Citrus Sinensis ID: 004022


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
cEEEccccccHHHHHccccccccEEEEEEEccccccccccHHHHHccccccEEEEEccccccccccccccHHHHccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccHHHHHcccccccEEccccccccccccEEEccccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEccccccccccccEEEEEEEEEcccccccccEEEEccccccccccccccEEEEEEEcccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHcccccccc
ccEEHHHcccHHHHHHcccccccEEEEEEEcccccccccccHHHHccccccEEEEccccccccccHHHccHHHHHHcccccccccHccccHHcEEEEcccccccccccHccHHHcEEEEcccccHHHccccccccccHHHcccccccEEEcccccccccccHHcccccccEEEEccccccccccHHcccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHccccHEEEcccccccccccccccccEEEcccccccccccHHHccccEEEcccccccccccHHHccccEEEccccccccccccccccccHccEEEcccccccccccHHHcccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHccccccEEEEEccccccccccEEEEEEEEEEEcccccccccccEEEEEEEEEcccccccEccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEcccccEEEEEcEEEEEEEcccccccccccccccccEEEccccccccccccccccccccccccEccccccc
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLskikginldpraftnmsnlrlfkfyvpkfyeieklpsmsteeqlsyskvqlpngldylpkklrylhwdtyplrtlpsnfkpknlVELNLRCskveqpwegekacvpssiqnFKYLSAlsfkgcqslrsfpsnlhfvcpvtINFSYCVNliefpqisgkvtrlylgqsaieevpssiecltdlevldlrgckrLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRiysdrtpitelpssfenlpglevlfvedcskldnlpdnigsLEYLYYILAAASAISQLPSSVALSNMLRSLdsshckglesfprTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEdfnmlqslpelplcLKYLHLIdckmlqslpvlpfclesldltgcnmlrslpelplclqylnledcnmlrslpelplclqlltvrncnrlqSLPEILLCLQELDASVLEKLSkhspdlqwapeslKSAAICFEFTNclklngkaNNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSlivlpgseipdwfsnqssgssiciqlpphsscrnlIGFAFCAVldskkvdsdcfrYFYVSFQFDLEIktlsetkhvdlgynsryiedlidsdrvilgfkpclnvgfpdgyhhtIATFKFFAERKFYkikrcglcpvyanpsetkdntfTINFATEvwklddlpsasgtldveelelspkricranqintp
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLrtlpsnfkpknlVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEevpssiecltdlevldlrgcKRLKRistsfcklrSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFdleiktlsetkhvdlgyNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVyanpsetkdnTFTINFATEVWKLDDLPSASGTldveelelspkricranqintp
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGsleylyyilaaasaisqlpssVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMlrslpelplclqllTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
*FLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLP*******LSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLP***************************
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHS********SLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLG***AINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANP*******************************************ANQIN**
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPS*************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLFCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQFDLEIKTLSETKHVDLGYNSRYIEDLIDSDRVILGFKPCLNVGFPDGYHHTIATFKFFAERKFYKIKRCGLCPVYANPSETKDNTFTINFATEVWKLDDLPSASGTLDVEELELSPKRICRANQINTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query779 2.2.26 [Sep-21-2011]
Q9SZ671895 Probable WRKY transcripti no no 0.336 0.138 0.375 5e-43
Q9FH83 1288 Probable WRKY transcripti no no 0.442 0.267 0.284 3e-30
O235301301 Protein SUPPRESSOR OF npr no no 0.527 0.315 0.269 1e-27
Q9FL92 1372 Probable WRKY transcripti no no 0.346 0.196 0.281 9e-24
O825001095 Putative disease resistan no no 0.320 0.228 0.281 8e-23
Q403921144 TMV resistance protein N N/A no 0.573 0.390 0.259 6e-21
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.367 0.177 0.256 2e-18
P70587 1490 Leucine-rich repeat-conta yes no 0.387 0.202 0.279 6e-15
Q80TE7 1490 Leucine-rich repeat-conta yes no 0.387 0.202 0.279 6e-15
Q96NW7 1537 Leucine-rich repeat-conta yes no 0.378 0.191 0.289 9e-15
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 161/325 (49%), Gaps = 63/325 (19%)

Query: 14   LFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEE 73
            +F    GT AIEGIFLD+  +K  + +P  F  M NLRL K Y  K  E           
Sbjct: 1143 VFINDTGTSAIEGIFLDMLNLK-FDANPNVFEKMCNLRLLKLYCSKAEEKHG-------- 1193

Query: 74   QLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEK 133
                  V  P GL+YLP KLR LHW+ YPL +LP +F P+NLVELNL  S  ++ W+G+K
Sbjct: 1194 ------VSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKK 1247

Query: 134  A--CVP------------------------SSIQNFKYLSA------------------- 148
            A  C                          SS  N +++                     
Sbjct: 1248 ARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKL 1307

Query: 149  --LSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSS 206
              L+ KGC  L + PS +       +N S C  L  FP+IS  V  LY+G + I+E+PSS
Sbjct: 1308 VFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSS 1367

Query: 207  IECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYS 266
            I+ L  LE LDL   + LK + TS  KL+ L TL L GC++LE FP+   +M+ L+ +  
Sbjct: 1368 IKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDL 1427

Query: 267  DRTPITELPSSFENLPGL-EVLFVE 290
             RT I ELPSS   L  L E+LFV+
Sbjct: 1428 SRTDIKELPSSISYLTALDELLFVD 1452




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
255544956 1403 leucine-rich repeat containing protein, 0.860 0.477 0.297 4e-71
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.768 0.417 0.316 5e-69
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.767 0.406 0.314 1e-68
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.783 0.390 0.308 5e-68
359486075 1291 PREDICTED: TMV resistance protein N-like 0.780 0.470 0.305 4e-67
255563202 1158 leucine-rich repeat containing protein, 0.473 0.318 0.384 9e-67
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.780 0.429 0.305 1e-66
359486073 1296 PREDICTED: TMV resistance protein N-like 0.789 0.474 0.290 1e-65
224089412679 predicted protein [Populus trichocarpa] 0.799 0.917 0.299 1e-63
451798990 1335 TMV resistance protein N-like protein 7 0.827 0.483 0.297 2e-63
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  276 bits (705), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 248/834 (29%), Positives = 380/834 (45%), Gaps = 164/834 (19%)

Query: 19   KGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYS 78
            +GT A EGIFLD+SKI+ ++L   AF+ M NLRL KFY   F   +      +E  L   
Sbjct: 532  RGTFATEGIFLDISKIEKVDLSSVAFSKMWNLRLLKFYHNSFLSWKNPTGFVSESTLDSR 591

Query: 79   KVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKAC--- 135
                 +GL  LP KL +LHW  YP  +LPSNF  +NLVELN+  S+V++ W G K     
Sbjct: 592  -----DGLQSLPNKLCFLHWHGYPWESLPSNFSMENLVELNMPFSQVKELWTGVKHLQKL 646

Query: 136  ------------------------------------VPSSIQNFKYLSALSFKGCQSLRS 159
                                                +PSSIQ  + L  LS   C+ L+S
Sbjct: 647  KLLDLHDSELLVTLPDLSSASNLEKIILNNCTSLLEIPSSIQCLRKLVCLSLSNCKELQS 706

Query: 160  FPSNLHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLR 219
             PS +      T+N S C NL +FP+ISG++  L+L  + +EE PSS++ L  L +L L 
Sbjct: 707  LPSLIPLKYLKTLNLSSCSNLKKFPEISGEIEELHLDGTGLEEWPSSVQYLDKLRLLSLD 766

Query: 220  GCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFE 279
             C+ LK +  S   L SL  L L  C +L++FP+++  +++L       T I ELPSS  
Sbjct: 767  HCEDLKSLPGSI-HLNSLDNLDLSWCSSLKNFPDVVGNIKYLN---VGHTAIEELPSSIG 822

Query: 280  NLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHC 339
            +L  L  L ++D +++  LP +IG+L  L  +    S+I +LPSS+   + L  L+ +  
Sbjct: 823  SLVSLTKLNLKD-TEIKELPSSIGNLSSLVELNLKESSIKELPSSIGCLSSLVKLNIA-V 880

Query: 340  KGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQM 399
              +E  P + L  LS++   ++    +  +P  I  L+SL  L L+    + LP  I  +
Sbjct: 881  VDIEELPSS-LGQLSSLVEFNLEKSTLTALPSSIGCLTSLVKLNLAVTEIKELPPSIGCL 939

Query: 400  SQLRFIHLEDFNMLQSLP----ELPLCLKYLHLIDCKMLQSLPVLPFCLESLD---LTGC 452
            S L  ++L    ML SLP    EL  CL+ L+L   + L+S+P     L+ L    L  C
Sbjct: 940  SSLVELNLSQCPMLGSLPFSIGELK-CLEKLYLCGLRRLRSIPSSIRELKRLQDVYLNHC 998

Query: 453  NMLRSLPELPLC------------------------------------------------ 464
              L  LP L  C                                                
Sbjct: 999  TKLSKLPSLSGCSSLRDLVLSYSGIVKVPGSLGYLSSLQVLLLKGNNFMRIPATIRQLSW 1058

Query: 465  LQYLNLEDCNMLRSLPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPD 524
            L+ L++  C  L++LPELP  +++L   NC  L+++   L+  QE          + SPD
Sbjct: 1059 LEVLDISYCKRLKALPELPQRIRVLVAHNCTSLKTVSSPLIQFQESQ--------EQSPD 1110

Query: 525  LQWAPESLKSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRL--GYEMAINEK 582
             ++           F F NC+ L   A + I+  +LL+ +H+A A L L   YE      
Sbjct: 1111 DKYG----------FTFANCVSLEKNARSNIVESALLKTQHLATAVLELLTSYEEI---- 1156

Query: 583  LSELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDC 642
               L   ++  PGSEIP+ F  Q++G+S+   LP       L+GF FCAV++ +      
Sbjct: 1157 ---LVSPVVCFPGSEIPECFRYQNTGASVTTLLPSKWHNNKLVGFTFCAVIELEN----- 1208

Query: 643  FRYFYVSFQFDLEIKTLSETKHVD-LGYNSRYIEDL-----IDSDRVILGFKPCLNVGFP 696
             R++   F F  + +   E ++ D L + S+ I +       ++D V L    C+ +   
Sbjct: 1209 -RHYQDGFTFQCDCRI--ENEYGDSLEFTSKEIGEWGNQFEFETDHVFLWNTSCIYILTE 1265

Query: 697  DGYHH-----TIATFKF--FAERKF---------YKIKRCGLCPVYANPSETKD 734
            + Y         A F+F  + E ++         +K+K  G  PVYA   +  D
Sbjct: 1266 ERYEQLRKNSCTAIFEFACYTEDEYKVMLPGANSFKVKNSGFNPVYAKDEKEWD 1319




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224089412|ref|XP_002335049.1| predicted protein [Populus trichocarpa] gi|222832778|gb|EEE71255.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.732 0.441 0.285 5.4e-39
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.508 0.324 0.313 1e-36
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.530 0.347 0.302 2.7e-36
TAIR|locus:20818101226 AT3G51570 [Arabidopsis thalian 0.338 0.215 0.336 2.4e-30
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.341 0.228 0.337 1.3e-29
TAIR|locus:21181161895 WRKY19 [Arabidopsis thaliana ( 0.332 0.136 0.351 1.1e-27
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.564 0.222 0.279 4.5e-27
TAIR|locus:21158701234 AT4G08450 [Arabidopsis thalian 0.485 0.306 0.284 3.8e-26
TAIR|locus:21530721229 AT5G51630 [Arabidopsis thalian 0.536 0.340 0.264 1.5e-25
TAIR|locus:21514911123 AT5G46450 [Arabidopsis thalian 0.460 0.319 0.259 2.7e-25
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 449 (163.1 bits), Expect = 5.4e-39, P = 5.4e-39
 Identities = 184/644 (28%), Positives = 284/644 (44%)

Query:    20 GTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSK 79
             GT  +EGI L+LS+I  +    RAF  +SNL+L  FY            +S + +   ++
Sbjct:   523 GTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFY-----------DLSFDGE---TR 568

Query:    80 VQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSS 139
             V LPNGL YLP+KLRYL WD YPL+T+PS F P+ LVEL +  S +E+ W+G        
Sbjct:   569 VHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDG-------- 620

Query:   140 IQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEF-PQISGK--VTRLYLG 196
             IQ  + L  +    C+ L   P          +N SYC +L+E  P I     ++  YL 
Sbjct:   621 IQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLT 680

Query:   197 QSA-IEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEIL 255
                 ++++P  I  L  LE + + GC  LK         R L     L    +E  P  +
Sbjct:   681 NCIQLKDIPIGI-ILKSLETVGMSGCSSLKHFPEISWNTRRLY----LSSTKIEELPSSI 735

Query:   256 EKMEHLKRI-YSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGXXXXXXXXXXX 314
              ++  L ++  SD   +  LPS   +L  L+ L ++ C +L+NLPD +            
Sbjct:   736 SRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVS 795

Query:   315 XXXXXXXXXXVALS-NMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYA-VREIPQE 372
                       V+ S  +LR  ++S    +E  P   +  LS +  L IS+   +  +P  
Sbjct:   796 GCLNVNEFPRVSTSIEVLRISETS----IEEIPAR-ICNLSQLRSLDISENKRLASLPVS 850

Query:   373 IAYLSSLEILYLSGNN-FESLPAIIKQ-MSQLRFIHLEDFNMLQSLPELPLCLKYLHLID 430
             I+ L SLE L LSG +  ES P  I Q MS LR+  L D   ++ LPE    L  L ++ 
Sbjct:   851 ISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDL-DRTSIKELPENIGNLVALEVLQ 909

Query:   431 CK--MLQSLPVLPFCLESLDL--------TGCNMLRSL-PELPLC--LQYLNLEDCNMXX 477
                 +++  P     L  L +        T   +L SL P L     L+ L+L + NM  
Sbjct:   910 ASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTE 969

Query:   478 XXXXXXXXXXXXTVR-NCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAA 536
                          +  + N  + +P  +  L  L+   L    +    LQ  P+ L    
Sbjct:   970 IPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQR----LQALPDELPRGL 1025

Query:   537 ICFEFTNCLKL---NGKANN----KILADSLLRIRHMAIASLRLGYEMAINEKLSELRGS 589
             +     +C  L   +G  N     K++A +  ++   A   +        N KL   +  
Sbjct:  1026 LYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIHR------NLKLESAKPE 1079

Query:   590 LIVLPGSEIPDWFSNQSSGSSICIQLPPHSSCRNLIGFAFCAVL 633
                 PGS+IP  F++Q  G S+ IQLP   S  +++GF+ C ++
Sbjct:  1080 HSYFPGSDIPTCFNHQVMGPSLNIQLPQSESSSDILGFSACIMI 1123


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00190624
tir-nbs-lrr resistance protein (1436 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-41
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-09
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-07
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam0772520 pfam07725, LRR_3, Leucine Rich Repeat 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  161 bits (410), Expect = 7e-41
 Identities = 171/665 (25%), Positives = 266/665 (40%), Gaps = 203/665 (30%)

Query: 19   KGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYS 78
             GT  + GI LD+ +I  +++   AF  M NL   KFY  K+            +Q    
Sbjct: 529  TGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW------------DQKKEV 576

Query: 79   KVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPS 138
            +  LP G DYLP KLR L WD YPLR +PSNF+P+NLV+L ++ SK+E+ W+G       
Sbjct: 577  RWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDG------- 629

Query: 139  SIQNFKYLSALSFKGCQSLRSFP-----SNLHFVCPVTINFSYCVNLIEFPQISGKVTRL 193
             + +   L  +  +G ++L+  P     +NL      T+  S C +L+E           
Sbjct: 630  -VHSLTGLRNIDLRGSKNLKEIPDLSMATNLE-----TLKLSDCSSLVE----------- 672

Query: 194  YLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPE 253
                     +PSSI+ L  LE LD+  C+ L+ + T    L+SL  L L GC  L+ FP 
Sbjct: 673  ---------LPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFP- 721

Query: 254  ILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILA 313
                                                       ++  NI  L  L     
Sbjct: 722  -------------------------------------------DISTNISWL-DLD---- 733

Query: 314  AASAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEI 373
              +AI + PS++ L N+                    L L  M    + +      P   
Sbjct: 734  -ETAIEEFPSNLRLENL------------------DELILCEMKSEKLWERVQPLTPLMT 774

Query: 374  AYLSSLEILYLSGN-NFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCK 432
                SL  L+LS   +   LP+ I+ + +L                     ++L + +C 
Sbjct: 775  MLSPSLTRLFLSDIPSLVELPSSIQNLHKL---------------------EHLEIENCI 813

Query: 433  MLQSLPV---LPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRSLPELPLC---- 485
             L++LP    L   LESLDL+GC+ LR+ P++   +  LNL        + E+P      
Sbjct: 814  NLETLPTGINLES-LESLDLSGCSRLRTFPDISTNISDLNLSRT----GIEEVPWWIEKF 868

Query: 486  --LQLLTVRNCNRLQSL-PEI--LLCLQELDASVLEKLSKHS--------PDLQWAPESL 532
              L  L +  CN LQ +   I  L  L+ +D S    L++ S                S 
Sbjct: 869  SNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSK 928

Query: 533  KSAAICFEFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEMAINEKLSELRGSLIV 592
              + +C  F NC  L+ +A        LL+ + +                        ++
Sbjct: 929  LPSTVCINFINCFNLDQEA--------LLQQQSIFKQ---------------------LI 959

Query: 593  LPGSEIPDWFSNQSSGSS-ICIQLPPHSSCRNLIGFAFCAVLDSKKVDSDCFRYFYVSFQ 651
            L G E+P +F+++++G+S   I L   S C+    F  CAV     VDS+ F  F +S  
Sbjct: 960  LSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAV-----VDSESF--FIISVS 1012

Query: 652  FDLEI 656
            FD+++
Sbjct: 1013 FDIQV 1017


syringae 6; Provisional. Length = 1153

>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 779
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
KOG4237498 consensus Extracellular matrix protein slit, conta 99.72
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
KOG4237498 consensus Extracellular matrix protein slit, conta 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
PRK15386426 type III secretion protein GogB; Provisional 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.76
PRK15386426 type III secretion protein GogB; Provisional 98.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.64
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.5
PLN03150623 hypothetical protein; Provisional 98.43
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.42
PLN03150623 hypothetical protein; Provisional 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.89
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.61
KOG4341483 consensus F-box protein containing LRR [General fu 97.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.49
KOG4341483 consensus F-box protein containing LRR [General fu 97.45
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.82
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.2
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.96
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 94.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.15
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.62
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.61
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.63
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.57
KOG4308478 consensus LRR-containing protein [Function unknown 84.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.2
smart0037026 LRR Leucine-rich repeats, outliers. 84.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.78
KOG4308478 consensus LRR-containing protein [Function unknown 80.57
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=1.9e-52  Score=512.65  Aligned_cols=571  Identities=29%  Similarity=0.467  Sum_probs=388.6

Q ss_pred             eeecchhhHHHhhcCcccccEEEEEeecccccccccChhhhhcccCCceEeeccCcccccccCCCCccccccccceeecC
Q 004022            4 FCFRLTHSLFLFFFYKGTDAIEGIFLDLSKIKGINLDPRAFTNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLP   83 (779)
Q Consensus         4 ~c~~~~~i~~vL~~~~g~~~i~~i~Ld~s~~~~~~l~~~~f~~l~~Lr~L~l~~n~l~~i~~l~~l~~~~~~~~~~~~l~   83 (779)
                      +-|+++||++||++++|+++|++|++|++......+.+++|.+|++|++|.++.+.+.            ........+|
T Consensus       514 ~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~------------~~~~~~~~lp  581 (1153)
T PLN03210        514 FLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWD------------QKKEVRWHLP  581 (1153)
T ss_pred             eEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEeccccc------------ccccceeecC
Confidence            5688999999999999999999999999999989999999999999999999877542            0112346789


Q ss_pred             CCCCCCCCCceEEEccCCCCCCCCCCCCCCCCcEEECCCCCCCCccCCCCcccCccccCCCCCcEEeccCCCCCCCCCCC
Q 004022           84 NGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSN  163 (779)
Q Consensus        84 ~~l~~l~~~L~~L~l~~n~l~~lp~~~~l~~L~~L~L~~n~i~~l~~g~~~~lp~~~~~l~~L~~L~Ls~n~~l~~~p~~  163 (779)
                      +++..+|.+||.|+|.+|+++.+|..|.+.+|++|+|++|+++.+|+|.+        .+++|+.|+|++|..++.+|.+
T Consensus       582 ~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~--------~l~~Lk~L~Ls~~~~l~~ip~l  653 (1153)
T PLN03210        582 EGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVH--------SLTGLRNIDLRGSKNLKEIPDL  653 (1153)
T ss_pred             cchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccc--------cCCCCCEEECCCCCCcCcCCcc
Confidence            99999999999999999999999999999999999999999999877754        8999999999999889999999


Q ss_pred             CCCCCCcEEEecCCcCccccCCcCCCccEEEecCcCCcccCcccCCCCCccEEeeeCCCCCcccccccCCCCCCcEEecc
Q 004022          164 LHFVCPVTINFSYCVNLIEFPQISGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILL  243 (779)
Q Consensus       164 ~~l~~L~~L~L~~~~~l~~~~~~~~~L~~L~L~~n~i~~lp~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~  243 (779)
                      ..+++|+.|++++|..+                    ..+|.+++++++|+.|++++|..++.+|..+ ++++|+.|+++
T Consensus       654 s~l~~Le~L~L~~c~~L--------------------~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Ls  712 (1153)
T PLN03210        654 SMATNLETLKLSDCSSL--------------------VELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLS  712 (1153)
T ss_pred             ccCCcccEEEecCCCCc--------------------cccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCC
Confidence            99999999999999877                    7788889999999999999999999999866 69999999999


Q ss_pred             cccCCcccchhhhcCccCcEeecCCcCCCcCCccCCCCCCCCEEeccCCCCCCCCCCCCCCchhHHHHHhhcccCCcCCc
Q 004022          244 GCLNLEHFPEILEKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPS  323 (779)
Q Consensus       244 ~~~~~~~~p~~l~~l~~L~~L~L~~n~i~~lp~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~~~~~~~~~~~lp~  323 (779)
                      +|..++.+|..   ..+|++|++++|.++.+|..+ .+++|+.|.+.++.... ++..+..+.               +.
T Consensus       713 gc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~-l~~~~~~l~---------------~~  772 (1153)
T PLN03210        713 GCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEK-LWERVQPLT---------------PL  772 (1153)
T ss_pred             CCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhh-ccccccccc---------------hh
Confidence            99988888864   468999999999999999865 58889999887754321 111111110               00


Q ss_pred             cccCccccCeeeccCCCCCCccChhhccCCCCCcEEEecCCC-CccCCcccCCCCCccEEEEecCC-CccCChhccCCCC
Q 004022          324 SVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYA-VREIPQEIAYLSSLEILYLSGNN-FESLPAIIKQMSQ  401 (779)
Q Consensus       324 ~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~Ls~~~-l~~~p~~l~~l~~L~~L~Ls~n~-l~~lp~~l~~l~~  401 (779)
                      .....++|+.|++++|.....+|.. +..+++|+.|++++|. +..+|..+ .+++|+.|++++|. +..+|..   .++
T Consensus       773 ~~~~~~sL~~L~Ls~n~~l~~lP~s-i~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~n  847 (1153)
T PLN03210        773 MTMLSPSLTRLFLSDIPSLVELPSS-IQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI---STN  847 (1153)
T ss_pred             hhhccccchheeCCCCCCccccChh-hhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc---ccc
Confidence            1112344555555555544444443 3455555555555553 33354443 45555555555542 3333321   234


Q ss_pred             CCEEEcCCCCCCCcCCC---CCCCccEEEEecCCCCCCCCCCCCCccEEEeeCCCCCCCCCCCCCCccEEeeecCcCCcc
Q 004022          402 LRFIHLEDFNMLQSLPE---LPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNLEDCNMLRS  478 (779)
Q Consensus       402 L~~L~Ls~n~~~~~~~~---~~~~L~~L~l~~c~~l~~lp~l~~~L~~L~ls~n~~l~~l~~~~~~L~~L~l~~c~~L~~  478 (779)
                      |+.|++++|.+. .+|.   .+++|+.|++++|+.++.+|....+                  +++|+.|++++|..|..
T Consensus       848 L~~L~Ls~n~i~-~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~------------------L~~L~~L~l~~C~~L~~  908 (1153)
T PLN03210        848 ISDLNLSRTGIE-EVPWWIEKFSNLSFLDMNGCNNLQRVSLNISK------------------LKHLETVDFSDCGALTE  908 (1153)
T ss_pred             cCEeECCCCCCc-cChHHHhcCCCCCEEECCCCCCcCccCccccc------------------ccCCCeeecCCCccccc
Confidence            444444444332 1221   1122222444444444443321100                  13455555555555543


Q ss_pred             cCCCCCCccEEEEecCCCCCCccccccCCcccchhhhhhhccCCCCCcccccccccccceeecccccccCcccchhhhHH
Q 004022          479 LPELPLCLQLLTVRNCNRLQSLPEILLCLQELDASVLEKLSKHSPDLQWAPESLKSAAICFEFTNCLKLNGKANNKILAD  558 (779)
Q Consensus       479 l~~~~~sL~~L~i~~C~~L~~lp~~l~~L~~L~~~~~~~l~~~~p~l~~lp~~l~~~l~~l~~~~C~~l~~~~~~~i~~~  558 (779)
                      ++-.........+.+                     +  ...      .    + ++...+.|.+|.++++.++.     
T Consensus       909 ~~l~~~~~~~~~~~~---------------------n--~~~------~----~-p~~~~l~f~nC~~L~~~a~l-----  949 (1153)
T PLN03210        909 ASWNGSPSEVAMATD---------------------N--IHS------K----L-PSTVCINFINCFNLDQEALL-----  949 (1153)
T ss_pred             ccCCCCchhhhhhcc---------------------c--ccc------c----C-CchhccccccccCCCchhhh-----
Confidence            321000000000000                     0  000      0    1 12345778999999976642     


Q ss_pred             HHHHHHHHHHHHHhhhhHHhhhhhcccccccEEEecCCCCCccccccCCCceEE-EECCCCCCCCCcceeEEEEEEccCC
Q 004022          559 SLLRIRHMAIASLRLGYEMAINEKLSELRGSLIVLPGSEIPDWFSNQSSGSSIC-IQLPPHSSCRNLIGFAFCAVLDSKK  637 (779)
Q Consensus       559 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~si~-~~lp~~~~~~~~~gf~~c~v~~~~~  637 (779)
                         +.                  +   .....+++||.+||+||.||+.|++++ |++|+.|....|.||++|+|+++..
T Consensus       950 ---~~------------------~---~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~ 1005 (1153)
T PLN03210        950 ---QQ------------------Q---SIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSES 1005 (1153)
T ss_pred             ---cc------------------c---ccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCc
Confidence               10                  0   011238899999999999999999999 9999999988999999999998776


Q ss_pred             CCCCc-ceeeEeeEEEecccccc---CCCCeeEEecccccccccccccceEEceeecc-----ccCC-CCCceeEEEEEE
Q 004022          638 VDSDC-FRYFYVSFQFDLEIKTL---SETKHVDLGYNSRYIEDLIDSDRVILGFKPCL-----NVGF-PDGYHHTIATFK  707 (779)
Q Consensus       638 ~~~~~-~~~~~~~~~~~~~~~~~---~~~dh~~~~~~~~~~~~~~~s~~~~~~~~~~~-----~~~~-~~~~~~~~~~f~  707 (779)
                      ..... ...+.+.|.|....+..   ...+|+|+.|...        .|.+ .|+-+.     +... ...|+|+.+.|+
T Consensus      1006 ~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~--------~~l~-~~~~~~~~~~~~~~~~~~~~~~~~~~f~ 1076 (1153)
T PLN03210       1006 FFIISVSFDIQVCCRFIDRLGNHFDSPYQPHVFSVTKKG--------SHLV-IFDCCFPLNEDNAPLAELNYDHVDIQFR 1076 (1153)
T ss_pred             cccCCCceeEEEEEEEECCCCCccccCCCceeEeeeccc--------cceE-EecccccccccccchhccCCceeeEEEE
Confidence            43221 12566778887776542   3478888887542        1211 111111     1101 125888889998


Q ss_pred             EccccceeEEEeeeeeeeecCCCC
Q 004022          708 FFAERKFYKIKRCGLCPVYANPSE  731 (779)
Q Consensus       708 f~~~~~~~~vk~CGv~lvy~~~~~  731 (779)
                      |......++||+||||++|.++..
T Consensus      1077 ~~~~~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1077 LTNKNSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             EecCCCCeEEEeeeEEEeccCCCc
Confidence            877655579999999999966543



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 9e-09
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 2e-06
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-06
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 1e-04
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 45/104 (43%), Positives = 56/104 (53%), Gaps = 4/104 (3%) Query: 411 NMLQSLPELPLCLKYLHLIDCKMLQSLPVLPFCLESLDLTGCNMLRSLPELPLCLQYLNL 470 N L SLPELP L+YL D + L +LP LP L+ LD+ N L LPELP L+Y+N Sbjct: 90 NALISLPELPASLEYLDACDNR-LSTLPELPASLKHLDVDN-NQLTXLPELPALLEYINA 147 Query: 471 EDCNMXXXXXXXXXXXXXXTVRNCNRLQSLPEILLCLQELDASV 514 D N +VRN N+L LPE+ L+ LD S Sbjct: 148 -DNNQLTXLPELPTSLEVLSVRN-NQLTFLPELPESLEALDVST 189
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  155 bits (394), Expect = 4e-42
 Identities = 70/359 (19%), Positives = 120/359 (33%), Gaps = 58/359 (16%)

Query: 139 SIQNFKYLSALSFKGCQSLRSFPSNLH-FVCPVTINFSYCVNLIEFPQISGKVTRLYLGQ 197
              +      L F+G  +LR +   L  +      + +   +       +          
Sbjct: 7   HHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN-NPQIETRTG 65

Query: 198 SAIEEVPSSIECLTD--LEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEIL 255
            A++     +E  T      L+LR    L +      +L  L  + +     L   P+ +
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAA-GLMELPDTM 123

Query: 256 EKMEHLKRIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAA 315
           ++   L+ +   R P+  LP+S  +L  L  L +  C +L  LP+ + S +         
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDAS------- 176

Query: 316 SAISQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVREIPQEIAY 375
                L +       L+SL                               +R +P  IA 
Sbjct: 177 GEHQGLVN-------LQSLRLEWTG-------------------------IRSLPASIAN 204

Query: 376 LSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPE----LPLCLKYLHLIDC 431
           L +L+ L +  +   +L   I  + +L  + L     L++ P         LK L L DC
Sbjct: 205 LQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA-PLKRLILKDC 263

Query: 432 KMLQSLPV----LPFCLESLDLTGCNMLRSLPELP---LCLQYLNLEDCNMLRSLPELP 483
             L +LP+    L   LE LDL GC  L  LP L         + +      +     P
Sbjct: 264 SNLLTLPLDIHRLT-QLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQHRP 321


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.52
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.99
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.72
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.54
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.51
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.45
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.23
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.73
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.26
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.57
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-43  Score=422.38  Aligned_cols=455  Identities=18%  Similarity=0.200  Sum_probs=316.9

Q ss_pred             CCceEEEccCCCCCCCCCCC-CCCCCcEEECCCCCCCCccCCCCcccCccccCCCCCcEEeccCCCCCCCCCCCCCCCCC
Q 004022           91 KKLRYLHWDTYPLRTLPSNF-KPKNLVELNLRCSKVEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCP  169 (779)
Q Consensus        91 ~~L~~L~l~~n~l~~lp~~~-~l~~L~~L~L~~n~i~~l~~g~~~~lp~~~~~l~~L~~L~Ls~n~~l~~~p~~~~l~~L  169 (779)
                      .+|++|++++|.+...+..+ .+++|++|+|++|.++..       +|.+++++++|++|++++|.+.+.+|.. .+++|
T Consensus       200 ~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~-------~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L  271 (768)
T 3rgz_A          200 VNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGD-------FSRAISTCTELKLLNISSNQFVGPIPPL-PLKSL  271 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSC-------HHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTC
T ss_pred             CcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCc-------ccHHHhcCCCCCEEECCCCcccCccCcc-ccCCC
Confidence            47777777777776533335 677777777777777643       6777778888888888888766666655 77788


Q ss_pred             cEEEecCCcCccccCCcC----CCccEEEecCcCCc-ccCcccCCCCCccEEeeeCCCCCcccccc-cCCCCCCcEEecc
Q 004022          170 VTINFSYCVNLIEFPQIS----GKVTRLYLGQSAIE-EVPSSIECLTDLEVLDLRGCKRLKRISTS-FCKLRSLVTLILL  243 (779)
Q Consensus       170 ~~L~L~~~~~l~~~~~~~----~~L~~L~L~~n~i~-~lp~~l~~l~~L~~L~L~~~~~~~~lp~~-l~~l~~L~~L~L~  243 (779)
                      ++|++++|...+.+|..+    .+|+.|++++|.+. .+|..++++++|++|++++|.+.+.+|.. +..+++|++|+++
T Consensus       272 ~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls  351 (768)
T 3rgz_A          272 QYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS  351 (768)
T ss_dssp             CEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECC
T ss_pred             CEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCc
Confidence            888888887766666554    56788888888875 66777888888888888888777677765 7778888888888


Q ss_pred             cccCCcccchhhhcCc-cCcEeecCCcCCC-cCCccCCC--CCCCCEEeccCCCCCCCCCCCCCCchhHHH-HHhhcccC
Q 004022          244 GCLNLEHFPEILEKME-HLKRIYSDRTPIT-ELPSSFEN--LPGLEVLFVEDCSKLDNLPDNIGSLEYLYY-ILAAASAI  318 (779)
Q Consensus       244 ~~~~~~~~p~~l~~l~-~L~~L~L~~n~i~-~lp~~l~~--l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~-~~~~~~~~  318 (779)
                      +|.+.+.+|..+..++ +|++|++++|.++ .+|..+..  +++|+.|++++|.+.+.+|..+..+++|+. .+.+|...
T Consensus       352 ~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~  431 (768)
T 3rgz_A          352 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS  431 (768)
T ss_dssp             SSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEE
T ss_pred             CCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCccc
Confidence            8877777777777776 7777777777766 44555544  667777777777777777777777777777 55555555


Q ss_pred             CcCCccccCccccCeeeccCCCCCCccChhhccCCCCCcEEEecCCCCcc-CCcccCCCCCccEEEEecCCCc-cCChhc
Q 004022          319 SQLPSSVALSNMLRSLDSSHCKGLESFPRTFLLGLSAMGLLHISDYAVRE-IPQEIAYLSSLEILYLSGNNFE-SLPAII  396 (779)
Q Consensus       319 ~~lp~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~Ls~~~l~~-~p~~l~~l~~L~~L~Ls~n~l~-~lp~~l  396 (779)
                      +.+|..+..+++|+.|++++|.+.+..|.. +..+++|+.|++++|.+++ +|..+..+++|++|+|++|+++ .+|.++
T Consensus       432 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~-~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          432 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQE-LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGG-GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             CcccHHHhcCCCCCEEECCCCcccCcCCHH-HcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH
Confidence            567777777777777777777777666554 4567777777777777775 6777777777777777777777 667777


Q ss_pred             cCCCCCCEEEcCCCCCCCcCCCC---CCCccEEEEecCCCCCCCCC----------------------------------
Q 004022          397 KQMSQLRFIHLEDFNMLQSLPEL---PLCLKYLHLIDCKMLQSLPV----------------------------------  439 (779)
Q Consensus       397 ~~l~~L~~L~Ls~n~~~~~~~~~---~~~L~~L~l~~c~~l~~lp~----------------------------------  439 (779)
                      +.+++|+.|++++|++.+.+|..   .++|+.|++++|+....+|.                                  
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGA  590 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSS
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccc
Confidence            77777777777777777777653   36677777777754333321                                  


Q ss_pred             -------------------------------------C--CCCccEEEeeCCCCCCCCCCC---CCCccEEeeecCcCCc
Q 004022          440 -------------------------------------L--PFCLESLDLTGCNMLRSLPEL---PLCLQYLNLEDCNMLR  477 (779)
Q Consensus       440 -------------------------------------l--~~~L~~L~ls~n~~l~~l~~~---~~~L~~L~l~~c~~L~  477 (779)
                                                           +  ..+|+.|++++|++.+.+|..   +++|+.|++++|.-..
T Consensus       591 ~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g  670 (768)
T 3rgz_A          591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG  670 (768)
T ss_dssp             EEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             ccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC
Confidence                                                 0  026889999999999999864   4789999999988777


Q ss_pred             ccCCC---CCCccEEEEecCCCCCCccccc---cCCcccchhhhhhhccCCCCCc---ccccc-cccc--cceeeccccc
Q 004022          478 SLPEL---PLCLQLLTVRNCNRLQSLPEIL---LCLQELDASVLEKLSKHSPDLQ---WAPES-LKSA--AICFEFTNCL  545 (779)
Q Consensus       478 ~l~~~---~~sL~~L~i~~C~~L~~lp~~l---~~L~~L~~~~~~~l~~~~p~l~---~lp~~-l~~~--l~~l~~~~C~  545 (779)
                      .+|..   +++|+.|++++|.-...+|..+   ..|+.|++++| ++++..|...   .++.. +..+  +--.-+..|.
T Consensus       671 ~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N-~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~  749 (768)
T 3rgz_A          671 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN-NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCD  749 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSS-EEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCC
T ss_pred             CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCC-cccccCCCchhhccCCHHHhcCCchhcCCCCcCCC
Confidence            88853   5789999999977666888765   46778888887 5666666542   22211 1111  0001123677


Q ss_pred             ccCcccchhh
Q 004022          546 KLNGKANNKI  555 (779)
Q Consensus       546 ~l~~~~~~~i  555 (779)
                      .-..+.|.+|
T Consensus       750 ~~~~~~~~~~  759 (768)
T 3rgz_A          750 PSNADGYAHH  759 (768)
T ss_dssp             SCC-------
T ss_pred             CCccCCCCCC
Confidence            7666777655



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 779
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 57.5 bits (137), Expect = 2e-09
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 375 YLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLPELPLCLKYLHLIDCKML 434
              SLE L +S N    LPA+  ++ +L       FN L  +PELP  LK LH+     L
Sbjct: 282 LPPSLEELNVSNNKLIELPALPPRLERLIA----SFNHLAEVPELPQNLKQLHVEYNP-L 336

Query: 435 QSLPVLPFCLESLDL 449
           +  P +P  +E L +
Sbjct: 337 REFPDIPESVEDLRM 351


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.36
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.21
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.18
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.57
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.28
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.91  E-value=1.4e-23  Score=226.59  Aligned_cols=320  Identities=15%  Similarity=0.168  Sum_probs=199.4

Q ss_pred             hcccCCceEeeccCcccccccCCCCccccccccceeecCCCCCCCCCCceEEEccCCCCCCCCCCCCCCCCcEEECCCCC
Q 004022           45 TNMSNLRLFKFYVPKFYEIEKLPSMSTEEQLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVELNLRCSK  124 (779)
Q Consensus        45 ~~l~~Lr~L~l~~n~l~~i~~l~~l~~~~~~~~~~~~l~~~l~~l~~~L~~L~l~~n~l~~lp~~~~l~~L~~L~L~~n~  124 (779)
                      +.+.+|+.|+++++.|+                   .+ +++..+ ++|++|++++|+++.+|..-++++|++|++++|+
T Consensus        41 ~~l~~l~~L~l~~~~I~-------------------~l-~gl~~L-~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~   99 (384)
T d2omza2          41 TDLDQVTTLQADRLGIK-------------------SI-DGVEYL-NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQ   99 (384)
T ss_dssp             HHHTTCCEEECCSSCCC-------------------CC-TTGGGC-TTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSC
T ss_pred             HHhCCCCEEECCCCCCC-------------------Cc-cccccC-CCCCEEeCcCCcCCCCccccCCcccccccccccc
Confidence            45778999999999884                   33 356677 5999999999999999874489999999999999


Q ss_pred             CCCccCCCCcccCccccCCCCCcEEeccCCCCCCCCCCCCCCCCCcEEEecCCcCccccCCc------------------
Q 004022          125 VEQPWEGEKACVPSSIQNFKYLSALSFKGCQSLRSFPSNLHFVCPVTINFSYCVNLIEFPQI------------------  186 (779)
Q Consensus       125 i~~l~~g~~~~lp~~~~~l~~L~~L~Ls~n~~l~~~p~~~~l~~L~~L~L~~~~~l~~~~~~------------------  186 (779)
                      |+.+        + .++++++|+.|+++++.. ..++.......+..+....+......+..                  
T Consensus       100 i~~i--------~-~l~~l~~L~~L~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  169 (384)
T d2omza2         100 IADI--------T-PLANLTNLTGLTLFNNQI-TDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLK  169 (384)
T ss_dssp             CCCC--------G-GGTTCTTCCEEECCSSCC-CCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCG
T ss_pred             cccc--------c-cccccccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccchhh
Confidence            9873        2 377999999999998874 44444444555555555443321111100                  


Q ss_pred             ----CCCccEEEecCcCCcccCcccCCCCCccEEeeeCCCCCcccccccCCCCCCcEEecccccCCcccchhhhcCccCc
Q 004022          187 ----SGKVTRLYLGQSAIEEVPSSIECLTDLEVLDLRGCKRLKRISTSFCKLRSLVTLILLGCLNLEHFPEILEKMEHLK  262 (779)
Q Consensus       187 ----~~~L~~L~L~~n~i~~lp~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~  262 (779)
                          ...........+. .........+++++.+++++|.+.+..|  ....++|++|++++|.+.. + ..+..+++|+
T Consensus       170 ~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~-~-~~l~~l~~L~  244 (384)
T d2omza2         170 PLANLTTLERLDISSNK-VSDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKD-I-GTLASLTNLT  244 (384)
T ss_dssp             GGTTCTTCCEEECCSSC-CCCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCC-C-GGGGGCTTCS
T ss_pred             hhccccccccccccccc-cccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCC-c-chhhcccccc
Confidence                0011112222222 2223345667788888888877555433  4556788888888876544 2 3567778888


Q ss_pred             EeecCCcCCCcCCccCCCCCCCCEEeccCCCCCCCCCCCCCCchhHHHHHhhcccCCcCCccccCccccCeeeccCCCCC
Q 004022          263 RIYSDRTPITELPSSFENLPGLEVLFVEDCSKLDNLPDNIGSLEYLYYILAAASAISQLPSSVALSNMLRSLDSSHCKGL  342 (779)
Q Consensus       263 ~L~L~~n~i~~lp~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~~~~~~~~~~~lp~~l~~l~~L~~L~l~~n~~~  342 (779)
                      .|++++|.++.++. ++.+++|+.|+++++.+.+..                         .+..++.++.+.+..|.+.
T Consensus       245 ~L~l~~n~l~~~~~-~~~~~~L~~L~l~~~~l~~~~-------------------------~~~~~~~l~~l~~~~n~l~  298 (384)
T d2omza2         245 DLDLANNQISNLAP-LSGLTKLTELKLGANQISNIS-------------------------PLAGLTALTNLELNENQLE  298 (384)
T ss_dssp             EEECCSSCCCCCGG-GTTCTTCSEEECCSSCCCCCG-------------------------GGTTCTTCSEEECCSSCCS
T ss_pred             hhccccCccCCCCc-ccccccCCEeeccCcccCCCC-------------------------ccccccccccccccccccc
Confidence            88888888877764 677788888888776654321                         1334455555555555554


Q ss_pred             CccChhhccCCCCCcEEEecCCCCccCCcccCCCCCccEEEEecCCCccCChhccCCCCCCEEEcCCCCCCCcCC-CCCC
Q 004022          343 ESFPRTFLLGLSAMGLLHISDYAVREIPQEIAYLSSLEILYLSGNNFESLPAIIKQMSQLRFIHLEDFNMLQSLP-ELPL  421 (779)
Q Consensus       343 ~~~~~~~~~~l~~L~~L~Ls~~~l~~~p~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~Ls~n~~~~~~~-~~~~  421 (779)
                      +...   +..+++++.|++++|++++++. +..+++|++|++++|+++.++ .++.+++|++|++++|++.+..| ..++
T Consensus       299 ~~~~---~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~l~~l~  373 (384)
T d2omza2         299 DISP---ISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTPLANLT  373 (384)
T ss_dssp             CCGG---GGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGGGTTCT
T ss_pred             cccc---cchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChhhccCC
Confidence            4221   3355556666666666655432 455566666666666665554 35556666666666665544332 1235


Q ss_pred             CccEEEEecC
Q 004022          422 CLKYLHLIDC  431 (779)
Q Consensus       422 ~L~~L~l~~c  431 (779)
                      +|+.|+|++|
T Consensus       374 ~L~~L~L~~N  383 (384)
T d2omza2         374 RITQLGLNDQ  383 (384)
T ss_dssp             TCSEEECCCE
T ss_pred             CCCEeeCCCC
Confidence            5666666554



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure