Citrus Sinensis ID: 004055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770------
MGKSGGRRKKGGSNANQVAADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGASAVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSYKQDRPLMNVTAENGLENKTQFSKLALKPSNGRSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEADKSDSVGMLRLHIVDVSPEQEPPLLEEEEEKPLESEGTKGDESGSHSSLAESVVEAADTEIDKTDKDAAKEKPGSEDLSKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPSKRDELLKRRKKQGSGSDGDPSGTGEGEISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGDAVEGEEKKVQNQSTNKTIEPDENNEANQISNN
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccHHHccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHcccccccccEEccHHHHHHHHHHHHHccccccccccccccccEEEEEEEccccccccccHHHHccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccc
cccccccEccccccccccccccccccHcEcccccccHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccEccccccccccccccccccccccccccccEccccccccccccccccccHcccccccEEEEcccccEEEEEcccEEEEEEccccEEEEccccccHHHHHHHHHHHcccccEEEEEEEcccccEEEEccHHHHHHHHHHHHcccccccccccccccccEEEEEEEEccccccccccHHccccccccccccccccccccccccEEEEccccHHHccccccccccccccccccEEHHHHHHHHHHHHHHHccccccHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHcccccEEccccccccccccccccHHHcccc
mgksggrrkkggsnanqvaadnsnanistnsnggvdldsSIFLKRAHELKEegnkrfqnkDYVGALEQYDnalrltpkthpdravfhSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTAlgprqeaqqdlqsrpspaalgasavrgapiaglgpclparpvgkkagapaggllvspsykqdrplmnvtaenglenktqfsklalkpsngrscgnpskdshreqslssavsldtrgqplevpvrwrplklvydhdirlgqmpvncSFKALREIVskrfpssksVLIKykdndgdlvTITCTAELRLaesasdslmtkepeadksdsvgmLRLHivdvspeqepplleeeeekplesegtkgdesgshssLAESVVEAADTeidktdkdaakekpgsedlskeveMDDWLFEFAQLFRThvgidpdahiDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNwgnvhmcaarkripldesagKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIdlsgwdatetLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPSKRDELLKRrkkqgsgsdgdpsgtgegeisaDEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKlagasesdVSMVLKNHcsngdavegeekkvqnqstnktiepdenneanqisnn
mgksggrrkkggsnanqvaadnsnanistnsnggvdlDSSIFLKRAHELKeegnkrfqnkdYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQeaqqdlqsrpsPAALGASAVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSYKQDRPLMNVTAenglenktqfsklalkpsngrSCGNPSKDSHREQSlssavsldtrgqplevpvrwrpLKLVYDHDIRLGQMPVNCSFKALREIvskrfpssksvlikykdndgdlVTITCTAELRLaesasdslmtkepeadksdsvgMLRLHIVdvspeqepplleeeeekplesegtkgdesgshssLAESVVEAADTeidktdkdaakekpgsedlskevEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEqraieqkdpskrdellkrrkkqgsgsdgdpsgtgeGEISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSngdavegeekkvqnqstnktiepdenneanqisnn
MgksggrrkkggsNANQVAADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVrallrraraFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGASAVRGAPIAGLGPCLPARpvgkkagapaggllvSPSYKQDRPLMNVTAENGLENKTQFSKLALKPSNGRSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEADKSDSVGMLRLHIVDVSpeqepplleeeeekpleseGTKGDESGSHSSLAESVVEAADTEIDKTDKDAAKEKPGSEDLSKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPSKRDELLKRRKKQgsgsdgdpsgtgegeISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGDAVEGEEKKVQNQSTNKTIEPDENNEANQISNN
***********************************************************KDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIA****************************************************************************************************************************LEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRL**************************************************************************************************MDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLF*******************************************************************VMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGA*************************************************
************************************************LKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIAR**********************************************************************************************************************************RPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAES*********************RLHIVDVSPE***********************************************************SKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAA****************AQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLS*WD*TETL*LFDSA*E**KT***MW******************************************************MRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGD********************************
***************NQVAADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALG****************ALGASAVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSYKQDRPLMNVTAENGLENKTQFSKLALKPS**********************SLDTRGQPLEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEADKSDSVGMLRLHIVDVSPEQ********************************VVEAADTEIDKT****************EVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPSKRDEL*******************************AAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGD**************NKTIEPDE**********
*************************NISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGASAVRGAPIAGLGPCL**********************************************************************SAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSL***********SVGMLRLHIVDVSPEQEPPLLE**************************VVE***********************SKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPSKRDELLKRRKKQ**************EISADEAA***AVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGD********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKSGGRRKKGGSNANQVAADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGASAVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSYKQDRPLMNVTAENGLENKTQFSKLALKPSNGRSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEADKSDSVGMLRLHIVDVSPEQEPPLLEEEEEKPLESEGTKGDESGSHSSLAESVVEAADTEIDKTDKDAAKEKPGSEDLSKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLxxxxxxxxxxxxxxxxxxxxxRAIEQKDPSKRDELLKRRKKQGSGSDGDPSGTGEGEISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRFKLAGASESDVSMVLKNHCSNGDAVEGEEKKVQNQSTNKTIEPDENNEANQISNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query776 2.2.26 [Sep-21-2011]
Q91Z38292 Tetratricopeptide repeat yes no 0.157 0.417 0.392 1e-16
Q3ZBR5292 Tetratricopeptide repeat yes no 0.157 0.417 0.376 2e-15
Q68F64 927 Protein unc-45 homolog B N/A no 0.167 0.140 0.368 3e-15
Q99614292 Tetratricopeptide repeat yes no 0.157 0.417 0.36 7e-15
D7REX8 927 Protein unc-45 homolog B yes no 0.167 0.140 0.368 4e-14
Q8CGY6 931 Protein unc-45 homolog B no no 0.170 0.141 0.355 9e-14
Q6DGE9 934 Protein unc-45 homolog B yes no 0.163 0.135 0.367 1e-13
Q8IWX7 931 Protein unc-45 homolog B no no 0.170 0.141 0.355 2e-13
Q15785309 Mitochondrial import rece no no 0.162 0.407 0.367 9e-13
A4K2V0309 Mitochondrial import rece no no 0.154 0.388 0.376 2e-12
>sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 3/125 (2%)

Query: 49  LKEEGNKRFQNKDYVGALEQYDNALRLTPKT-HPDRAVFHSNRAACLMQMKPINYETVIA 107
           LKEEGN+RF+  DY+ A   Y  AL++ P     DR+V  SNRAA   +MK    ET I 
Sbjct: 119 LKEEGNERFKRGDYMEAESSYSQALQMCPACFQKDRSVLFSNRAA--ARMKQDKKETAIT 176

Query: 108 ECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTAL 167
           +C+ A+Q+ P ++RA+LRRA  ++   K + A++D + +L  +P+   A E   RL   +
Sbjct: 177 DCSKAIQLNPTYIRAILRRAELYEKTDKLDEALEDYKSVLEKDPSVHQAREACMRLPKQI 236

Query: 168 GPRQE 172
             R E
Sbjct: 237 EERNE 241

Mus musculus (taxid: 10090)
>sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 Back     alignment and function description
>sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 Back     alignment and function description
>sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 Back     alignment and function description
>sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 Back     alignment and function description
>sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 Back     alignment and function description
>sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 Back     alignment and function description
>sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=2 SV=1 Back     alignment and function description
>sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 Back     alignment and function description
>sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
224116018789 predicted protein [Populus trichocarpa] 0.974 0.958 0.765 0.0
224118154785 predicted protein [Populus trichocarpa] 0.948 0.937 0.782 0.0
357480407810 hypothetical protein MTR_4g132780 [Medic 0.972 0.932 0.740 0.0
356562742776 PREDICTED: uncharacterized protein LOC10 0.988 0.988 0.773 0.0
255554751748 heat shock protein 70 (HSP70)-interactin 0.929 0.963 0.752 0.0
356522033769 PREDICTED: uncharacterized protein LOC10 0.979 0.988 0.754 0.0
449455373777 PREDICTED: uncharacterized protein LOC10 0.966 0.965 0.746 0.0
365222950761 Hop-interacting protein THI142 [Solanum 0.957 0.976 0.716 0.0
297837181755 octicosapeptide/Phox/Bem1p domain-contai 0.907 0.932 0.696 0.0
18407574751 octicosapeptide/Phox/Be.1 domain-contain 0.944 0.976 0.684 0.0
>gi|224116018|ref|XP_002317186.1| predicted protein [Populus trichocarpa] gi|222860251|gb|EEE97798.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1186 bits (3069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/777 (76%), Positives = 665/777 (85%), Gaps = 21/777 (2%)

Query: 10  KGGSNANQVAADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQY 69
           KGG+N N      +N+  + N+NGG+DL+S IFLKRAHELKEEGNKRFQNKD+ GAL+QY
Sbjct: 21  KGGNNGN------TNSVATPNANGGIDLNSLIFLKRAHELKEEGNKRFQNKDFAGALDQY 74

Query: 70  DNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARA 129
           DNALRL PKTHPDRAVFHSNRAACLMQMKPI+YETVI ECTMALQVQP+FVRALLRRARA
Sbjct: 75  DNALRLIPKTHPDRAVFHSNRAACLMQMKPIDYETVITECTMALQVQPQFVRALLRRARA 134

Query: 130 FDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGAS 189
           ++AIGKYEMAMQDVQVLLG +PNHRDAL+IARRLRTA GPRQEAQQDLQSRPSPAALGAS
Sbjct: 135 YEAIGKYEMAMQDVQVLLGADPNHRDALDIARRLRTAFGPRQEAQQDLQSRPSPAALGAS 194

Query: 190 AVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSYKQDRPLMNVTAENGLENKTQFSKL 249
           AVRGAPIAGLGPCLPARPV KKA AP+G  LVSP  K ++PLMN  +ENG E K Q  KL
Sbjct: 195 AVRGAPIAGLGPCLPARPVSKKAAAPSGVSLVSPINKMEKPLMNSVSENGPETKNQLPKL 254

Query: 250 ALKPSNG--RSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQM 307
            LKPS+G  ++  NP KD   + SLSS+VSL    Q  EVPVR RPLKLVYDHDIRL QM
Sbjct: 255 VLKPSSGSSKASANPGKDRQGKGSLSSSVSLPR--QVSEVPVRLRPLKLVYDHDIRLAQM 312

Query: 308 PVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEA 367
           PVNC+FK LREIVSKRF SSKSVLIKYKD DGDLVTITCT ELRLAES+ DSL+ KEP  
Sbjct: 313 PVNCTFKVLREIVSKRFSSSKSVLIKYKDTDGDLVTITCTTELRLAESSVDSLLVKEPGT 372

Query: 368 DKSDSVGMLRLHIVDVS------PEQEPPLLEEEEEKPLESEGTKGDESGSHSSLAESVV 421
           DK+DSVGMLRLH+V+VS        +E    EEEEEKP ESE  KGDESGSHSSL ESV 
Sbjct: 373 DKTDSVGMLRLHVVEVSPEQEPPLVEEEEEEEEEEEKPPESEENKGDESGSHSSLGESVS 432

Query: 422 EAADTEIDKTDKDAAKEK--PGSEDLSKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHEL 479
           E  DTEI+K +K+  KEK     +  S+EVEMDDWLFEFAQLFRTHVGIDPDAHIDLHE+
Sbjct: 433 EVIDTEINKAEKETTKEKLEASGDPESREVEMDDWLFEFAQLFRTHVGIDPDAHIDLHEI 492

Query: 480 GMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGK 539
           GMELCSEALEETVTSEEAQ+LFDKAA KFQEVAALAFFNWGNVHMCAARKRIPLDESAGK
Sbjct: 493 GMELCSEALEETVTSEEAQSLFDKAASKFQEVAALAFFNWGNVHMCAARKRIPLDESAGK 552

Query: 540 EVVAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAK 599
           EVV+AQLQTAY+WVK+KYSLA+EKYEEALLIKPDFYEGLLALGQQQFEMAKLHWS+ LAK
Sbjct: 553 EVVSAQLQTAYEWVKDKYSLAREKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSFVLAK 612

Query: 600 KIDLSGWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDP--SKRDELLKRRKKQG 657
           KIDLS WD+ ETL+LFDSA+EKMK ATEMWEK+EEQ+A E KDP  SK+DE+L+RRKKQG
Sbjct: 613 KIDLSSWDSAETLKLFDSADEKMKVATEMWEKMEEQKANELKDPNASKKDEMLRRRKKQG 672

Query: 658 SGSDGDPSGTG-EGEISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLD 716
           S  +G+ S +G +GEIS +EAAEQAAVMRSQIHLFWGNMLFERSQVECKLG+D W + LD
Sbjct: 673 SNVEGESSESGAQGEISPEEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGMDDWKRKLD 732

Query: 717 AAIDRFKLAGASESDVSMVLKNHCSNGDAVEGEEKKVQNQSTNKTIEPDENNEANQI 773
           AA++RF+LAGASE D+SMVLKNHCSNGDA EG++KKVQN +T+   E D++ E N++
Sbjct: 733 AAVERFRLAGASEGDISMVLKNHCSNGDAAEGDDKKVQNSNTDNVNEADKSEEVNKV 789

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224118154|ref|XP_002331571.1| predicted protein [Populus trichocarpa] gi|222873795|gb|EEF10926.1| predicted protein [Populus trichocarpa] gi|429326630|gb|AFZ78655.1| receptor kinase [Populus tomentosa] Back     alignment and taxonomy information
>gi|357480407|ref|XP_003610489.1| hypothetical protein MTR_4g132780 [Medicago truncatula] gi|355511544|gb|AES92686.1| hypothetical protein MTR_4g132780 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356562742|ref|XP_003549628.1| PREDICTED: uncharacterized protein LOC100786963 [Glycine max] Back     alignment and taxonomy information
>gi|255554751|ref|XP_002518413.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223542258|gb|EEF43800.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356522033|ref|XP_003529654.1| PREDICTED: uncharacterized protein LOC100784987 [Glycine max] Back     alignment and taxonomy information
>gi|449455373|ref|XP_004145427.1| PREDICTED: uncharacterized protein LOC101214983 [Cucumis sativus] gi|449513523|ref|XP_004164348.1| PREDICTED: uncharacterized LOC101214983 [Cucumis sativus] Back     alignment and taxonomy information
>gi|365222950|gb|AEW69827.1| Hop-interacting protein THI142 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|297837181|ref|XP_002886472.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332313|gb|EFH62731.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18407574|ref|NP_564794.1| octicosapeptide/Phox/Be.1 domain-containing protein [Arabidopsis thaliana] gi|7940289|gb|AAF70848.1|AC003113_15 F2401.12 [Arabidopsis thaliana] gi|19423968|gb|AAL87265.1| unknown protein [Arabidopsis thaliana] gi|21281131|gb|AAM45044.1| unknown protein [Arabidopsis thaliana] gi|332195840|gb|AEE33961.1| octicosapeptide/Phox/Be.1 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
TAIR|locus:2027104751 Phox2 "Phox2" [Arabidopsis tha 0.927 0.958 0.655 1.4e-247
TAIR|locus:2116677811 Phox4 "Phox4" [Arabidopsis tha 0.395 0.378 0.451 3.5e-117
TAIR|locus:2059546745 Phox1 "Phox1" [Arabidopsis tha 0.417 0.434 0.443 1.9e-116
TAIR|locus:2149174809 Phox3 "Phox3" [Arabidopsis tha 0.364 0.349 0.393 1.7e-86
MGI|MGI:1914077292 Ttc1 "tetratricopeptide repeat 0.158 0.421 0.341 5.8e-12
UNIPROTKB|F1RR38292 TTC1 "Uncharacterized protein" 0.163 0.434 0.307 3.1e-11
RGD|1359604292 Ttc1 "tetratricopeptide repeat 0.158 0.421 0.333 3.1e-11
UNIPROTKB|Q3ZBR5292 TTC1 "Tetratricopeptide repeat 0.163 0.434 0.315 7e-11
UNIPROTKB|Q99614292 TTC1 "Tetratricopeptide repeat 0.163 0.434 0.315 2.8e-10
UNIPROTKB|F1S166 929 UNC45B "Uncharacterized protei 0.170 0.142 0.325 5.9e-10
TAIR|locus:2027104 Phox2 "Phox2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2385 (844.6 bits), Expect = 1.4e-247, P = 1.4e-247
 Identities = 493/752 (65%), Positives = 580/752 (77%)

Query:    14 NANQVAADNSN--ANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDN 71
             N++QV +  ++  +  ST  NGGVD D+SIFLKRAHELKEEGNK+FQ +DYVGALEQY+N
Sbjct:    17 NSSQVNSSETSGLSKPSTIVNGGVDFDASIFLKRAHELKEEGNKKFQARDYVGALEQYEN 76

Query:    72 ALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVXXXXXXXXXFD 131
              ++L PK+HPDRAVFHSNRAACLMQMKPI+YE+VI+EC+MAL+ QP F          F+
Sbjct:    77 GIKLIPKSHPDRAVFHSNRAACLMQMKPIDYESVISECSMALKSQPGFTRALLRRARAFE 136

Query:   132 AIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQSRPSPAALGASAV 191
             A+GK+++A+QDV VLLG +PNH+DA EI++RL+TALGP Q    DLQSRPSPAALGASA 
Sbjct:   137 AVGKFDLAVQDVNVLLGSDPNHKDAGEISKRLKTALGPHQ----DLQSRPSPAALGASAA 192

Query:   192 RGAPIAGLGPCLPARXXXXXXXXXXXXXXXSPSY---KQDRP-LMNVTAENGLE-NKTQF 246
              G PIAGLGPCLP+R                P+    K +RP ++N   ENG   +K Q 
Sbjct:   193 LGGPIAGLGPCLPSRNVHKKGVTSPVGSVSLPNASNGKVERPQVVNPVTENGGSVSKGQA 252

Query:   247 SKLALKPSNGRSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIRLGQ 306
             S++ LKP +     +P K S  E+  SS+V++   G+  E  +RWRPLK VYDHDIRLGQ
Sbjct:   253 SRVVLKPVSH----SP-KGSKVEELGSSSVAVV--GKVQEKRIRWRPLKFVYDHDIRLGQ 305

Query:   307 MPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPE 366
             MPVNC FK LREIVS RFPSSK+VLIKYKDNDGDLVTIT TAEL+LAESA+D ++TKEP+
Sbjct:   306 MPVNCRFKELREIVSSRFPSSKAVLIKYKDNDGDLVTITSTAELKLAESAADCILTKEPD 365

Query:   367 ADKSDSVGMLRLHIVDVSXXXXXXXXXXXXXXXXXXXGTKGDESGSHSSLAESVVEAADT 426
              DKSDSVGMLRLH+VDVS                     +   S    SL+E+ +   +T
Sbjct:   366 TDKSDSVGMLRLHVVDVSPEQEPMLLEEEEEEVEEKPVIEEVISSPTESLSETEI---NT 422

Query:   427 EIDKTDKDAAKEKPGS-EDL-SKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELC 484
             E  KTDK+  KEK  S ED  +KE+EMDDWLF+FA LFRTHVGIDPDAHIDLHELGMELC
Sbjct:   423 E--KTDKEVEKEKASSSEDPETKELEMDDWLFDFAHLFRTHVGIDPDAHIDLHELGMELC 480

Query:   485 SEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAA 544
             SEALEETVTSE+AQ LFDKA+ KFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAA
Sbjct:   481 SEALEETVTSEKAQPLFDKASAKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEVVAA 540

Query:   545 QLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLS 604
             QLQTAY+WVKE+Y+LAKEKYE+AL IKPDFYEGLLALGQQQFEMAKLHWSY LA+KID+S
Sbjct:   541 QLQTAYEWVKERYTLAKEKYEQALSIKPDFYEGLLALGQQQFEMAKLHWSYLLAQKIDIS 600

Query:   605 GWDATETLQLFDSAEEKMKTATEMWEKLEEQRAIEQKDPS--KRDELLKRRKKQXXXXXX 662
             GWD +ETL LFDSAE KMK ATEMWEKLEEQR  + K+P+  K++E+ KRRKKQ      
Sbjct:   601 GWDPSETLNLFDSAEAKMKDATEMWEKLEEQRMDDLKNPNSNKKEEVSKRRKKQGGDGNE 660

Query:   663 XXXXXXXXXISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLGLDGWNKNLDAAIDRF 722
                      I+A+EAAEQA  MRSQIHLFWGNMLFERSQVECK+G DGWNKNLD+A++RF
Sbjct:   661 EVSET----ITAEEAAEQATAMRSQIHLFWGNMLFERSQVECKIGKDGWNKNLDSAVERF 716

Query:   723 KLAGASESDVSMVLKNHCSN-GDAVEGEEKKV 753
             KLAGASE+D++ V+KNHCSN   A EG+EKKV
Sbjct:   717 KLAGASEADIATVVKNHCSNEAAATEGDEKKV 748
GO:0005737 "cytoplasm" evidence=ISM
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2116677 Phox4 "Phox4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059546 Phox1 "Phox1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149174 Phox3 "Phox3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1914077 Ttc1 "tetratricopeptide repeat domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR38 TTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359604 Ttc1 "tetratricopeptide repeat domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBR5 TTC1 "Tetratricopeptide repeat protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q99614 TTC1 "Tetratricopeptide repeat protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S166 UNC45B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00110177
hypothetical protein (789 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 4e-15
smart0066681 smart00666, PB1, PB1 domain 1e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-13
pfam0056484 pfam00564, PB1, PB1 domain 5e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-10
cd0599281 cd05992, PB1, The PB1 domain is a modular domain m 3e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-05
cd0640181 cd06401, PB1_TFG, The PB1 domain found in TFG prot 0.001
cd0640782 cd06407, PB1_NLP, A PB1 domain is present in NIN l 0.001
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information 
 Score = 78.9 bits (194), Expect = 4e-15
 Identities = 46/150 (30%), Positives = 76/150 (50%), Gaps = 13/150 (8%)

Query: 3   KSGGRRKKGGSNANQVAADNSNANISTNSNGGVDLDSSIFL------KRAHELKEEGNKR 56
           K   +  +G +   +  A  +      +    +D  S   L      K A +LKE+GNK 
Sbjct: 78  KQAEKETEGKTEEKKSTAPKNAPVEPADELPEIDESSVANLSEEERKKYAAKLKEKGNKA 137

Query: 57  FQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQ 116
           ++NKD+  A++ Y  A+   P       V++SNRAAC   +   ++E V+ + T AL++ 
Sbjct: 138 YRNKDFNKAIKLYSKAIECKPD-----PVYYSNRAACHNALG--DWEKVVEDTTAALELD 190

Query: 117 PRFVRALLRRARAFDAIGKYEMAMQDVQVL 146
           P + +AL RRA A+D +GKY  A+ D+   
Sbjct: 191 PDYSKALNRRANAYDGLGKYADALLDLTAS 220

[Transport and binding proteins, Amino acids, peptides and amines]. Length = 615
>gnl|CDD|214770 smart00666, PB1, PB1 domain Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215996 pfam00564, PB1, PB1 domain Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|99716 cd05992, PB1, The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|99722 cd06401, PB1_TFG, The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK Back     alignment and domain information
>gnl|CDD|99728 cd06407, PB1_NLP, A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 776
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 100.0
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 99.88
cd0640181 PB1_TFG The PB1 domain found in TFG protein, an on 99.8
KOG0553304 consensus TPR repeat-containing protein [General f 99.75
cd0640287 PB1_p62 The PB1 domain is an essential part of p62 99.73
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.71
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.64
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.63
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 99.61
PRK11189296 lipoprotein NlpI; Provisional 99.61
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 99.59
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.58
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.57
KOG4234271 consensus TPR repeat-containing protein [General f 99.56
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.54
cd0599281 PB1 The PB1 domain is a modular domain mediating s 99.53
cd0640483 PB1_aPKC PB1 domain is an essential modular domain 99.53
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.51
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.49
PRK12370553 invasion protein regulator; Provisional 99.49
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.49
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 99.48
PRK15359144 type III secretion system chaperone protein SscB; 99.47
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.47
PRK12370553 invasion protein regulator; Provisional 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.43
KOG4648536 consensus Uncharacterized conserved protein, conta 99.42
PRK15359144 type III secretion system chaperone protein SscB; 99.42
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.42
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.41
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 99.36
KOG1126638 consensus DNA-binding cell division cycle control 99.36
PRK11189296 lipoprotein NlpI; Provisional 99.35
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.35
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.34
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.31
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.31
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.3
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.29
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.29
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.29
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.28
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.28
PRK11788389 tetratricopeptide repeat protein; Provisional 99.27
PRK11788389 tetratricopeptide repeat protein; Provisional 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.25
PRK10370198 formate-dependent nitrite reductase complex subuni 99.23
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.19
PLN02789320 farnesyltranstransferase 99.18
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.15
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.15
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.15
PRK10370198 formate-dependent nitrite reductase complex subuni 99.13
PLN02789320 farnesyltranstransferase 99.13
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.12
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.11
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.1
KOG1125579 consensus TPR repeat-containing protein [General f 99.09
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.09
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.08
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.06
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.05
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.02
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 99.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.0
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.0
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.0
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 98.99
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.99
KOG2076895 consensus RNA polymerase III transcription factor 98.98
KOG0553304 consensus TPR repeat-containing protein [General f 98.98
PRK14574822 hmsH outer membrane protein; Provisional 98.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.97
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.96
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.95
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.94
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.93
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.93
cd0640380 PB1_Par6 The PB1 domain is an essential part of Pa 98.93
KOG2003840 consensus TPR repeat-containing protein [General f 98.9
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.88
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.87
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.85
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.85
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.83
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.78
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 98.77
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.75
PRK15331165 chaperone protein SicA; Provisional 98.75
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.75
KOG1125579 consensus TPR repeat-containing protein [General f 98.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.74
PRK10803263 tol-pal system protein YbgF; Provisional 98.74
PRK11906458 transcriptional regulator; Provisional 98.73
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.72
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 98.72
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.7
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.7
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.7
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.67
KOG1129478 consensus TPR repeat-containing protein [General f 98.65
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.58
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.58
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.56
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.55
KOG1129478 consensus TPR repeat-containing protein [General f 98.54
KOG4555175 consensus TPR repeat-containing protein [Function 98.54
PRK14574822 hmsH outer membrane protein; Provisional 98.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.52
PF13512142 TPR_18: Tetratricopeptide repeat 98.52
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.52
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.51
KOG2003840 consensus TPR repeat-containing protein [General f 98.5
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.5
PF1337173 TPR_9: Tetratricopeptide repeat 98.5
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.45
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.45
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 98.45
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.41
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.41
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.39
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.39
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.39
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.38
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.37
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.37
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.35
PF1337173 TPR_9: Tetratricopeptide repeat 98.34
PRK14720906 transcript cleavage factor/unknown domain fusion p 98.34
cd0641097 PB1_UP2 Uncharacterized protein 2. The PB1 domain 98.32
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.3
KOG2076895 consensus RNA polymerase III transcription factor 98.28
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.27
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.27
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.26
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.23
PF12688120 TPR_5: Tetratrico peptide repeat 98.21
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.17
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.16
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.15
KOG1128777 consensus Uncharacterized conserved protein, conta 98.14
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.13
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.13
PRK11906458 transcriptional regulator; Provisional 98.13
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.13
KOG1128777 consensus Uncharacterized conserved protein, conta 98.13
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.12
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
PF12688120 TPR_5: Tetratrico peptide repeat 98.12
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
cd0639591 PB1_Map2k5 PB1 domain is essential part of the mit 98.09
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.09
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.08
PRK10803263 tol-pal system protein YbgF; Provisional 98.06
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.06
KOG2376652 consensus Signal recognition particle, subunit Srp 98.04
KOG1310758 consensus WD40 repeat protein [General function pr 98.04
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.03
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.03
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.99
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.97
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.96
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.95
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.94
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.92
cd0639992 PB1_P40 The PB1 domain is essential part of the p4 97.89
KOG4648536 consensus Uncharacterized conserved protein, conta 97.87
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.86
PRK15331165 chaperone protein SicA; Provisional 97.85
KOG11271238 consensus TPR repeat-containing protein [RNA proce 97.84
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 97.78
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.77
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.77
KOG0695 593 consensus Serine/threonine protein kinase [Signal 97.76
COG4700251 Uncharacterized protein conserved in bacteria cont 97.74
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.72
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.67
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.66
PLN032181060 maturation of RBCL 1; Provisional 97.61
KOG4234271 consensus TPR repeat-containing protein [General f 97.59
PRK04841903 transcriptional regulator MalT; Provisional 97.59
COG4700251 Uncharacterized protein conserved in bacteria cont 97.58
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.56
PLN032181060 maturation of RBCL 1; Provisional 97.52
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.49
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.49
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.46
PLN03077857 Protein ECB2; Provisional 97.44
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.37
PF1342844 TPR_14: Tetratricopeptide repeat 97.37
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.37
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 97.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.36
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.35
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.33
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.32
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.27
cd0640579 PB1_Mekk2_3 The PB1 domain is present in the two m 97.23
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.22
PRK04841903 transcriptional regulator MalT; Provisional 97.2
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.19
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.19
KOG4555175 consensus TPR repeat-containing protein [Function 97.15
KOG2376652 consensus Signal recognition particle, subunit Srp 97.12
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.11
PF1343134 TPR_17: Tetratricopeptide repeat 97.04
PF1342844 TPR_14: Tetratricopeptide repeat 97.04
PF13512142 TPR_18: Tetratricopeptide repeat 96.99
KOG4340459 consensus Uncharacterized conserved protein [Funct 96.97
PLN03077857 Protein ECB2; Provisional 96.97
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.9
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.86
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.83
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.76
PRK10941269 hypothetical protein; Provisional 96.7
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.68
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.56
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.49
PF1343134 TPR_17: Tetratricopeptide repeat 96.46
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.44
KOG1915677 consensus Cell cycle control protein (crooked neck 96.23
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.23
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.2
KOG1915677 consensus Cell cycle control protein (crooked neck 96.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.12
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.99
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.83
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.82
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.67
KOG4507886 consensus Uncharacterized conserved protein, conta 95.53
KOG4814872 consensus Uncharacterized conserved protein [Funct 95.43
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.42
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.36
KOG1941518 consensus Acetylcholine receptor-associated protei 95.35
KOG1941518 consensus Acetylcholine receptor-associated protei 95.3
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.22
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.1
KOG1585308 consensus Protein required for fusion of vesicles 95.08
KOG1586288 consensus Protein required for fusion of vesicles 95.07
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.92
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.89
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 94.85
COG3898531 Uncharacterized membrane-bound protein [Function u 94.82
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.78
KOG1586288 consensus Protein required for fusion of vesicles 94.75
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.71
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.71
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.7
KOG2471696 consensus TPR repeat-containing protein [General f 94.61
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.59
KOG3364149 consensus Membrane protein involved in organellar 94.5
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.44
COG3898531 Uncharacterized membrane-bound protein [Function u 94.42
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.4
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.15
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.04
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.97
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.93
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.9
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 93.82
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.79
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.73
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.46
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.45
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.43
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 93.39
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.26
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.21
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.1
KOG1550552 consensus Extracellular protein SEL-1 and related 93.1
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.06
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.85
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.64
PRK10941269 hypothetical protein; Provisional 92.33
KOG2047835 consensus mRNA splicing factor [RNA processing and 92.13
KOG2471696 consensus TPR repeat-containing protein [General f 92.12
COG2912269 Uncharacterized conserved protein [Function unknow 92.04
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.61
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 91.18
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 90.98
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 90.42
KOG0530318 consensus Protein farnesyltransferase, alpha subun 90.27
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 90.01
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 89.2
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.16
COG4976287 Predicted methyltransferase (contains TPR repeat) 88.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.8
KOG1550552 consensus Extracellular protein SEL-1 and related 88.77
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.42
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 88.08
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 87.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.61
KOG3364149 consensus Membrane protein involved in organellar 87.53
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 87.44
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 86.97
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.81
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 86.73
KOG4814872 consensus Uncharacterized conserved protein [Funct 86.31
KOG1310758 consensus WD40 repeat protein [General function pr 86.27
KOG1585308 consensus Protein required for fusion of vesicles 86.1
COG5191435 Uncharacterized conserved protein, contains HAT (H 85.95
PF13281374 DUF4071: Domain of unknown function (DUF4071) 85.58
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.49
KOG2300629 consensus Uncharacterized conserved protein [Funct 85.03
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.95
KOG2300629 consensus Uncharacterized conserved protein [Funct 84.74
KOG0529421 consensus Protein geranylgeranyltransferase type I 84.5
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 83.6
PF1286294 Apc5: Anaphase-promoting complex subunit 5 83.34
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.03
KOG0530318 consensus Protein farnesyltransferase, alpha subun 81.95
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 81.9
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 80.93
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-87  Score=765.79  Aligned_cols=657  Identities=40%  Similarity=0.575  Sum_probs=505.4

Q ss_pred             CCCCCCCCCCCCCCCCcc-cc------cCCCCCCCCCCCCCCCC-ChHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q 004055            1 MGKSGGRRKKGGSNANQV-AA------DNSNANISTNSNGGVDL-DSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNA   72 (776)
Q Consensus         1 mgk~~~~Kk~~~~~~~~~-~~------~~~~~~~~~~~~~~~d~-D~~~~le~A~~LkeeGn~lfqkGdyeeAle~Y~KA   72 (776)
                      ||++++++|++....+.. ++      .++.+...+ -.++.++ |..+++.++..++++||.+|++++|.+|...|..+
T Consensus         1 ~~d~~~k~~n~~~~~~~~~~~~~~~~~~~~~~~~~~-~~k~~~d~di~v~l~ra~~~~~E~n~~~~K~d~~~~~~~~~~~   79 (748)
T KOG4151|consen    1 MGDKTLKSKNNLDVLNDAENGAELVGEKSKKPKVLS-IVKSLDDEDIEVFLSRALELKEEGNKLFQKRDYEGAMFRYDCA   79 (748)
T ss_pred             CCccccccCCcccccccccccccccccccccchhhh-hhhcccccchHHHHHHHHHHHhhhhHHhhhhhhhccchhhhhh
Confidence            899999999995322221 11      111212222 2344444 99999999999999999999999999999999999


Q ss_pred             HHhCCCCCCChHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCC
Q 004055           73 LRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPN  152 (776)
Q Consensus        73 LkLdP~~~~d~A~ay~n~A~cy~~LG~gdyeeAi~~~~kALeldP~n~kAl~~rA~ay~aLGr~deAl~d~~kAL~LdP~  152 (776)
                      +.+.|..|.+.+.++.|++.||+++|+++|..++.+|..|+...|...++++.++++|..+++++.|++++.-...++|.
T Consensus        80 ~~llp~~~~~~a~~~~~~~s~~m~~~l~~~~~~~~E~~la~~~~p~i~~~Ll~r~~~y~al~k~d~a~rdl~i~~~~~p~  159 (748)
T KOG4151|consen   80 IKLLPKDHHVVATLRSNQASCYMQLGLGEYPKAIPECELALESQPRISKALLKRARKYEALNKLDLAVRDLRIVEKMDPS  159 (748)
T ss_pred             heeccccchhhhhHHHHHHHHHhhcCccchhhhcCchhhhhhccchHHHHHhhhhhHHHHHHHHHHHHHHHHHHhcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHcCChHHHHHHHhh---CCCC--CCH--HHHHHHHHHHHhCCCccchhHHhhhhcCCCCCCccCCCC
Q 004055          153 HRDALEIARRLRTALGPRQEAQQDLQS---RPSP--AAL--GASAVRGAPIAGLGPCLPARPVGKKAGAPAGGLLVSPSY  225 (776)
Q Consensus       153 N~~al~~la~ll~~lg~~qeA~~~l~k---kl~P--~~~--~a~~~lA~~l~~LG~~eeArk~~KKa~~s~P~~~v~p~~  225 (776)
                      ++.+...+..++..+..++-+....+.   ...|  ..+  ...+.+.+ ++..+.++.++..+.+.     .+...+  
T Consensus       160 ~~~~~eif~elk~ll~~~d~~s~~~~~~~~~~~~vg~~~~~~~~i~l~r-l~~~~~~~~~~~~~~~~-----~~~~~~--  231 (748)
T KOG4151|consen  160 NVSASEIFEELKGLLELKDLASDESELPLEAVAPVGASPALIAKICLQR-LYKSKKTDCVEAFLTKD-----GERLFK--  231 (748)
T ss_pred             cchHHHHHHHHHHHHhhcCCccccccCChhhhccccCchHHHHHHHHHH-HhhhccchhHHhhcCCc-----HHhhhh--
Confidence            988888777766655333222211100   0111  111  22222222 22333444333333221     110000  


Q ss_pred             cccccccccccccCCC--cccccceeeecCCCCCCCCCCCCCcccccccccccccCCCCCcccccccccceeEeecccee
Q 004055          226 KQDRPLMNVTAENGLE--NKTQFSKLALKPSNGRSCGNPSKDSHREQSLSSAVSLDTRGQPLEVPVRWRPLKLVYDHDIR  303 (776)
Q Consensus       226 ~~~~~~~~~~~~~~~~--~~~~~P~~~l~p~~~~~~~~~~~~~~~~~~~~t~~~~~v~~~~~~~~~~~~~vK~~~~~DiR  303 (776)
                         ..+..-|...+..  .....-.....|..-+   ...+ +   ...-....+.+.+.+.....+|+.+|+++++|||
T Consensus       232 ---~~v~~~~~d~~~~~~~~~~l~a~~~~~v~~~---~~~~-~---~e~l~~~~l~~~~~~~e~~~~~~~~~~v~~~~i~  301 (748)
T KOG4151|consen  232 ---ERVFEDPSDLKFKKKSKCKLKAAQEDPVSDT---VKVM-D---KEQLLEEILAVGGSQDELAQVWRTLKLVYGDDIR  301 (748)
T ss_pred             ---hhhccCcccchhhhhhhhhhhhhcCCcccch---hhhh-h---HHHHHHHhhcccccchHHhhhhhhhhhhhccHHH
Confidence               0000001111111  0000000111110000   0000 0   0001112233555666677899999999999999


Q ss_pred             EEeccCCCCHHHHHHHHHhHCCCCCceEEEEecCCCCeeeecChHHHHHHHHhcccccccCcccccCCCCC-cEEEEEEe
Q 004055          304 LGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLAESASDSLMTKEPEADKSDSVG-MLRLHIVD  382 (776)
Q Consensus       304 ~~~v~~~~~~~~L~~~v~~kF~~~~~~~iKYkDeDGDlVTi~s~dDL~~A~~~~~~~~~~~~~~~~~~~~g-~~rL~v~e  382 (776)
                      +.++|.+|++..||+.|.+ ||..+.|+|||+|.+||+||||++++|+|+.+++             ...+ .+|+|+++
T Consensus       302 laql~~~~~~~~lR~ii~~-~~~~~~v~ik~~~~~~~~vtit~~a~l~l~~sa~-------------i~l~~~~r~~~ve  367 (748)
T KOG4151|consen  302 LAQLPLNCTVKILREIIHS-FPSLRAVLIKYRDTEGDLVTITTTAELRLAESAV-------------IKLGKTLRFYVVE  367 (748)
T ss_pred             HHhcchhhchHHHHHHHhc-ccchhhheeeeccCCcceeeeeehhhhhhhhHHH-------------HHHHHHhhhheee
Confidence            9999999999999999999 9999999999999999999999999999999988             5666 89999999


Q ss_pred             cCCCCCCCchhhhhcccccccCCCCCCCCCCCchhhHHHHhhhhhhhhhchhhhccCCCCCCcccccchhhHHHHHHHHH
Q 004055          383 VSPEQEPPLLEEEEEKPLESEGTKGDESGSHSSLAESVVEAADTEIDKTDKDAAKEKPGSEDLSKEVEMDDWLFEFAQLF  462 (776)
Q Consensus       383 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eid~w~~~fa~lf  462 (776)
                      ++|+|+|.+....    .+.+....+++++-  .+          ++         +                       
T Consensus       368 ~s~~qd~ry~s~~----a~~ke~~i~d~~s~--~a----------ln---------~-----------------------  399 (748)
T KOG4151|consen  368 VSPEQDPRYLSID----AELKELKIEDSSSS--KA----------LN---------G-----------------------  399 (748)
T ss_pred             cCccccchhhccc----cchhhhhccccchH--HH----------HH---------h-----------------------
Confidence            9999999866321    11222233333330  00          00         0                       


Q ss_pred             HHhhcCCCCc-ccchHHHHHHHhHHHHHhhhChHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHhhhhhcCCcccccchHH
Q 004055          463 RTHVGIDPDA-HIDLHELGMELCSEALEETVTSEEAQNLFDKAALKFQEVAALAFFNWGNVHMCAARKRIPLDESAGKEV  541 (776)
Q Consensus       463 ~~~~g~d~d~-~ldl~~~g~~~~~eale~~v~~~~a~~lf~~a~~kfqe~aa~a~fnwgnvh~~~ark~~~~~~~~~~~~  541 (776)
                         ++=+.+. |+|+|+|||++|++||+++||||.||++||.|+.+||||+|+++|||||||||+|||+++++++++.++
T Consensus       400 ---l~~~~~~~~~~~~~lg~~l~s~a~~~~~~sE~~qel~~la~~a~qev~~~~~~n~~~v~~~r~rk~~~~~~~~~~~s  476 (748)
T KOG4151|consen  400 ---LKGDAVESYLDLHELGMKLYSEAMEEEVTSEKAQELFDLAAFAFQEVAALSPLNWGNVHMSRARKRLSLDEDPSCES  476 (748)
T ss_pred             ---hhcccccccccHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHhhhhhccccccchHHHHHHHHhhccCcchhhhH
Confidence               0001111 999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHccCCchhHHHHHhHhhHHHHhhhhhhhhhhhccCCCCCChhHHHHHHHHHHHH
Q 004055          542 VAAQLQTAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLHWSYALAKKIDLSGWDATETLQLFDSAEEK  621 (776)
Q Consensus       542 ~~~~~~~~~~~~~~~y~~a~~~ye~a~~ikpdf~e~~~a~g~q~fe~akl~w~~~~~~~~d~~~~~s~~~~~~~~~a~~~  621 (776)
                      +++++.    |+..+|..|++||+.+..|||+||+++|+|||||||.|||+|||||+.+||+.+|.+.+|+.+|++|+.+
T Consensus       477 vakt~~----~~~~E~~aA~~K~~~~~~Ik~~~~~aLlrl~~~q~e~akl~~~~aL~~~i~f~~~~~~~v~~~~~s~~~~  552 (748)
T KOG4151|consen  477 VAKTVS----WAKNEYLAAKEKYERAKKIKPGGYEALLRLGQQQFEEAKLKWYHALAGKIDFPGERSYEVVKPLDSALHN  552 (748)
T ss_pred             HHHHHH----HHHHHHHhhhhHHhcCccccccHHHHHHHHHHHhchHHHHHHHHHHhhhcCCCCCchhhhhhhhcchhhh
Confidence            988775    9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHH-HhhcCCCchhhHHHHHHHhcCCCCCCCCCCCCCCCCChhHHHHHHHhhhhhHHHHhhhhhhhhh
Q 004055          622 MKTATEMWEKLEEQR-AIEQKDPSKRDELLKRRKKQGSGSDGDPSGTGEGEISADEAAEQAAVMRSQIHLFWGNMLFERS  700 (776)
Q Consensus       622 ~~~~~~~we~~e~~~-~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~e~~eq~~~~~~q~~~~wg~~l~e~s  700 (776)
                      |++||++||.+++++ +++.++..+.+ ++   ++.+       +++....++.|++++|++.|+||||++||.+|||||
T Consensus       553 d~~~~en~E~L~altnLas~s~s~r~~-i~---ke~~-------~~~ie~~~~ee~~~lqraa~e~~~NLl~~~~~~e~s  621 (748)
T KOG4151|consen  553 DEKGLENFEALEALTNLASISESDRQK-IL---KEKA-------LGKIEELMTEENPALQRAALESIINLLWSPLLYERS  621 (748)
T ss_pred             hHHHHHHHHHHHHhhcccCcchhhHHH-HH---HHhc-------chhhHHHhhcccHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            999999999999999 78777765444 54   3333       233344588999999999999999999999999999


Q ss_pred             HHHhhcCccchhhhHHHHHHHHHhcCCChhh-HHHHHhhccCC-CcccccccccccCC
Q 004055          701 QVECKLGLDGWNKNLDAAIDRFKLAGASESD-VSMVLKNHCSN-GDAVEGEEKKVQNQ  756 (776)
Q Consensus       701 ~~~~~~g~~~w~~~l~~a~ekf~~ag~~~~d-i~~~~~nh~~~-~~~~~~~~~~~~~~  756 (776)
                      ++++++|++.|..++++++|+|++|||+..| |..+++|||++ ...++|..+.+.-+
T Consensus       622 i~e~~~~l~~w~~~~e~~~E~~~lA~a~a~a~I~sv~~n~c~~~~~~~~~~e~~~~~i  679 (748)
T KOG4151|consen  622 IVEYKDRLKLWNLNLEVADEKFELAGAGALAAITSVVENHCSRILELLEWLEILVRAI  679 (748)
T ss_pred             hhccccCchHHHHHHHhhhhHHhhhccccccchhhcchhhhhhHHHhhcchHHHHHhh
Confidence            9999999999999999999999999999999 99999999995 44446666665444

>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3 proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd06410 PB1_UP2 Uncharacterized protein 2 Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06405 PB1_Mekk2_3 The PB1 domain is present in the two mitogen-activated protein kinase kinases MEKK2 and MEKK3 which are two members of the signaling kinase cascade involved in angiogenesis and early cardiovascular development Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 8e-10
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 2e-09
1wao_1477 Pp5 Structure Length = 477 3e-09
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 8e-09
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 1e-07
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-07
2gw1_A514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-06
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 7e-05
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 8e-05
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-04
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 4e-04
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
Query: 43  LKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINY 102
           LKRA ELK + N  F+ KDY  A++ Y  A+ L P      A+++ NR+   ++ +   Y
Sbjct: 10  LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSN----AIYYGNRSLAYLRTECYGY 65
Query: 103 ETVIAECTMALQVQPRFVXXXXXXXXXFDAIGKYEMAMQDVQVLLGVEPNHRDA 156
              + + T A+++  +++           A+GK+  A++D + ++ V+P+ +DA
Sbjct: 66  --ALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDA 117
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-36
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-30
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-29
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-29
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-28
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-27
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-24
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-22
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-22
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 6e-22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-14
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 8e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-04
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-08
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-08
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-08
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-08
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-08
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-06
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-06
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-04
2kkc_A102 Sequestosome-1; P62, PB1, autophagy, ubiquitin-pro 3e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-04
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
 Score =  132 bits (335), Expect = 3e-36
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 3/146 (2%)

Query: 19  AADNSNANISTNSNGGVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPK 78
            +  S+    +         ++       +L++EGN+ F+  DY GAL  Y  AL L   
Sbjct: 1   GSSGSSGMTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDA- 59

Query: 79  THPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEM 138
           T  D+AV H NRAAC ++++  +Y+    E + A++     V+AL RR++A + +G+ + 
Sbjct: 60  TPQDQAVLHRNRAACHLKLE--DYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQ 117

Query: 139 AMQDVQVLLGVEPNHRDALEIARRLR 164
           A+ D+Q  + +EP ++   E  R + 
Sbjct: 118 AVLDLQRCVSLEPKNKVFQEALRNIS 143
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2kkc_A Sequestosome-1; P62, PB1, autophagy, ubiquitin-proteasome system, NF-KB signaling, alternative splicing, apoptosis, cytoplasm, differentiation; NMR {Rattus norvegicus} PDB: 2ktr_B Length = 102 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.82
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.79
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.77
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.77
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.76
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.75
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.73
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 99.72
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.71
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.69
2kkc_A102 Sequestosome-1; P62, PB1, autophagy, ubiquitin-pro 99.69
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.69
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.68
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.67
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.67
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.66
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
2ktr_A117 Sequestosome-1; autophagy, NF-KB signaling, HOMO-o 99.66
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.66
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.65
1pqs_A77 Cell division control protein 24; alpha and beta p 99.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.65
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.65
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.64
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.64
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.64
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.63
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.62
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.61
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.61
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 99.6
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.6
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.6
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.59
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.58
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.58
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.57
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.56
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.56
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.56
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.56
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.56
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.56
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.54
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.54
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.53
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.53
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.53
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.53
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.52
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.52
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.51
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.49
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.49
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.48
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.46
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.46
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.46
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.45
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.45
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.44
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.43
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.42
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.42
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.39
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.39
1wmh_B86 Partitioning defective-6 homolog alpha; kinase, PB 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.38
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.37
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.36
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.35
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.34
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.34
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.34
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.34
3k9i_A117 BH0479 protein; putative protein binding protein, 99.33
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.33
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.32
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.32
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.31
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.31
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.3
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.27
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.27
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.27
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.26
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.22
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.21
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.21
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.2
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.18
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.17
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.16
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.15
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.14
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.11
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.08
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.07
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.07
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.05
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.05
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.04
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.03
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.0
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.0
3k9i_A117 BH0479 protein; putative protein binding protein, 99.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.99
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.99
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.97
2bkf_A87 Zinc-finger protein NBR1 (NEXT to breast cancer 1; 98.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.94
1wj6_A101 KIAA0049 protein, RSGI RUH-024; PB1 domain, protei 98.9
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.89
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.87
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.84
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 98.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.75
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.75
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.75
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.74
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
1oey_J107 P40-PHOX, neutrophil cytosol factor 4; immune syst 98.66
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.65
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.6
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.59
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.5
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.45
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.43
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.43
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.36
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.35
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 98.35
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.22
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.19
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.16
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.13
2cu1_A103 Mitogen-activated protein kinase kinase kinase 2; 97.99
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.98
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.93
2npt_A106 Dual specificity mitogen-activated protein kinase; 97.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.83
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.8
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.73
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.63
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.48
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.42
2jrh_A94 Mitogen-activated protein kinase kinase kinase 3; 97.29
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.21
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.2
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.12
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.12
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.08
2c60_A111 Human mitogen-activated protein kinase kinase kina 97.07
2npt_B100 Mitogen-activated protein kinase kinase kinase 2; 97.07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.48
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 96.4
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.16
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.82
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.74
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.65
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.52
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.07
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.31
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 92.86
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.58
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.51
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.51
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 89.97
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.75
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.89
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.77
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 87.88
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.78
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 85.88
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 84.45
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.21
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 82.02
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 81.18
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
Probab=99.82  E-value=7.5e-19  Score=167.38  Aligned_cols=168  Identities=17%  Similarity=0.129  Sum_probs=161.2

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCCCChHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHcCCCCHHHHH
Q 004055           45 RAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHPDRAVFHSNRAACLMQMKPINYETVIAECTMALQVQPRFVRALL  124 (776)
Q Consensus        45 ~A~~LkeeGn~lfqkGdyeeAle~Y~KALkLdP~~~~d~A~ay~n~A~cy~~LG~gdyeeAi~~~~kALeldP~n~kAl~  124 (776)
                      .+..|...|+.++.+|+|++|+..|+++|+++|++    +.+++++|.||..+|  ++++|+..+.+++..+|.+..++.
T Consensus         4 ~~~iy~~lG~~~~~~g~~~~A~~~~~~al~~~p~~----~~~~~~la~~~~~~~--~~~~a~~~~~~~~~~~~~~~~~~~   77 (184)
T 3vtx_A            4 TTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNN----VETLLKLGKTYMDIG--LPNDAIESLKKFVVLDTTSAEAYY   77 (184)
T ss_dssp             CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTC----HHHHHHHHHHHHHTT--CHHHHHHHHHHHHHHCCCCHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC----HHHHHHHHHHHHHCC--CHHHHHHHHHHHHhcCchhHHHHH
Confidence            46789999999999999999999999999999998    899999999999999  999999999999999999999999


Q ss_pred             HHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCChHHHHHHHhh--CCCCCCHHHHHHHHHHHHhCCCc
Q 004055          125 RRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEAQQDLQS--RPSPAALGASAVRGAPIAGLGPC  202 (776)
Q Consensus       125 ~rA~ay~aLGr~deAl~d~~kAL~LdP~N~~al~~la~ll~~lg~~qeA~~~l~k--kl~P~~~~a~~~lA~~l~~LG~~  202 (776)
                      .+|.++...++++.|...+.+++.++|++..++..++.++..+|++++|+..+.+  ...|.++.++..+|.++..+|++
T Consensus        78 ~~~~~~~~~~~~~~a~~~~~~a~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~lg~~~~~~g~~  157 (184)
T 3vtx_A           78 ILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLR  157 (184)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHhCCchhHHHHHHHHHHhcchhhhHHHHHHHHHHHCCCH
Confidence            9999999999999999999999999999999999999999999999999999987  67899999999999999999999


Q ss_pred             cchhHHhhhhcCCCCC
Q 004055          203 LPARPVGKKAGAPAGG  218 (776)
Q Consensus       203 eeArk~~KKa~~s~P~  218 (776)
                      ++|..+++++....|.
T Consensus       158 ~~A~~~~~~al~~~p~  173 (184)
T 3vtx_A          158 DEAVKYFKKALEKEEK  173 (184)
T ss_dssp             HHHHHHHHHHHHTTHH
T ss_pred             HHHHHHHHHHHhCCcc
Confidence            9999999998866554
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2kkc_A Sequestosome-1; P62, PB1, autophagy, ubiquitin-proteasome system, NF-KB signaling, alternative splicing, apoptosis, cytoplasm, differentiation; NMR {Rattus norvegicus} PDB: 2ktr_B Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ktr_A Sequestosome-1; autophagy, NF-KB signaling, HOMO-oligomer, PB1 dimer, signaling protein, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1pqs_A Cell division control protein 24; alpha and beta protein, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1tz1_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wmh_B Partitioning defective-6 homolog alpha; kinase, PB1 domain, OPCA motif, APKC, cell polarity, transferase/cell cycle complex; 1.50A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2bkf_A Zinc-finger protein NBR1 (NEXT to breast cancer 1; PB1 domain, interaction domain, Z finger; 1.56A {Homo sapiens} SCOP: d.15.2.2 PDB: 2g4s_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1wj6_A KIAA0049 protein, RSGI RUH-024; PB1 domain, protein binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1oey_J P40-PHOX, neutrophil cytosol factor 4; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2cu1_A Mitogen-activated protein kinase kinase kinase 2; PB1 domain, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, signaling protein; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2npt_A Dual specificity mitogen-activated protein kinase; MAP2K5, MEK5, MKK PRKMK5, MAP kinase kinase 5, PHOX, PHOX-domain; 1.75A {Homo sapiens} SCOP: d.15.2.2 PDB: 2o2v_A 1wi0_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2jrh_A Mitogen-activated protein kinase kinase kinase 3; kinase signaling domain, transferase; NMR {Homo sapiens} PDB: 2pph_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2c60_A Human mitogen-activated protein kinase kinase kinase 3 isoform 2; MAP3K3, MAP/ERK kinase kinase 3, MAPKKK3, MEKK3, serine threonine phosphorylation; HET: MSE; 1.25A {Homo sapiens} SCOP: d.15.2.2 PDB: 2o2v_B Back     alignment and structure
>2npt_B Mitogen-activated protein kinase kinase kinase 2; MAP2K5, MEK5, MKK PRKMK5, MAP kinase kinase 5, PHOX, PHOX-domain; 1.75A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 776
d1ip9a_85 d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker' 5e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-11
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-11
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 8e-11
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-08
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 8e-08
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-07
d2bkfa185 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NB 6e-07
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.003
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-05
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 1e-04
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Bud emergence mediator Bemp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 66.0 bits (161), Expect = 5e-14
 Identities = 13/68 (19%), Positives = 28/68 (41%), Gaps = 1/68 (1%)

Query: 294 LKLVYDHDIRLGQMPVNCSFKALREIVSKRFPSSKSVLIKYKDNDGDLVTITCTAELRLA 353
           +K  Y  DI    +  + ++K LR  ++ R   + +  ++ K  DG    I   +++   
Sbjct: 15  IKFYYKDDIFALMLKGDTTYKELRSKIAPRI-DTDNFKLQTKLFDGSGEEIKTDSQVSNI 73

Query: 354 ESASDSLM 361
             A   + 
Sbjct: 74  IQAKLKIS 81
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.77
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.77
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.76
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.74
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.71
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.67
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.66
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 99.66
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.65
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.56
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.42
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.37
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.35
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 99.32
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.32
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.26
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.21
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.2
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.16
d1pqsa_77 Cell division control protein 24, CDC24, C-termina 99.15
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.12
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.11
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.1
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.04
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.01
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.96
d1wmha_83 Protein kinase C, iota type {Human (Homo sapiens) 98.93
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.93
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.92
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.87
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.87
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.59
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.59
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.56
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.53
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.49
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.29
d2npta1105 Mitogen activated protein kinase kinase 5, Map2k5 98.27
d1oeyj_105 Neutrophil cytosol factor 4 (p40phox component of 97.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.97
d1wmhb_82 Partitioning defective-6 homolog alpha, PAR-6 alph 97.74
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.4
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 97.39
d2c60a180 Mitogen-activated protein kinase kinase kinase 3, 97.32
d2nptb182 Mitogen-activated protein kinase kinase kinase 2, 97.22
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.07
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.68
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.45
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP52 (FKBP4), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=2.5e-18  Score=165.01  Aligned_cols=138  Identities=24%  Similarity=0.352  Sum_probs=127.4

Q ss_pred             CCCCChHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCCC-----------ChHHHHHHHHHHHHHcCCCCH
Q 004055           34 GVDLDSSIFLKRAHELKEEGNKRFQNKDYVGALEQYDNALRLTPKTHP-----------DRAVFHSNRAACLMQMKPINY  102 (776)
Q Consensus        34 ~~d~D~~~~le~A~~LkeeGn~lfqkGdyeeAle~Y~KALkLdP~~~~-----------d~A~ay~n~A~cy~~LG~gdy  102 (776)
                      ++|+++.+.++.+..+++.|+.+|..|+|++|+..|+++|.+.|....           ....+|.|+|.||+++|  +|
T Consensus         1 ~~~~~~~ek~~~a~~l~~~G~~~~~~~~~~~Ai~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~y~k~~--~~   78 (170)
T d1p5qa1           1 SWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQ--AF   78 (170)
T ss_dssp             GGGCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTT--CH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhhhccccchHHHhhhchhHHHHHHHHHHHHHhhh--hc
Confidence            368999999999999999999999999999999999999999987532           24578999999999999  99


Q ss_pred             HHHHHHHHHHHHcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCChHHH
Q 004055          103 ETVIAECTMALQVQPRFVRALLRRARAFDAIGKYEMAMQDVQVLLGVEPNHRDALEIARRLRTALGPRQEA  173 (776)
Q Consensus       103 eeAi~~~~kALeldP~n~kAl~~rA~ay~aLGr~deAl~d~~kAL~LdP~N~~al~~la~ll~~lg~~qeA  173 (776)
                      ++|+.+|++||.++|+++.+|+++|.||..+|++++|+.+|++++.++|+|+.+...++.+...+.+....
T Consensus        79 ~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~~~  149 (170)
T d1p5qa1          79 SAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAR  149 (170)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccchhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999998877655443
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c60a1 d.15.2.2 (A:43-122) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nptb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure