Citrus Sinensis ID: 004133

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770--
MGKKKKNQSSSSSSATDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTDVETERKKASSSSKSKRKGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
ccccccccccccccccHHcccccccccHHHHHHHHccccccccccccccccccHHHHHHHHccccccccccEEEEcccccHHHHHHHHccccccEEEcccHHHHHHHHHHHcccccccEEEEccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHccccccccEEEEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccEEEEEccccccccEEEEEEEEcccccccccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHcHHHHHccccccccccccEEEEcccccEEEEEEEEEEccccccEEEEEEEcccccccccccccccccEEEEEEEEccccccEEcEEEEEccccccccHHHHHHHcccccccccccccccccccccccEEccccccHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccccEEEEEccHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcc
cccccccHcccccccccccccHHHcccHHHHHHHHHHcccccccHHHccHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccccEEEEEEcccccccccccccEEEEcccHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccccEEEEEEEcccccccccccEEEEEEEcccccccccHHHHHHHcccccccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccEEEEEEEEcccccccccccEEEEEEccccccHHEEccHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccEEEEcccccEEEEEEEEEccccccEEEEEEEEcccccccHccccccccEEEEEEEEccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHcccccHHHccccccEEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccHHHHcHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHEEcccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccHccHHHHHHHHHHHHcc
mgkkkknqsssssSATDLLQTLgdftskenwdkfftirgigdsfewyaewpqlrdplisligaptsspppqilvpgcgnsrlsehlydagfhgitnvdfsKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDkggldalmepelghkLGNQYLSEVKRLLKSGGKFVCLTLAEShvlgllfpkfrfgwkmsvhaipqksssepslQTFMVVADKENSSVVLQVTssfdhssldcnknqafGIHEALESenqtrreyshgsdilysledlqlgakgdmknlspgcrfelilggegdfCFSYRAVLLDArensgpfmyncgvfivpktrahewlfsseEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPlvkqlapgkddqgaqipfmmagdgikhrnvvhqatssltgpiivedlvyenvdpefsriwpsedlKFRRLVFQRTQGLVQSEALLmrdgsshrtdveterkkasssskskrkgtqrrsddsgnqlkVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGagllpmflhecmpfvgiEAVELDLTMLNLAEDyfgftqdkslkvHITDGIKFVREMksssatdeMSVVHgneitsnntrscngnctasnarVDILIIdvdspdsssgmtcpaadfvegSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLssescikdnsfPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
mgkkkknqssssssaTDLLQTLgdftskenwDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHgitnvdfskvvisdmlrrnvrdrsdmrwRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHaipqksssepSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQglvqseallmrdgsshrtdveterkkasssskskrkgtqrrsddsgnqLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFgftqdkslkvHITDGIKFVREMKSSSATDEMSVVHGNeitsnntrscngNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
MGKKKKNQssssssATDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTDVETErkkasssskskrkGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYLEsvasvgksvkavvIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
******************LQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGA*******QILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAI************FMVV*******VVLQVT**************AFGI******************DILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDT*******************************IPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQ********************************************LKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVR**************************CNGNCTASNARVDILIIDVD*******MTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMD*********
*************************TSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKE*******VTSSFDHSSLDCNKNQAFGI*E******QTRREYSHGSDILYSLEDL*************GCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLM*************************************QLKVYHGYLASSYHMGIISGFTLISSYLES*ASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSS********VHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSES*****SF***AVQLGKLVKFQHLEISQSIMDAAKKIRCL*
****************DLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALES*********HGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMR**********************************GNQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREM********MSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
***************TDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEF*R*WPSEDLKFRRLVFQRTQGLVQSEALLMRDG*********************************NQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSS***************************ASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKKKNQSSSSSSATDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTDVETERKKASSSSKSKRKGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query772 2.2.26 [Sep-21-2011]
A5PK19699 Methyltransferase-like pr yes no 0.817 0.902 0.328 8e-89
Q8N6R0699 Methyltransferase-like pr yes no 0.812 0.896 0.328 1e-87
Q91YR5698 Methyltransferase-like pr yes no 0.804 0.889 0.322 1e-86
A5WVX1690 Methyltransferase-like pr yes no 0.844 0.944 0.303 4e-78
Q29LW1673 Methyltransferase-like pr yes no 0.792 0.909 0.299 5e-66
Q9VIK9673 Methyltransferase-like pr yes no 0.790 0.906 0.289 3e-64
Q6NTR1693 Methyltransferase-like pr N/A no 0.479 0.533 0.316 2e-48
Q10711 883 Endothelin-converting enz no no 0.170 0.149 0.356 1e-13
O60344 883 Endothelin-converting enz no no 0.148 0.130 0.380 2e-13
Q80Z60 881 Endothelin-converting enz no no 0.165 0.145 0.363 5e-13
>sp|A5PK19|MET13_BOVIN Methyltransferase-like protein 13 OS=Bos taurus GN=METTL13 PE=2 SV=1 Back     alignment and function desciption
 Score =  328 bits (842), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 239/728 (32%), Positives = 357/728 (49%), Gaps = 97/728 (13%)

Query: 24  DFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLS 83
           +F S + W+KFF  RG   +FEWY  + +L   L   I      P  ++LV GCGNS LS
Sbjct: 10  EFGSVDYWEKFFQQRG-KKAFEWYGTYLELCGVLHKYI-----KPREKVLVVGCGNSELS 63

Query: 84  EHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKG 143
           E LYD G+  I N+D S+VVI  M  RN   R  M +  MDMT M+ F D +F V+LDKG
Sbjct: 64  EQLYDVGYQDIVNIDISEVVIKQMKERNASRRPRMSFLKMDMTQME-FPDASFQVVLDKG 122

Query: 144 GLDALM--EPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKF-RFGWKMS 200
            LDA++  E E   +  ++ L+EV R+L+ GG+++C++LA++HVL      F R GW + 
Sbjct: 123 TLDAVLTDEEEKTLQQVDRMLAEVGRVLQVGGRYLCISLAQAHVLKKAVGHFSREGWMVR 182

Query: 201 VHAIP----QKSSSEP--SLQTFMVVADKEN--SSVVLQVTSSFDHSSLDCNKNQAFGIH 252
           VH +     Q   +EP  SL  F  +  K    +   LQ+   F+  + +  K       
Sbjct: 183 VHQVASSQDQLLEAEPRFSLPVFAFIMTKFRPVTGSALQI---FELCAQEQGKPVRLESA 239

Query: 253 EALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAV 312
           E L    + R++Y+     LY         K  + ++S     +L  G  G+  ++   V
Sbjct: 240 EQLAEAVRERQQYAWLCSQLYR--------KAGLGSVS----LDLCNGDTGEPRYTLHVV 287

Query: 313 ----LLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTS 368
               +  +R+N      +  +FI+P+ R  EWLF  EEG+  +  S+   RLI V L   
Sbjct: 288 DSPTVKPSRDN------HFAIFIIPQGRETEWLFGMEEGRKQLAASAGFRRLITVALHRG 341

Query: 369 HASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQATSSLTGPIIVE 428
                MD IQ +LS  V +LAP       Q+PF+  G  I  R V HQA S L+G  ++E
Sbjct: 342 QQYEGMDSIQAELSARVMELAPAGMPAQLQVPFLSVGGDIGVRIVQHQACSPLSGDYVIE 401

Query: 429 DLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTD---VETERKK 485
           D+  +  D  +          FRRL+F   + +VQSEA L++D  SHR      +  +K 
Sbjct: 402 DV--QGDDKRY----------FRRLIFLSNRNVVQSEARLLQD-VSHRAQKKRKKDRKKH 448

Query: 486 ASSSSKSKRKGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVK 545
             + +       Q +S D          YL   +H  +I+G  L+ +       +   + 
Sbjct: 449 RPADTPEDLPAAQGQSIDK--------SYLCCEHHKAMIAGLALLKN---PELLLETPLA 497

Query: 546 AVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFV 605
            +V+GLG G LP+F+H+  P   I AVE+D +ML +A  +FGF+Q   +KVHI DG+ F+
Sbjct: 498 LLVVGLGGGSLPLFIHDHFPKSCIHAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDFI 557

Query: 606 REMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAA 665
             +    A                               D+++ DVDS D + GM+CP  
Sbjct: 558 TRLAEEEA---------------------------RPHYDVIMFDVDSKDPTLGMSCPPP 590

Query: 666 DFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVL 725
            FV   FL  VK  L+ +G+FI+NLV R    KD V++ +K VF  L+  ++E +VN +L
Sbjct: 591 AFVAQLFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEIL 650

Query: 726 FGLSSESC 733
           F      C
Sbjct: 651 FCQLHSEC 658

Bos taurus (taxid: 9913)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8N6R0|MET13_HUMAN Methyltransferase-like protein 13 OS=Homo sapiens GN=METTL13 PE=1 SV=1 Back     alignment and function description
>sp|Q91YR5|MET13_MOUSE Methyltransferase-like protein 13 OS=Mus musculus GN=Mettl13 PE=1 SV=1 Back     alignment and function description
>sp|A5WVX1|MET13_DANRE Methyltransferase-like protein 13 OS=Danio rerio GN=mettl13 PE=2 SV=1 Back     alignment and function description
>sp|Q29LW1|MTE13_DROPS Methyltransferase-like protein 13 OS=Drosophila pseudoobscura pseudoobscura GN=GA15401 PE=3 SV=1 Back     alignment and function description
>sp|Q9VIK9|MET13_DROME Methyltransferase-like protein 13 OS=Drosophila melanogaster GN=CG2614 PE=2 SV=1 Back     alignment and function description
>sp|Q6NTR1|MET13_XENLA Methyltransferase-like protein 13 OS=Xenopus laevis GN=mettl13 PE=2 SV=1 Back     alignment and function description
>sp|Q10711|ECE2_BOVIN Endothelin-converting enzyme 2 OS=Bos taurus GN=ECE2 PE=1 SV=2 Back     alignment and function description
>sp|O60344|ECE2_HUMAN Endothelin-converting enzyme 2 OS=Homo sapiens GN=ECE2 PE=1 SV=4 Back     alignment and function description
>sp|Q80Z60|ECE2_MOUSE Endothelin-converting enzyme 2 OS=Mus musculus GN=Ece2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query772
224060357779 predicted protein [Populus trichocarpa] 0.992 0.983 0.710 0.0
359477926782 PREDICTED: methyltransferase-like protei 0.984 0.971 0.692 0.0
255554026761 S-adenosylmethionine-dependent methyltra 0.984 0.998 0.701 0.0
356512463761 PREDICTED: methyltransferase-like protei 0.977 0.992 0.658 0.0
356512461762 PREDICTED: methyltransferase-like protei 0.975 0.988 0.656 0.0
449432402752 PREDICTED: methyltransferase-like protei 0.971 0.997 0.676 0.0
34148076763 putative spermine/spermidine synthase [G 0.979 0.990 0.649 0.0
356525225763 PREDICTED: methyltransferase-like protei 0.975 0.986 0.649 0.0
298205206748 unnamed protein product [Vitis vinifera] 0.924 0.954 0.650 0.0
297826625762 hypothetical protein ARALYDRAFT_902209 [ 0.974 0.986 0.632 0.0
>gi|224060357|ref|XP_002300159.1| predicted protein [Populus trichocarpa] gi|222847417|gb|EEE84964.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/785 (71%), Positives = 641/785 (81%), Gaps = 19/785 (2%)

Query: 1   MGKKKKNQSSSSSSATDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISL 60
           MGKK K   SS +S  +LL TLGDFTSKENWDKFFTIRG  DSFEWYAEW +L  PL+SL
Sbjct: 1   MGKKDKQ--SSKASTEELLTTLGDFTSKENWDKFFTIRGTDDSFEWYAEWTELHHPLLSL 58

Query: 61  IG------APTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRD 114
           +       + +SSP  +ILVPGCGNS+LSE+LYDAGF  ITN+DFSKVVISDMLRRNVRD
Sbjct: 59  LAGNDENHSSSSSPLLKILVPGCGNSKLSENLYDAGFKEITNIDFSKVVISDMLRRNVRD 118

Query: 115 RSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGK 174
           R  MRWRVMDMT MQ+  DE+FDV+LDKGGLDALMEPELG KLGNQYLSEVKR+L   GK
Sbjct: 119 RPGMRWRVMDMTQMQL-ADESFDVVLDKGGLDALMEPELGPKLGNQYLSEVKRVLNFEGK 177

Query: 175 FVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTS 234
           F+CLTLAESHVL LLF KFRFGWKMSV AIPQK SS+P L+TFMVVA+KENSS +  +T+
Sbjct: 178 FICLTLAESHVLALLFSKFRFGWKMSVQAIPQKPSSKPDLRTFMVVAEKENSSALHFITA 237

Query: 235 SFDHSSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCR 294
            FDHSSLDC  NQA G+HEALE+ENQ R+EYS G DILYSLEDL +GAKGD+  LS G R
Sbjct: 238 LFDHSSLDCIGNQAIGLHEALENENQIRKEYSIGPDILYSLEDLLIGAKGDLSKLSLGRR 297

Query: 295 FELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVES 354
           F+L LGG GD  FSY+A++LDA+E+S  F Y+CGVFIVPKTRAHEWLFSSEEGQWLVVES
Sbjct: 298 FQLTLGGNGDSRFSYKAIVLDAKESSSQFTYHCGVFIVPKTRAHEWLFSSEEGQWLVVES 357

Query: 355 SKAARLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVV 414
           SKAARLIM+++D+SH +ASMD+IQKDLSPLVKQLAPGKDD  AQIPFMMAGDGIK R  V
Sbjct: 358 SKAARLIMIIMDSSHNNASMDDIQKDLSPLVKQLAPGKDDNSAQIPFMMAGDGIKERKTV 417

Query: 415 HQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSS 474
           H+ TSSLTG IIVED+VYENV  + SR +PS DL FRRLVFQR +GLVQSEALL RD SS
Sbjct: 418 HKVTSSLTGSIIVEDVVYENVADDVSRPFPSSDLIFRRLVFQRAEGLVQSEALLTRDESS 477

Query: 475 HRTDVETERKKASSSSKSKRKGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYL 534
           H+     E KK +SSSKSK+KG+Q+R+D S   LKVYH Y+ASSYHMGI+SGFTL+SSYL
Sbjct: 478 HKI---VEEKKKTSSSKSKKKGSQKRNDASSKILKVYHDYMASSYHMGIVSGFTLMSSYL 534

Query: 535 ESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSL 594
           ESV S GK+V AV+IGLGAGLLPMFLH CMP + IE VELD  +L+LA DYFGF +D+ L
Sbjct: 535 ESVESTGKTVNAVIIGLGAGLLPMFLHGCMPSLQIEVVELDAVVLSLARDYFGFAEDERL 594

Query: 595 KVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSC---NGNCTASNA----RVDIL 647
           KVHI DGI+FVRE+K+ +  D +  +HG E  S +T+     +G+ + +      RVDIL
Sbjct: 595 KVHIADGIRFVREVKNFAVADGLPAIHGIEDASGSTKPSPDESGSVSYTEGRGRPRVDIL 654

Query: 648 IIDVDSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKM 707
           IIDVDS DSSSGM CPAADFVE SFLLTVKD LSEQGLFIVNLVSRS A KD +ISRMK 
Sbjct: 655 IIDVDSSDSSSGMACPAADFVEESFLLTVKDTLSEQGLFIVNLVSRSPAVKDTIISRMKA 714

Query: 708 VFNHLFCLQLEEDVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKK 767
           VFNHLF LQLEED+N+VLFGL SE C+K++ FPEAA QL KL+KF+H EI QSI+D+ KK
Sbjct: 715 VFNHLFSLQLEEDINMVLFGLCSEVCLKEDCFPEAACQLDKLLKFKHQEIGQSIIDSTKK 774

Query: 768 IRCLK 772
           IR LK
Sbjct: 775 IRRLK 779

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359477926|ref|XP_002263181.2| PREDICTED: methyltransferase-like protein 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554026|ref|XP_002518053.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223542649|gb|EEF44186.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512463|ref|XP_003524938.1| PREDICTED: methyltransferase-like protein 13-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356512461|ref|XP_003524937.1| PREDICTED: methyltransferase-like protein 13-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449432402|ref|XP_004133988.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus] gi|449517108|ref|XP_004165588.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|34148076|gb|AAQ62585.1| putative spermine/spermidine synthase [Glycine max] Back     alignment and taxonomy information
>gi|356525225|ref|XP_003531227.1| PREDICTED: methyltransferase-like protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|298205206|emb|CBI17265.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297826625|ref|XP_002881195.1| hypothetical protein ARALYDRAFT_902209 [Arabidopsis lyrata subsp. lyrata] gi|297327034|gb|EFH57454.1| hypothetical protein ARALYDRAFT_902209 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query772
TAIR|locus:2045253760 AT2G31740 [Arabidopsis thalian 0.975 0.990 0.605 4e-241
MGI|MGI:1918699698 Mettl13 "methyltransferase lik 0.541 0.598 0.350 3.3e-89
UNIPROTKB|A5PK19699 METTL13 "Methyltransferase-lik 0.541 0.597 0.350 6.8e-89
RGD|1311526700 Mettl13 "methyltransferase lik 0.542 0.598 0.348 1.8e-88
UNIPROTKB|F1PDJ6699 METTL13 "Uncharacterized prote 0.541 0.597 0.348 6.8e-69
UNIPROTKB|B4E2X3698 METTL13 "cDNA FLJ56024" [Homo 0.541 0.598 0.344 2.3e-68
UNIPROTKB|Q8N6R0699 METTL13 "Methyltransferase-lik 0.541 0.597 0.344 2.3e-68
UNIPROTKB|F1S7S8699 METTL13 "Uncharacterized prote 0.541 0.597 0.348 3.7e-68
FB|FBgn0032873673 CG2614 [Drosophila melanogaste 0.259 0.297 0.373 2.2e-61
UNIPROTKB|Q29LW1673 GA15401 "Methyltransferase-lik 0.502 0.576 0.299 2.4e-60
TAIR|locus:2045253 AT2G31740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2324 (823.1 bits), Expect = 4.0e-241, P = 4.0e-241
 Identities = 472/779 (60%), Positives = 585/779 (75%)

Query:     1 MGKKKKNQXXXXXXATDLLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISL 60
             MGKKK N+        D LQTL DFTSKENWDKFFT+RG  DSFEWYAEWPQL D L+ L
Sbjct:     1 MGKKKGNKAAASTD--DFLQTLEDFTSKENWDKFFTLRGNDDSFEWYAEWPQLHDSLLPL 58

Query:    61 I--GAPTSSPPPQILVPGCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDM 118
             +   + +SS   QILVPGCGNSRL+EHLYDAGF  ITNVDFSKVVISDMLRRN+R R ++
Sbjct:    59 LQDSSSSSSDSLQILVPGCGNSRLTEHLYDAGFRDITNVDFSKVVISDMLRRNIRTRPEL 118

Query:   119 RWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCL 178
             RWRVMD+T MQ+  DE+FD +LDKG LDALMEPE+G KLGNQYLSE KR+LK GGKF+CL
Sbjct:   119 RWRVMDITKMQL-ADESFDTVLDKGALDALMEPEVGTKLGNQYLSEAKRVLKPGGKFICL 177

Query:   179 TLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDH 238
             TLAESHVL LLF +FRFGWKM+VH+I QK S    L+T+MVVA+KENS ++ ++TS+F+ 
Sbjct:   178 TLAESHVLALLFSRFRFGWKMNVHSIAQKRSK---LKTYMVVAEKENSVLLHEITSAFEL 234

Query:   239 SSLDCNKNQAFGIHEALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELI 298
              SL  N +Q  G+ EA+ESEN+ RR+ ++GSD+LYS EDL+LG KGD+  L+ G R +  
Sbjct:   235 VSLGRNDSQGSGMREAVESENKIRRDCNNGSDLLYSHEDLKLGIKGDLAELTEGRRIKFT 294

Query:   299 LGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVPKTRAHEWLFSSEEGQWLVVESSKAA 358
             LGG+G   FSYRAVLLDA++ + PF+Y CGVF+VPKTRAHEWLF SEEGQW VVESS+AA
Sbjct:   295 LGGQGSN-FSYRAVLLDAQKQTEPFVYYCGVFLVPKTRAHEWLFCSEEGQWQVVESSQAA 353

Query:   359 RLIMVLLDTSHASASMDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHRNVVHQAT 418
             RLIMV LD+SH+ A+M++IQ DLSP+V QLAP  DD+ A+IP+MMA DGIK R+ VH+ T
Sbjct:   354 RLIMVFLDSSHSGATMEDIQNDLSPMVTQLAPRNDDE-ARIPYMMASDGIKKRDTVHEVT 412

Query:   419 SSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTD 478
             S +TG ++VED+VYE+       +  S DL FRRLVF+RT+GL+QSEALL+ DG      
Sbjct:   413 SPMTGKVVVEDVVYESAPSNLEDLSTSSDLAFRRLVFKRTEGLIQSEALLVEDGEILE-- 470

Query:   479 VETEXXXXXXXXXXXXXGTQRRSDDSGNQL-KVYHGYLASSYHMGIISGFTLISSYLEXX 537
              +++             G ++++ +    L +V H YLASSYH GIISGFTL+SSYL+  
Sbjct:   471 -QSQKEKTKNVSQSKRKGNKKQNQEPSRPLMRVSHDYLASSYHTGIISGFTLVSSYLKKA 529

Query:   538 XXXXXXXXXXXIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFGFTQDKSLKVH 597
                        IGLGAGLLPMFLH C+PF  IEAVELD  ML++ +DYFGFTQ+  LKVH
Sbjct:   530 ESCGTMVKTVVIGLGAGLLPMFLHGCLPFFSIEAVELDPVMLSVGKDYFGFTQNDRLKVH 589

Query:   598 ITDGIKFVREMKSSSAT-DEMSVVHGN-EITSNNTRSCNGNCTASNARVDILIIDVDSPD 655
             I DGIKF+R++ +S A+ +E S +  N + T++NT+   G C       DILIIDVDS D
Sbjct:   590 IADGIKFIRDITNSEASSEESSNIGSNGDSTTHNTQG--GICP------DILIIDVDSAD 641

Query:   656 SSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCL 715
             SS G+TCPA+DF+E +FLL+VK AL + GLFIVNLV+RSQ+ KDMV+SRMK VF+HLF L
Sbjct:   642 SSGGLTCPASDFIEETFLLSVKQALPQHGLFIVNLVTRSQSVKDMVVSRMKKVFDHLFGL 701

Query:   716 QLEE--DVNLVLFGLSSESCIKDNSFPEAAVQLGKLVKFQHLEISQSIMDAAKKIRCLK 772
             QLEE  DVN+VLFGL SES I +N  PE+AV L  L+K Q LE  QSI+DA KK++C K
Sbjct:   702 QLEEEDDVNVVLFGLCSESVISENDIPESAVILEGLLKCQRLETKQSIIDATKKLKCWK 760
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
MGI|MGI:1918699 Mettl13 "methyltransferase like 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A5PK19 METTL13 "Methyltransferase-like protein 13" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311526 Mettl13 "methyltransferase like 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDJ6 METTL13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4E2X3 METTL13 "cDNA FLJ56024" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N6R0 METTL13 "Methyltransferase-like protein 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7S8 METTL13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0032873 CG2614 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q29LW1 GA15401 "Methyltransferase-like protein 13" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A5PK19MET13_BOVIN2, ., 1, ., 1, ., -0.32820.81730.9027yesno
Q91YR5MET13_MOUSE2, ., 1, ., 1, ., -0.32220.80440.8896yesno
A5WVX1MET13_DANRE2, ., 1, ., 1, ., -0.30350.84450.9449yesno
Q8N6R0MET13_HUMAN2, ., 1, ., 1, ., -0.32860.81210.8969yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query772
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 3e-12
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 4e-10
COG0421282 COG0421, SpeE, Spermidine synthase [Amino acid tra 2e-09
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 2e-07
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 1e-06
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 9e-06
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 2e-05
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 3e-05
PRK04457262 PRK04457, PRK04457, spermidine synthase; Provision 3e-05
PRK00811283 PRK00811, PRK00811, spermidine synthase; Provision 5e-04
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 0.002
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information 
 Score = 62.7 bits (153), Expect = 3e-12
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 13/102 (12%)

Query: 76  GCGNSRLSEHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDET 135
           GCG   L+E L   G   +T VD S     +ML    R R+  ++ V D   +  F DE+
Sbjct: 4   GCGTGLLAEALARRGGARVTGVDLSP----EMLAL-ARKRAPRKFVVGDAEDLP-FPDES 57

Query: 136 FDVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVC 177
           FDV++    L  L +PE       + L E+ R+LK GGK V 
Sbjct: 58  FDVVVSSLVLHHLPDPE-------RALREIARVLKPGGKLVI 92

Members of this family are SAM dependent methyltransferases. Length = 92
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|223498 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|179854 PRK04457, PRK04457, spermidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|234843 PRK00811, PRK00811, spermidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 772
KOG2352482 consensus Predicted spermine/spermidine synthase [ 100.0
PRK04457262 spermidine synthase; Provisional 99.97
PLN02823336 spermine synthase 99.91
COG0421282 SpeE Spermidine synthase [Amino acid transport and 99.9
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 99.89
PRK00811283 spermidine synthase; Provisional 99.87
PLN02366308 spermidine synthase 99.86
PRK01581374 speE spermidine synthase; Validated 99.82
KOG1271227 consensus Methyltransferases [General function pre 99.76
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.76
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 99.75
PRK00536262 speE spermidine synthase; Provisional 99.72
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.69
PLN02336475 phosphoethanolamine N-methyltransferase 99.68
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.66
PRK03612521 spermidine synthase; Provisional 99.65
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.64
PRK13256226 thiopurine S-methyltransferase; Reviewed 99.64
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.63
PLN02233261 ubiquinone biosynthesis methyltransferase 99.62
PRK11207197 tellurite resistance protein TehB; Provisional 99.58
PLN02244340 tocopherol O-methyltransferase 99.58
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.58
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.58
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 99.57
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.56
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.54
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.53
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.51
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.51
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.49
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.49
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.48
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.48
COG4262508 Predicted spermidine synthase with an N-terminal m 99.48
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.46
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.46
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.44
PRK12335287 tellurite resistance protein TehB; Provisional 99.44
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.44
PLN02336475 phosphoethanolamine N-methyltransferase 99.42
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.42
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.41
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.4
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.4
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.39
TIGR00452314 methyltransferase, putative. Known examples to dat 99.39
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.39
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.38
KOG1562337 consensus Spermidine synthase [Amino acid transpor 99.37
KOG2361264 consensus Predicted methyltransferase [General fun 99.37
PRK05785226 hypothetical protein; Provisional 99.37
KOG4300252 consensus Predicted methyltransferase [General fun 99.37
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.36
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.36
PLN02490340 MPBQ/MSBQ methyltransferase 99.35
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.35
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.35
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.33
PRK08317241 hypothetical protein; Provisional 99.32
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.32
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.32
PRK06922677 hypothetical protein; Provisional 99.31
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.3
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.29
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.29
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.29
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.28
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.26
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.26
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.25
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.24
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.24
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.23
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.23
PRK06202232 hypothetical protein; Provisional 99.23
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.22
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.21
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.21
COG4122219 Predicted O-methyltransferase [General function pr 99.21
PLN03075296 nicotianamine synthase; Provisional 99.19
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.19
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.19
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.19
PRK14967223 putative methyltransferase; Provisional 99.18
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.16
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.16
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.15
PRK04266226 fibrillarin; Provisional 99.14
TIGR03438301 probable methyltransferase. This model represents 99.14
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.14
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.13
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.13
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.11
PRK07402196 precorrin-6B methylase; Provisional 99.11
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.1
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.1
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.1
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.09
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.09
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.08
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.08
COG4123248 Predicted O-methyltransferase [General function pr 99.08
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 99.07
PLN02476278 O-methyltransferase 99.06
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.05
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 99.05
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.05
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.05
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.04
PRK14968188 putative methyltransferase; Provisional 99.04
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.03
PLN03075296 nicotianamine synthase; Provisional 99.03
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.02
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.01
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.01
PTZ00146293 fibrillarin; Provisional 99.01
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.01
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.01
PLN02589247 caffeoyl-CoA O-methyltransferase 99.0
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.0
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.99
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.99
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.99
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.98
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.97
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.96
PLN02232160 ubiquinone biosynthesis methyltransferase 98.95
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.94
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.94
COG4123248 Predicted O-methyltransferase [General function pr 98.92
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.91
TIGR00438188 rrmJ cell division protein FtsJ. 98.9
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.88
PHA03411279 putative methyltransferase; Provisional 98.87
KOG3010261 consensus Methyltransferase [General function pred 98.86
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.85
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.85
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.84
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.84
PRK10901427 16S rRNA methyltransferase B; Provisional 98.83
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.83
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.82
PRK00811283 spermidine synthase; Provisional 98.82
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.81
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.79
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.79
PRK04457262 spermidine synthase; Provisional 98.77
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.77
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.77
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.75
PRK14903431 16S rRNA methyltransferase B; Provisional 98.74
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.74
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.73
COG2890280 HemK Methylase of polypeptide chain release factor 98.72
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.72
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.71
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.71
PRK14904445 16S rRNA methyltransferase B; Provisional 98.7
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.7
PHA03412241 putative methyltransferase; Provisional 98.67
COG1041347 Predicted DNA modification methylase [DNA replicat 98.67
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.66
PRK14901434 16S rRNA methyltransferase B; Provisional 98.66
PRK14902444 16S rRNA methyltransferase B; Provisional 98.66
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.65
PRK07402196 precorrin-6B methylase; Provisional 98.64
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.63
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.62
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.62
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.61
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.61
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.6
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.6
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.6
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.59
PRK14903431 16S rRNA methyltransferase B; Provisional 98.58
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.58
PLN02366308 spermidine synthase 98.57
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.57
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.57
PRK01581374 speE spermidine synthase; Validated 98.56
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.56
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.56
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.55
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.55
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.55
COG2521287 Predicted archaeal methyltransferase [General func 98.54
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.54
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.53
KOG2899288 consensus Predicted methyltransferase [General fun 98.53
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.53
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.53
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.53
PLN02233261 ubiquinone biosynthesis methyltransferase 98.52
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.52
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.52
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.51
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.51
KOG2940325 consensus Predicted methyltransferase [General fun 98.49
PRK04266226 fibrillarin; Provisional 98.49
PRK14902444 16S rRNA methyltransferase B; Provisional 98.49
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.49
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.48
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.48
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.47
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.47
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.47
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.47
PLN02672 1082 methionine S-methyltransferase 98.46
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.46
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.46
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.46
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.45
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.44
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.44
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.44
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.44
PRK03612521 spermidine synthase; Provisional 98.43
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.43
PRK10901427 16S rRNA methyltransferase B; Provisional 98.42
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.42
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.41
PRK14904445 16S rRNA methyltransferase B; Provisional 98.41
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.41
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.4
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.39
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.39
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.38
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.38
TIGR00438188 rrmJ cell division protein FtsJ. 98.38
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.37
PLN02244340 tocopherol O-methyltransferase 98.37
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.37
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.36
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.35
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.35
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.35
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.34
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.32
PTZ00146293 fibrillarin; Provisional 98.31
PRK11207197 tellurite resistance protein TehB; Provisional 98.31
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.31
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.31
PRK04148134 hypothetical protein; Provisional 98.3
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.29
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.28
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.28
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.28
COG2890280 HemK Methylase of polypeptide chain release factor 98.27
PRK14901434 16S rRNA methyltransferase B; Provisional 98.27
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.27
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.27
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.26
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.26
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.25
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.25
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.25
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.24
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.24
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.23
KOG2904328 consensus Predicted methyltransferase [General fun 98.23
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.22
PLN02476278 O-methyltransferase 98.22
PRK06922677 hypothetical protein; Provisional 98.22
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.22
PLN02490340 MPBQ/MSBQ methyltransferase 98.21
PLN02823336 spermine synthase 98.21
KOG1331293 consensus Predicted methyltransferase [General fun 98.21
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.2
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.2
KOG2899288 consensus Predicted methyltransferase [General fun 98.19
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.18
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.18
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.18
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 98.17
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.17
PRK08317241 hypothetical protein; Provisional 98.17
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.16
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.16
PRK14968188 putative methyltransferase; Provisional 98.16
COG4122219 Predicted O-methyltransferase [General function pr 98.16
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.16
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.14
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.13
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 98.13
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.12
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.11
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.11
PRK14967223 putative methyltransferase; Provisional 98.11
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.1
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.09
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.08
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.07
KOG1500517 consensus Protein arginine N-methyltransferase CAR 98.06
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.06
PHA03411279 putative methyltransferase; Provisional 98.06
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.05
PLN02672 1082 methionine S-methyltransferase 98.05
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.04
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.04
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.02
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.02
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.02
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.01
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.01
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.01
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.0
PLN02589247 caffeoyl-CoA O-methyltransferase 97.98
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.97
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.97
PHA03412241 putative methyltransferase; Provisional 97.97
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.96
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.96
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.95
PRK12335287 tellurite resistance protein TehB; Provisional 97.94
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.94
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.93
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.93
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.93
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.92
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.91
TIGR03438301 probable methyltransferase. This model represents 97.89
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.88
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.88
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.88
PRK05785226 hypothetical protein; Provisional 97.87
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.86
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.85
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.85
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.85
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.85
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.84
PRK06202232 hypothetical protein; Provisional 97.82
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.81
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.81
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 97.8
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.79
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.79
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.77
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.77
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.77
TIGR00452314 methyltransferase, putative. Known examples to dat 97.77
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.77
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.76
KOG4300252 consensus Predicted methyltransferase [General fun 97.75
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.75
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.75
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.75
COG2521287 Predicted archaeal methyltransferase [General func 97.75
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.74
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.73
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.7
PRK00536262 speE spermidine synthase; Provisional 97.68
KOG2904328 consensus Predicted methyltransferase [General fun 97.68
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.64
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.64
KOG1709271 consensus Guanidinoacetate methyltransferase and r 97.64
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.64
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.62
KOG3010261 consensus Methyltransferase [General function pred 97.62
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.62
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.61
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.61
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.61
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.59
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.56
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.55
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.54
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.52
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.52
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.52
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.51
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.47
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.46
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.45
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.44
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.44
COG2520341 Predicted methyltransferase [General function pred 97.44
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.42
KOG1271227 consensus Methyltransferases [General function pre 97.41
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.41
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.41
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.4
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.39
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.37
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.36
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.35
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.32
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.32
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.3
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 97.28
PF13679141 Methyltransf_32: Methyltransferase domain 97.27
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.27
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.26
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 97.24
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.24
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.21
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.18
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.14
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.14
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.13
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.11
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 97.11
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.1
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.09
PLN02232160 ubiquinone biosynthesis methyltransferase 97.09
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.06
KOG3987288 consensus Uncharacterized conserved protein DREV/C 97.06
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.06
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.06
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.05
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.96
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.96
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.93
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.91
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.88
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 96.88
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 96.87
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 96.87
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.85
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 96.85
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 96.82
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.81
COG3897218 Predicted methyltransferase [General function pred 96.78
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.76
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 96.7
COG4076252 Predicted RNA methylase [General function predicti 96.7
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 96.63
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.62
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 96.56
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.5
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.5
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.47
COG4262508 Predicted spermidine synthase with an N-terminal m 96.43
COG2384226 Predicted SAM-dependent methyltransferase [General 96.41
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.41
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 96.39
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.38
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.34
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.27
COG4076252 Predicted RNA methylase [General function predicti 96.21
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.13
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 96.12
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.08
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.02
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.88
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 95.86
KOG1499346 consensus Protein arginine N-methyltransferase PRM 95.85
KOG2730263 consensus Methylase [General function prediction o 95.85
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 95.83
PRK04148134 hypothetical protein; Provisional 95.73
PRK10742250 putative methyltransferase; Provisional 95.61
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 95.46
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 95.4
PRK10742250 putative methyltransferase; Provisional 95.23
KOG3115249 consensus Methyltransferase-like protein [General 95.21
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 95.18
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 95.18
COG0286489 HsdM Type I restriction-modification system methyl 95.17
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 95.1
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 95.03
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 95.0
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 94.99
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 94.97
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 94.91
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 94.8
COG4627185 Uncharacterized protein conserved in bacteria [Fun 94.74
COG2265432 TrmA SAM-dependent methyltransferases related to t 94.67
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 94.66
COG2520341 Predicted methyltransferase [General function pred 94.65
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 94.52
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 94.47
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 94.28
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 94.26
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 94.21
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 94.21
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 94.02
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 93.96
KOG2361264 consensus Predicted methyltransferase [General fun 93.91
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 93.87
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 93.83
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 93.72
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 93.61
COG4798238 Predicted methyltransferase [General function pred 93.56
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 93.48
KOG3201201 consensus Uncharacterized conserved protein [Funct 93.44
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 93.37
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 93.27
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 93.27
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 93.22
KOG2730263 consensus Methylase [General function prediction o 93.22
KOG1099294 consensus SAM-dependent methyltransferase/cell div 93.16
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 93.07
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 92.93
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 92.72
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 92.72
KOG2920282 consensus Predicted methyltransferase [General fun 92.67
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 92.54
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-67  Score=572.16  Aligned_cols=451  Identities=41%  Similarity=0.648  Sum_probs=413.2

Q ss_pred             hcccccCCCCHHHHHHHHHhcCCCCccccccchhhHHHHHHHhhcCCCCCCCC-eEEEEcCCCchhHHHHHHcCCCeEEE
Q 004133           18 LLQTLGDFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPP-QILVPGCGNSRLSEHLYDAGFHGITN   96 (772)
Q Consensus        18 lP~~~~~f~~~~yWd~~y~~~~~~~~~eW~~~~~~l~~~l~~~l~~~~~~~~~-~ILDlGCG~G~ls~~La~~g~~~V~g   96 (772)
                      +|+....|.+..||+.||..++ ...++||+.+..++..|..++.     +.. ++|.+|||++.+++.+++.||.+|++
T Consensus         3 ~p~~~~~~~s~~~wd~rf~~rg-~~~~ewY~~~l~l~~~i~~~~~-----p~~~~~l~lGCGNS~l~e~ly~~G~~dI~~   76 (482)
T KOG2352|consen    3 LPQEQLSFGSVVYWDKRFQPRG-SDPFEWYGALLSLSGSIMKYLS-----PSDFKILQLGCGNSELSEHLYKNGFEDITN   76 (482)
T ss_pred             CcccccccCcchhhhhhccccC-CChHHHHHHHHHHHHHHHHhhc-----hhhceeEeecCCCCHHHHHHHhcCCCCcee
Confidence            7889999999999999999986 6899999999999999999985     455 99999999999999999999999999


Q ss_pred             EeCCHHHHHHHHHHhccCCCCcEEEEeeccCcccccCCCccEEEecccccccccCccchH---HHHHHHHHHHhccccCe
Q 004133           97 VDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLDALMEPELGHK---LGNQYLSEVKRLLKSGG  173 (772)
Q Consensus        97 vDiS~~~I~~a~~~~~~~~~~v~f~~~D~~~l~~~~~~sfDvVi~~~~l~~l~~~~~~~~---~~~~~l~ei~rvLkpGG  173 (772)
                      +|+|+.+++.|..++....+.+.|..+|+..+. |++++||+|+++|++|++..++....   .+..++.+++|+|++||
T Consensus        77 iD~S~V~V~~m~~~~~~~~~~~~~~~~d~~~l~-fedESFdiVIdkGtlDal~~de~a~~~~~~v~~~~~eVsrvl~~~g  155 (482)
T KOG2352|consen   77 IDSSSVVVAAMQVRNAKERPEMQMVEMDMDQLV-FEDESFDIVIDKGTLDALFEDEDALLNTAHVSNMLDEVSRVLAPGG  155 (482)
T ss_pred             ccccHHHHHHHHhccccCCcceEEEEecchhcc-CCCcceeEEEecCccccccCCchhhhhhHHhhHHHhhHHHHhccCC
Confidence            999999999999998877889999999999999 99999999999999999998876655   58899999999999999


Q ss_pred             EEEEEEcCchhhhhcccccccCCcEEEEEEcCCCCCCCCCcceEEEEEEecCCccccccccccccCCCccCccchhhHHH
Q 004133          174 KFVCLTLAESHVLGLLFPKFRFGWKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLDCNKNQAFGIHE  253 (772)
Q Consensus       174 ~~ii~~~~~~~~~~~l~~~~~~~w~~~~~~~~~~~~~~~~l~~f~~~~~K~~~~~~~~v~~~~~~~~~~~~~~~~~~l~~  253 (772)
                      +++.+++.+                                                                       
T Consensus       156 k~~svtl~~-----------------------------------------------------------------------  164 (482)
T KOG2352|consen  156 KYISVTLVQ-----------------------------------------------------------------------  164 (482)
T ss_pred             EEEEEEeee-----------------------------------------------------------------------
Confidence            999998775                                                                       


Q ss_pred             HHHHhhhhhhhhcCCCcccchhhhhhccccccccccCCCceEEEEeCCCCCceeeEEEEEEeCCCCCCCCcccEEEEEee
Q 004133          254 ALESENQTRREYSHGSDILYSLEDLQLGAKGDMKNLSPGCRFELILGGEGDFCFSYRAVLLDARENSGPFMYNCGVFIVP  333 (772)
Q Consensus       254 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~~~y~~~v~D~~~~~~~~~~~~a~fiVP  333 (772)
                                                                                                   +||
T Consensus       165 -----------------------------------------------------------------------------~vp  167 (482)
T KOG2352|consen  165 -----------------------------------------------------------------------------VVP  167 (482)
T ss_pred             -----------------------------------------------------------------------------ecc
Confidence                                                                                         899


Q ss_pred             CCCccccccCChhhHHHHHHhcCCCEEEEEEecCCCCCCc--hHHHHHhhhHHHHhcCCCCCCCCCCccEEecCCCceee
Q 004133          334 KTRAHEWLFSSEEGQWLVVESSKAARLIMVLLDTSHASAS--MDEIQKDLSPLVKQLAPGKDDQGAQIPFMMAGDGIKHR  411 (772)
Q Consensus       334 ~gre~ewlfst~eG~~~l~~sa~~~RLi~v~l~~~~~~~~--~~~vk~el~~~v~~l~p~~~~~~~~ip~l~~~~~i~~r  411 (772)
                      +||+++|+|+++.|++++..+++..||++|.+++++.|..  +++++..+++.+..+.|+++++..+.|+++.|+++   
T Consensus       168 ~~r~~e~~~~~p~G~~~~~~~s~~~~l~~v~l~~gq~~~~~~~~~~~~~~s~~~~~l~~~g~~~~~q~~~ls~g~d~---  244 (482)
T KOG2352|consen  168 QGRKPEWLFGSPGGSKQMNVSSSGERLAIVALHRGQQYSTPQEDEVQDPLSPFRRQLDPKGEPTQQQREILSIGEDV---  244 (482)
T ss_pred             CCCCeeeeecCccchhhhhhhccCcceEEEEeccCccccchHHhhhccccccceeecccccCChhhhhccccccccc---
Confidence            9999999999999999999999999999999999999998  89999999999999999999888899999877533   


Q ss_pred             eEEEEEecCCccCEEEEEeecccCCCCcccCCCCCCceeeeEEecCCCCceecceEeeccCCCCCcchhhhhhhcccccc
Q 004133          412 NVVHQATSSLTGPIIVEDLVYENVDPEFSRIWPSEDLKFRRLVFQRTQGLVQSEALLMRDGSSHRTDVETERKKASSSSK  491 (772)
Q Consensus       412 ~~~~~~~s~~~g~~~Vedv~~e~~~~~~~~~~~~~~~~~RrLiF~~~~~~vQSe~~l~~~~~~~~~~~~~~~~~~~~~~~  491 (772)
                                                           ..|||.+..|.|++|||++..                      
T Consensus       245 -------------------------------------~~~~l~~~~n~nv~q~~~k~~----------------------  265 (482)
T KOG2352|consen  245 -------------------------------------GVRRLPPCGNMNVVQSEAKKD----------------------  265 (482)
T ss_pred             -------------------------------------ccccccCCCCcceecCchhcc----------------------
Confidence                                                 356666666999999996110                      


Q ss_pred             ccccCcccCCCCCCcceeecCCccchHHHHHHHHHHhhhhhhhhhhcccCCCCeEEEEcccccHHHHHHHHhCCCCcEEE
Q 004133          492 SKRKGTQRRSDDSGNQLKVYHGYLASSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEA  571 (772)
Q Consensus       492 ~~~~~~~~~~~~~~~~~~~d~~~L~~~Y~~~m~~~l~l~~~~~~~~~~~~~~~~vLviGlG~G~l~~~L~~~~p~~~i~~  571 (772)
                                         ...||+|+||+.|++|++|+.+...  ...+....+||+|+|||.||+||+.++|..++++
T Consensus       266 -------------------r~~~l~s~~h~~m~~g~aL~~n~~~--~~~~~~~~~lvvg~ggG~l~sfl~~~~p~~~i~~  324 (482)
T KOG2352|consen  266 -------------------RKPELASQYHQMMIGGLALIMNRPP--QKLDTGGKQLVVGLGGGGLPSFLHMSLPKFQITA  324 (482)
T ss_pred             -------------------cCcccCcchhhhhhccceeccccCc--hhccccCcEEEEecCCCccccceeeecCccceeE
Confidence                               1128999999999999999987654  2346778999999999999999999999999999


Q ss_pred             EEcCHHHHHHHHHhcCCCCCCCeEEEEccHHHHHHhhcccCcccccccccccccccCCCCCCCCCCCCCCCceeEEEEeC
Q 004133          572 VELDLTMLNLAEDYFGFTQDKSLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDV  651 (772)
Q Consensus       572 VEiDp~v~~vA~~~Fg~~~~~rl~v~i~Dg~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~IivD~  651 (772)
                      ||+||.|+++|+.||||.++.|.+||+.||++|++++.+.                          ..++.+||+|++|+
T Consensus       325 ve~dP~~l~va~q~f~f~q~~r~~V~i~dGl~~~~~~~k~--------------------------~~~~~~~dvl~~dv  378 (482)
T KOG2352|consen  325 VEIDPEMLEVATQYFGFMQSDRNKVHIADGLDFLQRTAKS--------------------------QQEDICPDVLMVDV  378 (482)
T ss_pred             EEEChhHhhccHhhhchhhhhhhhhhHhhchHHHHHHhhc--------------------------cccccCCcEEEEEC
Confidence            9999999999999999998889999999999999998732                          12368999999999


Q ss_pred             CCCCCCCCCCcCCcCCCcHHHHHHHHHccCCCcEEEEEecCCChhHHHHHHHHHHHhccceEEEeecCCceEEEEEecCC
Q 004133          652 DSPDSSSGMTCPAADFVEGSFLLTVKDALSEQGLFIVNLVSRSQATKDMVISRMKMVFNHLFCLQLEEDVNLVLFGLSSE  731 (772)
Q Consensus       652 ~~~d~~~g~s~Pp~~f~~~~fl~~~~~~L~~~Gilv~Nl~~~~~~~~~~v~~~l~~vF~~v~~~~~~~~~N~vl~a~~~~  731 (772)
                      |++| +.||+|||+.|++..||..++..|.|.|+|++|+++|+..++.++...|+++|+++|.+++++++|.|++|+..+
T Consensus       379 ds~d-~~g~~~pp~~fva~~~l~~~k~~l~p~g~f~inlv~r~~~~~~~~~~~l~~vf~~l~~~~~~~~~N~il~~~~~~  457 (482)
T KOG2352|consen  379 DSKD-SHGMQCPPPAFVAQVALQPVKMILPPRGMFIINLVTRNSSFKDEVLMNLAKVFPQLYHHQLEEDVNEILIGQMPP  457 (482)
T ss_pred             CCCC-cccCcCCchHHHHHHHHHHHhhccCccceEEEEEecCCcchhHHHHHhhhhhhHHHhhhhccCCCceeEEeecCh
Confidence            9999 899999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             Cc
Q 004133          732 SC  733 (772)
Q Consensus       732 ~~  733 (772)
                      ..
T Consensus       458 ~~  459 (482)
T KOG2352|consen  458 KQ  459 (482)
T ss_pred             hc
Confidence            54

>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query772
2pxx_A215 Human Putative Methyltransferase Mgc2408 Length = 2 4e-21
>pdb|2PXX|A Chain A, Human Putative Methyltransferase Mgc2408 Length = 215 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (248), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 63/181 (34%), Positives = 95/181 (52%), Gaps = 19/181 (10%)
Query: 29  ENWDKFFTIRGIGDS--FEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLSEHL 86
           E WD+ +  +G  DS  ++W+ ++   R  L      P   P  +ILV GCGNS LS  L
Sbjct: 8   EYWDQRY--QGAADSAPYDWFGDFSSFRALL-----EPELRPEDRILVLGCGNSALSYEL 60
Query: 87  YDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKGGLD 146
           +  GF  +T+VD+S VV++ M +        +RW  MD+  +  F   +FDV+L+KG LD
Sbjct: 61  FLGGFPNVTSVDYSSVVVAAM-QACYAHVPQLRWETMDVRKLD-FPSASFDVVLEKGTLD 118
Query: 147 ALMEPEL--------GHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFGWK 198
           AL+  E         G    +Q LSEV R+L  GG+F+ +T A  H     + +  +GW 
Sbjct: 119 ALLAGERDPWTVSSEGVHTVDQVLSEVSRVLVPGGRFISMTSAAPHFRTRHYAQAYYGWS 178
Query: 199 M 199
           +
Sbjct: 179 L 179

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query772
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 3e-49
3gjy_A317 Spermidine synthase; APC62791, structural genomics 8e-23
3lcc_A235 Putative methyl chloride transferase; halide methy 8e-14
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 2e-13
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-12
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 3e-12
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-12
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 5e-12
2kw5_A202 SLR1183 protein; structural genomics, northeast st 3e-11
1wzn_A252 SAM-dependent methyltransferase; structural genomi 6e-11
1vlm_A219 SAM-dependent methyltransferase; possible histamin 8e-11
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 2e-10
3hnr_A220 Probable methyltransferase BT9727_4108; structural 2e-10
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 6e-10
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 1e-09
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 2e-09
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 3e-09
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 3e-09
3m70_A286 Tellurite resistance protein TEHB homolog; structu 5e-09
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 6e-09
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 6e-09
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 7e-09
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 7e-09
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 7e-09
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 9e-09
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 2e-08
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 2e-08
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 2e-08
3ege_A261 Putative methyltransferase from antibiotic biosyn 5e-08
3dtn_A234 Putative methyltransferase MM_2633; structural gen 6e-08
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 8e-08
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-07
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 2e-07
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 2e-07
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 3e-07
3f4k_A257 Putative methyltransferase; structural genomics, P 5e-07
3m33_A226 Uncharacterized protein; structural genomics, PSI- 6e-07
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 6e-07
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 9e-07
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 1e-06
1vl5_A260 Unknown conserved protein BH2331; putative methylt 1e-06
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 1e-06
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 2e-06
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 2e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 3e-06
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 4e-06
1xxl_A239 YCGJ protein; structural genomics, protein structu 4e-06
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 5e-06
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 6e-06
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 6e-06
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 2e-05
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3ocj_A305 Putative exported protein; structural genomics, PS 5e-05
2o07_A304 Spermidine synthase; structural genomics, structur 6e-05
3gu3_A284 Methyltransferase; alpha-beta protein, structural 6e-05
1xj5_A334 Spermidine synthase 1; structural genomics, protei 6e-05
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 7e-05
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 1e-04
2i7c_A283 Spermidine synthase; transferase, structural genom 1e-04
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 2e-04
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 2e-04
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 2e-04
2pt6_A321 Spermidine synthase; transferase, structural genom 2e-04
3cc8_A230 Putative methyltransferase; structural genomics, j 3e-04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 3e-04
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 4e-04
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 4e-04
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 5e-04
3dh0_A219 SAM dependent methyltransferase; cystal structure, 5e-04
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
 Score =  171 bits (434), Expect = 3e-49
 Identities = 59/208 (28%), Positives = 93/208 (44%), Gaps = 21/208 (10%)

Query: 24  DFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLS 83
            +   E WD+ +        ++W+ ++   R  L   +      P  +ILV GCGNS LS
Sbjct: 3   GYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPEL-----RPEDRILVLGCGNSALS 57

Query: 84  EHLYDAGFHGITNVDFSKVVISDMLRRNVRDRSDMRWRVMDMTSMQVFMDETFDVILDKG 143
             L+  GF  +T+VD+S VV++ M          +RW  MD+  +  F   +FDV+L+KG
Sbjct: 58  YELFLGGFPNVTSVDYSSVVVAAMQACY-AHVPQLRWETMDVRKLD-FPSASFDVVLEKG 115

Query: 144 GLDALMEPELGHKLG--------NQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRF 195
            LDAL+  E              +Q LSEV R+L  GG+F+ +T A  H     + +  +
Sbjct: 116 TLDALLAGERDPWTVSSEGVHTVDQVLSEVSRVLVPGGRFISMTSAAPHFRTRHYAQAYY 175

Query: 196 GWKMSVHAIPQKSSSEPSLQTFMVVADK 223
           GW +                  + +  K
Sbjct: 176 GWSLRHATY------GSGFHFHLYLMHK 197
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Length = 317 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Length = 235 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Length = 314 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Length = 252 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Length = 304 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Length = 296 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Length = 304 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Length = 334 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Length = 203 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Length = 283 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Length = 314 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Length = 275 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Length = 321 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Length = 281 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Length = 292 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query772
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.93
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 99.9
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.87
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 99.86
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.85
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.83
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.8
2i7c_A283 Spermidine synthase; transferase, structural genom 99.79
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.79
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 99.78
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.77
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.77
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.76
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.71
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.71
2o07_A304 Spermidine synthase; structural genomics, structur 99.71
2pt6_A321 Spermidine synthase; transferase, structural genom 99.68
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.68
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.64
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.64
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.63
3lcc_A235 Putative methyl chloride transferase; halide methy 99.61
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.61
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.61
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.61
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.6
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.59
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.58
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.58
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.58
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.58
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.57
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.57
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.57
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.57
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.56
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.56
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.56
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.56
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.56
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.55
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.55
3f4k_A257 Putative methyltransferase; structural genomics, P 99.55
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.55
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.54
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.54
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.54
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.54
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.53
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.53
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.53
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.53
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.53
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.52
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.52
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.52
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.52
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.52
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.51
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.51
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.51
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.51
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.51
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.51
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.5
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.5
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.5
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.5
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.5
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.49
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.49
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.48
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.48
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.47
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.47
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.47
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.47
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.46
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.46
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.46
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.45
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.45
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.44
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.44
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.43
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.42
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.42
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.42
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.42
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.41
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.41
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.4
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.4
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.4
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.4
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.4
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.39
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.39
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.39
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.38
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.38
3ocj_A305 Putative exported protein; structural genomics, PS 99.38
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.38
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.37
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.37
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.36
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.36
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.36
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.35
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.35
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.35
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.35
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.35
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.35
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.34
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.34
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.34
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.33
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.33
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.33
3cc8_A230 Putative methyltransferase; structural genomics, j 99.32
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.32
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.31
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.3
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.3
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.3
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.3
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.3
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.3
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.29
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.28
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.28
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.28
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.28
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.27
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.27
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.27
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.27
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.27
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.26
3lpm_A259 Putative methyltransferase; structural genomics, p 99.26
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.25
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.25
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.25
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.24
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.24
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.23
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.23
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.23
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.23
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.22
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.22
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.22
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.22
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.21
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.2
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.2
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.2
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.19
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.19
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.19
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.19
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.19
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.19
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.18
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.18
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.18
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.17
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.16
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.15
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.15
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.15
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.15
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.14
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.14
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.14
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.14
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.14
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.13
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.13
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.13
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.13
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.13
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.13
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.12
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.12
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.12
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.12
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.12
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.12
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.12
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.11
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.11
2b25_A336 Hypothetical protein; structural genomics, methyl 99.11
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.11
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.1
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.1
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.1
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.1
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.1
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.1
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.09
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.09
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.09
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.08
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.07
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.07
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.07
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.07
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.07
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.07
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.06
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.06
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.06
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.06
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.05
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.05
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.04
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.04
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.04
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.04
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.04
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.03
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.02
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.02
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.02
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.02
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.02
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.01
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.01
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.0
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.0
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.0
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.0
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.99
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.99
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.99
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.99
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.99
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.99
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.99
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.98
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.98
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.98
2o07_A304 Spermidine synthase; structural genomics, structur 98.98
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.98
2i7c_A283 Spermidine synthase; transferase, structural genom 98.98
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.97
3k6r_A278 Putative transferase PH0793; structural genomics, 98.97
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.97
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.96
2h00_A254 Methyltransferase 10 domain containing protein; st 98.96
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.96
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.96
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.96
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.96
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.96
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.96
2pt6_A321 Spermidine synthase; transferase, structural genom 98.96
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.95
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.95
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.94
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.92
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.92
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.92
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.9
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.9
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.9
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.89
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.88
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.87
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.86
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.86
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.85
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.85
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.85
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.85
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.84
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.84
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.84
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.84
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.83
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.83
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.83
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.83
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.82
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.81
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.8
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.79
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.79
3lpm_A259 Putative methyltransferase; structural genomics, p 98.78
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.76
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.76
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.76
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.74
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.74
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.73
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.73
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.73
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.73
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.72
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.72
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.72
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.71
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.71
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.71
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.71
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.7
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.7
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.69
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.68
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.68
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.67
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.67
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.67
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.66
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.66
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.66
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.65
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.65
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.64
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.64
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.63
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.63
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.63
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.63
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.62
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.62
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.62
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.6
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.6
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.6
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.6
2b25_A336 Hypothetical protein; structural genomics, methyl 98.59
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.59
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.58
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.58
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.57
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.57
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.56
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.56
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.56
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.56
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.55
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.55
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.54
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.54
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.54
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.54
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.54
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.54
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.53
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.53
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.53
3f4k_A257 Putative methyltransferase; structural genomics, P 98.53
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.53
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.53
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.53
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.52
3ocj_A305 Putative exported protein; structural genomics, PS 98.52
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.52
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.52
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.52
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.52
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.52
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.51
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.51
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.51
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.51
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.51
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.5
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.5
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.5
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.49
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.49
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.48
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.48
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.48
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.48
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.48
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.47
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.46
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.46
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.46
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.46
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.45
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.44
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.44
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.44
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.44
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.44
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.44
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.44
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.43
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.43
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.42
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.42
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.42
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.41
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.41
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.41
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.4
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.4
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.4
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.4
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.39
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.39
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.38
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.38
3khk_A544 Type I restriction-modification system methylation 98.38
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.37
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.37
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.37
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.37
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.37
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.37
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.36
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.36
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.36
3lcc_A235 Putative methyl chloride transferase; halide methy 98.36
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.36
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.35
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.34
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.34
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.34
2fyt_A340 Protein arginine N-methyltransferase 3; structural 98.33
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.33
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.33
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.33
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.32
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.32
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.32
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.32
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.32
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.32
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.32
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.32
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 98.31
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.31
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.31
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.31
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.3
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.3
3lkd_A542 Type I restriction-modification system methyltrans 98.3
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.3
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.29
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.29
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.29
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.29
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.29
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.28
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.28
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.28
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.27
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.27
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.26
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.26
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.25
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.25
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.24
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.24
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.24
3cc8_A230 Putative methyltransferase; structural genomics, j 98.24
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.24
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.24
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.22
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.22
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.22
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.22
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.22
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.21
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.21
3k6r_A278 Putative transferase PH0793; structural genomics, 98.21
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.2
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.2
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.2
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.19
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.18
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.18
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.17
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.16
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.15
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.15
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.15
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.14
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.14
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.14
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.13
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 98.12
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.12
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 98.12
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.12
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.11
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.1
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.09
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.09
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.08
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.08
2h00_A254 Methyltransferase 10 domain containing protein; st 98.06
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.06
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
Probab=99.93  E-value=3e-25  Score=238.13  Aligned_cols=182  Identities=20%  Similarity=0.281  Sum_probs=153.0

Q ss_pred             ecCCccchHHHHHHHHHHhhh--hhhhhhhcccCCCCeEEEEcccccHHHHHHHHhCCCCcEEEEEcCHHHHHHHHHhcC
Q 004133          510 VYHGYLASSYHMGIISGFTLI--SSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYFG  587 (772)
Q Consensus       510 ~d~~~L~~~Y~~~m~~~l~l~--~~~~~~~~~~~~~~~vLviGlG~G~l~~~L~~~~p~~~i~~VEiDp~v~~vA~~~Fg  587 (772)
                      -|+.++.+.||+.|+..+.++  .+      ..+++.+||+||+|+|.++++|.+.+|..+|++|||||.|+++|+++|+
T Consensus        61 ~dP~~le~~Y~e~m~~~~~~l~~~~------p~p~~~rVLdIG~G~G~la~~la~~~p~~~v~~VEidp~vi~~Ar~~~~  134 (317)
T 3gjy_A           61 GQPQALEFEYMRWIATGARAFIDAH------QDASKLRITHLGGGACTMARYFADVYPQSRNTVVELDAELARLSREWFD  134 (317)
T ss_dssp             TCTTCCCSHHHHHHHHHHHHHHHHH------SCGGGCEEEEESCGGGHHHHHHHHHSTTCEEEEEESCHHHHHHHHHHSC
T ss_pred             CCCcchhhHHHHHHHHHHHhhcccC------CCCCCCEEEEEECCcCHHHHHHHHHCCCcEEEEEECCHHHHHHHHHhcc
Confidence            357889999999999876652  12      1123449999999999999999998899999999999999999999999


Q ss_pred             CCCCCCeEEEEccHHHHHHhhcccCcccccccccccccccCCCCCCCCCCCCCCCceeEEEEeCCCCCCCCCCCcCCcCC
Q 004133          588 FTQDKSLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADF  667 (772)
Q Consensus       588 ~~~~~rl~v~i~Dg~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~IivD~~~~d~~~g~s~Pp~~f  667 (772)
                      +..++|++++++||++|++...                               ..+||+||+|++....      ++..+
T Consensus       135 ~~~~~rv~v~~~Da~~~l~~~~-------------------------------~~~fDvIi~D~~~~~~------~~~~L  177 (317)
T 3gjy_A          135 IPRAPRVKIRVDDARMVAESFT-------------------------------PASRDVIIRDVFAGAI------TPQNF  177 (317)
T ss_dssp             CCCTTTEEEEESCHHHHHHTCC-------------------------------TTCEEEEEECCSTTSC------CCGGG
T ss_pred             ccCCCceEEEECcHHHHHhhcc-------------------------------CCCCCEEEECCCCccc------cchhh
Confidence            8778999999999999997653                               3679999999876631      46889


Q ss_pred             CcHHHHHHHHHccCCCcEEEEEecCCC-hhHHHHHHHHHHHhccceEEEeec------CCceEEEEEecCCCcC
Q 004133          668 VEGSFLLTVKDALSEQGLFIVNLVSRS-QATKDMVISRMKMVFNHLFCLQLE------EDVNLVLFGLSSESCI  734 (772)
Q Consensus       668 ~~~~fl~~~~~~L~~~Gilv~Nl~~~~-~~~~~~v~~~l~~vF~~v~~~~~~------~~~N~vl~a~~~~~~~  734 (772)
                      ++.+||+.++++|+|||+|++|+.+.. ......++.+|+++|+++..+...      +..|.|++|++.+...
T Consensus       178 ~t~efl~~~~r~LkpgGvlv~~~~~~~~~~~~~~~~~tL~~vF~~v~~~~~~~~~~g~~~gN~Vl~As~~plp~  251 (317)
T 3gjy_A          178 TTVEFFEHCHRGLAPGGLYVANCGDHSDLRGAKSELAGMMEVFEHVAVIADPPMLKGRRYGNIILMGSDTEFFS  251 (317)
T ss_dssp             SBHHHHHHHHHHEEEEEEEEEEEEECTTCHHHHHHHHHHHHHCSEEEEEECHHHHTTSSCEEEEEEEESSCCCC
T ss_pred             hHHHHHHHHHHhcCCCcEEEEEecCCcchHHHHHHHHHHHHHCCceEEEEecCCCCCCcCceEEEEEECCCCCc
Confidence            999999999999999999999997543 355678899999999999888642      5689999999887544
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 772
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 4e-08
d2bzga1229 c.66.1.36 (A:17-245) Thiopurine S-methyltransferas 1e-06
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 2e-06
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 4e-06
d1p91a_268 c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher 1e-05
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 2e-05
d2b2ca1312 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhab 2e-05
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 3e-05
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 5e-05
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 1e-04
d1ve3a1226 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {A 1e-04
d1zx0a1229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 1e-04
d2a14a1257 c.66.1.15 (A:5-261) Indolethylamine N-methyltransf 2e-04
d1xtpa_254 c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa 3e-04
d2o07a1285 c.66.1.17 (A:16-300) Spermidine synthase {Human (H 6e-04
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.001
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 0.002
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 0.003
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Glycine N-methyltransferase
domain: Glycine N-methyltransferase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 53.4 bits (127), Expect = 4e-08
 Identities = 37/226 (16%), Positives = 66/226 (29%), Gaps = 25/226 (11%)

Query: 24  DFTSKENWDKFFTIRGIGDSFEWYAEWPQLRDPLISLIGAPTSSPPPQILVPGCGNSRLS 83
           D  +   W  +     IGD+    AE+   +  L+ L+         ++L   CG    S
Sbjct: 23  DGEAARVWQLY-----IGDTRSRTAEY---KAWLLGLLRQH---GCHRVLDVACGTGVDS 71

Query: 84  EHLYDAGFH---GITNVDFSKVVISDMLRRNVRDRSDM----RWRVMDMTSMQVFMDETF 136
             L + GF       +    K  + +   R      D         + +       D   
Sbjct: 72  IMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFD 131

Query: 137 DVILDKGGLDALMEPELGHKLGNQYLSEVKRLLKSGGKFVCLTLAESHVLGLLFPKFRFG 196
            VI        L + +         L  +  +++ GG  V       ++L         G
Sbjct: 132 AVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYIL-------STG 184

Query: 197 WKMSVHAIPQKSSSEPSLQTFMVVADKENSSVVLQVTSSFDHSSLD 242
                  I  KS     + T ++  + +   V L  T     +  D
Sbjct: 185 CAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRD 230
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 226 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Length = 254 Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query772
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 99.93
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 99.92
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 99.92
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 99.92
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 99.91
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 99.91
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 99.91
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.8
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.77
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.74
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.71
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.71
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.7
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.68
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.68
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.67
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.67
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.66
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.64
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.63
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.61
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.6
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.59
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.58
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.58
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.56
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.53
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.52
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.48
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.48
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.48
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.46
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.45
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.43
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.43
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.42
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.4
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.39
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.33
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.33
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.32
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.31
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.3
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.3
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.3
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.25
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.24
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.21
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.21
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.2
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.19
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.17
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.16
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.12
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.09
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.08
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.07
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.05
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.05
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.04
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.01
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.0
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.96
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.96
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.95
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.94
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.92
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.9
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.9
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.9
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.89
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.86
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.85
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.84
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.81
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.81
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.8
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.78
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.77
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.77
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.74
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.74
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.73
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.72
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.72
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.69
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.67
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.67
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.67
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.65
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.65
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.64
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.63
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.63
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.62
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.62
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.62
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.6
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.59
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.59
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.58
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.55
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.55
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.54
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.54
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.53
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.53
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.52
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.51
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.51
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.51
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.51
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.48
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.48
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.48
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.46
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.45
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.44
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.43
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.43
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.42
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.38
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.36
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.34
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.33
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.32
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.32
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.32
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.3
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.28
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.28
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.27
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.26
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.26
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.25
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.24
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.24
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.24
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.23
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.2
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.2
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.18
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.18
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.17
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.16
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.16
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.15
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.08
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.07
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.07
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.03
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.01
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.01
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.0
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.95
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.92
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.9
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.86
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.81
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.78
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.78
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.77
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 97.7
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.56
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.56
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.46
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.45
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.44
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.44
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.4
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.4
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.39
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.39
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.37
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.37
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.34
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.25
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.24
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.21
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.14
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.0
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 96.99
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 96.95
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.94
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.92
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 96.88
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 96.85
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.79
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 96.58
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.58
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.44
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.42
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.41
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 96.33
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.32
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 96.27
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.27
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.16
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.07
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.94
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 95.91
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 95.86
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 95.85
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.8
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.73
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.46
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.42
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.41
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.3
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.25
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.21
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.07
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.0
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.93
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.92
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.85
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.54
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 94.51
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.49
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.98
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.95
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.86
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 93.77
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.69
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.69
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.58
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.52
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.88
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 92.72
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.71
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.06
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 91.9
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.78
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 91.62
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.61
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.51
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.11
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.88
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.6
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.36
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 89.9
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 89.66
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.42
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.39
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.06
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 88.51
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 88.42
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 88.31
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.18
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 88.08
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 88.05
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 87.86
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 87.67
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 87.38
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.1
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 87.1
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 86.98
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 86.73
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 86.61
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 86.38
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 86.21
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 85.91
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 85.55
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 85.32
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 85.12
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 85.12
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.76
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 84.75
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.43
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 84.06
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 84.06
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 83.73
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 83.72
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 83.69
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 83.16
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 83.15
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 83.03
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 82.96
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 82.85
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 82.77
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.58
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 82.53
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 82.46
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 82.15
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 81.66
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 81.56
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 81.54
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 81.29
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 81.07
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 80.81
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 80.05
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Spermidine synthase
domain: Spermidine synthase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=6.8e-25  Score=230.03  Aligned_cols=168  Identities=18%  Similarity=0.267  Sum_probs=132.2

Q ss_pred             hHHHHHHHHHHhhhhhhhhhhcccCCCCeEEEEcccccHHHHHHHHhCCCCcEEEEEcCHHHHHHHHHhc----CCCCCC
Q 004133          517 SSYHMGIISGFTLISSYLESVASVGKSVKAVVIGLGAGLLPMFLHECMPFVGIEAVELDLTMLNLAEDYF----GFTQDK  592 (772)
Q Consensus       517 ~~Y~~~m~~~l~l~~~~~~~~~~~~~~~~vLviGlG~G~l~~~L~~~~p~~~i~~VEiDp~v~~vA~~~F----g~~~~~  592 (772)
                      ..||. |++++++..+        +.|++|||||+|+|++++.+.++.+..+|++|||||.|+++|++||    +..+++
T Consensus        62 ~~Yhe-~l~h~~l~~~--------~~pk~vLiiGgG~G~~~~~~l~~~~~~~v~~vEiD~~Vv~~a~~~~~~~~~~~~d~  132 (285)
T d2o07a1          62 FSYQE-MIANLPLCSH--------PNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSS  132 (285)
T ss_dssp             HHHHH-HHHHHHHTTS--------SSCCEEEEEECTTSHHHHHHTTCTTCCEEEEEESCHHHHHHHHHHCHHHHGGGGCT
T ss_pred             HHHHH-HhccHhhhhC--------cCcCeEEEeCCCchHHHHHHHHcCCcceeeeccCCHHHHHHHHhhchhhccccCCC
Confidence            56886 4555666554        7889999999999999999999988889999999999999999999    334689


Q ss_pred             CeEEEEccHHHHHHhhcccCcccccccccccccccCCCCCCCCCCCCCCCceeEEEEeCCCCCCCCCCCcCCcCCCcHHH
Q 004133          593 SLKVHITDGIKFVREMKSSSATDEMSVVHGNEITSNNTRSCNGNCTASNARVDILIIDVDSPDSSSGMTCPAADFVEGSF  672 (772)
Q Consensus       593 rl~v~i~Dg~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~IivD~~~~d~~~g~s~Pp~~f~~~~f  672 (772)
                      |++++++||++||++..                                .+||+||+|+.++..      |+..+++.+|
T Consensus       133 rv~i~~~Da~~~l~~~~--------------------------------~~yDvIi~D~~~p~~------~~~~L~t~eF  174 (285)
T d2o07a1         133 KLTLHVGDGFEFMKQNQ--------------------------------DAFDVIITDSSDPMG------PAESLFKESY  174 (285)
T ss_dssp             TEEEEESCHHHHHHTCS--------------------------------SCEEEEEEECC-----------------CHH
T ss_pred             CceEEEccHHHHHhcCC--------------------------------CCCCEEEEcCCCCCC------cccccccHHH
Confidence            99999999999998743                                679999999976531      5789999999


Q ss_pred             HHHHHHccCCCcEEEEEecCC--ChhHHHHHHHHHHHhccceEEEe--ecC---CceEEEEEecCC
Q 004133          673 LLTVKDALSEQGLFIVNLVSR--SQATKDMVISRMKMVFNHLFCLQ--LEE---DVNLVLFGLSSE  731 (772)
Q Consensus       673 l~~~~~~L~~~Gilv~Nl~~~--~~~~~~~v~~~l~~vF~~v~~~~--~~~---~~N~vl~a~~~~  731 (772)
                      ++.++++|+|+|++++|..+.  .......+.++++++|+++..+.  ++.   +...+++|++.+
T Consensus       175 ~~~~~~~L~~~Gi~v~q~~s~~~~~~~~~~~~~tl~~~F~~v~~y~~~vP~~~~g~w~f~~aSk~p  240 (285)
T d2o07a1         175 YQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP  240 (285)
T ss_dssp             HHHHHHHEEEEEEEEEEEECTTTCHHHHHHHHHHHHHHCSEEEEEEEECTTSGGGEEEEEEEESST
T ss_pred             HHHHHHhcCCCCeEEEeccchhhhHHHHHHHHHHHHhcCCeeeEEeeeeeecCCCCeEEEEEECCc
Confidence            999999999999999998664  45667788999999999976654  332   234678898875
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure