~~~~l~~~~~~~r~~~ld~~~g~~~~~~~~~~~~~  181 (182)
T 3kta_A          108 PDGR-S-SYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDISGIAEYDSKKEKALE  181 (182)
T ss_dssp             TTSC-E-EEEETTEEECHHHHHHHHHHTTCCTTCTTEECTTCTTHHHHSCHHHHHHHHHHHHTC------------
T ss_pred             eCCc-E-EEEECCeEcCHHHHHHHHHHcCCCCCCCEEEEcccHHHHHhCCHHHHHHHHHHHHChHHHHHHHHHHhc
Confidence            1233 3 588899  8899999999999999999999999999999999999999999   666677766665543
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1upt_B Golgi autoantigen, golgin subfamily A member 4; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: a.193.1.1 PDB: 1r4a_E* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query784
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.66
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 99.46
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.2
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 97.68
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.95
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.72
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 86.45
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 81.57
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.66  E-value=1e-17  Score=181.05  Aligned_cols=154  Identities=13%  Similarity=0.091  Sum_probs=80.1

Q ss_pred             hhhhhhccCCCCCcchh-hHHHHhhhcccccccccccCCCcccCCCCCCCCC--------------------------c-
Q 003944          106 EQISRLNGEYGLLKQNL-DATNAALNAFRNGNSKASSNGINIPKGSGDLSPS--------------------------R-  157 (784)
Q Consensus       106 ~~~~~~~g~NGSgKsni-d~~~f~L~~~~~~~~ra~~~~dli~~~~~~~~p~--------------------------r-  157 (784)
                      ..+.-++|||||||||| |||.||||. +++.+|+.++.|+||+|.......                          . 
T Consensus        25 ~~l~~i~G~NGsGKS~ileAi~~~lg~-~~~~~R~~~~~dli~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (427)
T d1w1wa_          25 SNFTSIIGPNGSGKSNMMDAISFVLGV-RSNHLRSNILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKL  103 (427)
T ss_dssp             CSEEEEECSTTSSHHHHHHHHHHHTTC----------CGGGSCCC-------------------CCEEEEEEEEEETTEE
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHhCC-CccccccccchhheecCCcCCcceEEEEeeccccccccccceeeeeccCCcE
Confidence            34667899999999999 999999987 457899999999999986522211                          0 


Q ss_pred             -ccccccccCCCCccceeccC--CccchhhchhhhccCCccccc-cccccchhHHhhhcHHHhHHHH---HHHHHHHHHH
Q 003944          158 -QHKLTAQVKNRHAGHQLQNG--FSKQDGVSNGSHALQTEVVQS-SKMQGKEKELADLLEEKNRSLA---AERAAYESQT  230 (784)
Q Consensus       158 -~~k~~~~~~~~~s~~~~~Ng--~~~~~~~~~l~~~~i~p~gyn-~vmqgd~t~~~~m~e~err~i~---a~~a~~e~ei  230 (784)
                       .+++....++. + -||+||  |++.++.+++...|+.|.+|+ +|+||++++|+.|++..||.++   ++...+....
T Consensus       104 i~i~r~i~~~~~-~-~~~in~~~~~~~~i~~~~~~~~~~~~~~~~~i~q~~~~~~~~~~~~~~~~~le~~~~~~~~~~~~  181 (427)
T d1w1wa_         104 VELMRIISRNGD-T-SYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEY  181 (427)
T ss_dssp             EEEEEEEETTSC-E-EEEETTEEECHHHHHHHHHHTTCCTTTCTTEECTTCTTHHHHSCHHHHHHTC-------------
T ss_pred             EEEEEEEccCCc-e-eEecCcccccHHHHHHHHHHcCCCCCCccceechhhhhhhhhccccccccccccccccccccccc
Confidence             01111112244 3 478999  999999999999999999998 7899999999999999999988   5666777777


Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHHHhhHhHH
Q 003944          231 RQLRMELEQQRNKFADVQLKLQEEQRLNESFQ  262 (784)
Q Consensus       231 ~~l~~ELe~~~ekle~l~~~LeE~~~~le~Lk  262 (784)
                      ..+...++....++.+....+......+..++
T Consensus       182 ~~~~~~~~~~~~~~~e~~~~~~~i~~e~~~~~  213 (427)
T d1w1wa_         182 EELKEKIEKLSKSATESIKNRRRIHGELKTYK  213 (427)
T ss_dssp             --------------------------------
T ss_pred             ccccccccccccccccccccccccccchhhhh
Confidence            77777776666666555555555444444433
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure