Citrus Sinensis ID: 004160


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-
MAFSARFSSNHLHLNPNPKVHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNLEILESDLQAVLAALKKKEEDLEDAERRVCLEHSELNRAKEELLRREREIDVACSRHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEKLKVVEANLEKRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSSQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMPTDDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAKEKELKKLEETVEDANDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGIVDGQIS
cccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccccccccccccccEEEEcccccEEEccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
mafsarfssnhlhlnpnpkvhwkhklpgryvtsgkrRVRSLGLVravlpdgkkssvngyglgePARILLERLFAQTQKLEERmsrdsgvgkdvqfGLNLEILESDLQAVLAALKKKEEDLEDAERRVCLEHSELNRAKEELLRREREIDVACSRHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEKLKVVEANLEKRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSSQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELgrkntefgetenllrvKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNEldgtklkvsEAETVVEQIVDLTHKLVIsnkndesstsmptddMGLELMQQGLdkgndnfrLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAKEKELKKLEETVEDANDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLNKASlsietdtdntifpesrfdprisvienneclteVGSEVARLSVLTEQLVKEagivdgqis
mafsarfssnhlhlnpnpkvhwkhklpgryvtsgkrrvrslglvravlpdgkkssvngyglGEPARILLERLFAQTQKLEermsrdsgvgkDVQFGLNLEILESDLQAVLAALKKKEEDLEDAErrvclehselnrakeellrrEREIDVACSRHEKLeeelgqsnlklvsqARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASvalrkveeekLKVVEAnlekrtmewllSQDALKKLAEEASRrmeetndtledfRRVKKLLSDVRSELVSsqkslassrKQMEEQEHLLGKQLVELEEQKKSLTSYMTSlkdaqveveservklrvtearnkelerdlsmEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGrkntefgetenllrvKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHklvisnkndesstsmpTDDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAkraltvkdeelktvlgrldakekelkkleetvedanDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVlteqlvkeagivdgqis
MAFSARFSSNHLHLNPNPKVHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNLEILESdlqavlaalkkkeedledaeRRVCLEHSelnrakeellrrereIDVACSRHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQsalslkelelekmrsellkkseeAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASvalrkveeeklkvveanlekRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSSQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMPTDDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAkekelkkleeTVEDANDLRKLYALAQERFGEKSVGDlaierlqleaaqleveaaTSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGIVDGQIS
*******************VHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQ**************GKDVQFGLNLEILESDLQAVLAAL******************************************************************************************************************************************************************VV***L**RTMEWLL****************************************************************************************************************************************************************************************LI************************************************HVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVI*************************************QLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLG********************DLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVE******************************TIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGI******
***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
********SNHLHLNPNPKVHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNLEILESDLQAVLAALKKKEEDLEDAERRVCLEHSELNRAKEELLRREREIDVACSRHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEKLKVVEANLEKRTMEWLLSQDALKKLAE***********TLEDFRRVKKLLSDV********************QEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNK********PTDDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAKEKELKKLEETVEDANDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGIVDGQIS
************HLNPNPKVHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNLEILESDLQAVLAALKKKEEDLEDAERRVCLEHSELNRAKEELLRREREIDVACSRHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEKLKVVEANLEKRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSSQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMPTDDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAKEKELKKLEETVEDANDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSARFSSNHLHLNPNPKVHWKHKLPGRYVTSGKRRVRSLGLVRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNxxxxxxxxxxxxxxxxxxxxxxxxxxxxVCLEHSELNRAKEExxxxxxxxxxxxxxxxxxxxxLGQSNLKLVSQARHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKVVEANLEKRTMEWLLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKLLSDVRSELVSSQKSLASSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGETENLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVQAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMPTDDMGLELMQQGLDKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLAAKRALTVKDEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGEKSVGDLAxxxxxxxxxxxxxxxxxxxxxxxxxxSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGIVDGQIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
225430316774 PREDICTED: uncharacterized protein LOC10 0.987 0.983 0.648 0.0
255548884776 Ubiquitin-protein ligase BRE1A, putative 0.994 0.988 0.634 0.0
224092500716 predicted protein [Populus trichocarpa] 0.922 0.993 0.687 0.0
356562046764 PREDICTED: uncharacterized protein LOC10 0.977 0.986 0.570 0.0
449525716769 PREDICTED: uncharacterized LOC101208859 0.949 0.951 0.586 0.0
449437152777 PREDICTED: uncharacterized protein LOC10 0.949 0.942 0.586 0.0
357437005755 hypothetical protein MTR_1g012620 [Medic 0.950 0.970 0.528 0.0
18417960783 Myosin heavy chain-related protein [Arab 0.980 0.965 0.531 0.0
13430502783 unknown protein [Arabidopsis thaliana] 0.980 0.965 0.531 0.0
2864624764 putative protein [Arabidopsis thaliana] 0.946 0.955 0.552 0.0
>gi|225430316|ref|XP_002282750.1| PREDICTED: uncharacterized protein LOC100262916 [Vitis vinifera] gi|296082052|emb|CBI21057.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/779 (64%), Positives = 628/779 (80%), Gaps = 18/779 (2%)

Query: 1   MAFSARFSSNHLHLNPNPKVHW----------KHKLPGRYVTSGKRRVRSLGLVRAVLPD 50
           MAF+A F     H+ P    H+          K K     +T+ KR+  S  +V++VL +
Sbjct: 1   MAFAAVF-----HVPPTSSHHYSQLCSLGLNRKQKRLA-VMTTSKRKGHSRRIVKSVL-N 53

Query: 51  GKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQFGLNLEILESDLQAVL 110
            +KSS+N  G  EPAR+LLERLFAQTQKLEE MSRD G+  D+Q GLNLE LESDLQA L
Sbjct: 54  NRKSSINDNGSTEPARVLLERLFAQTQKLEEHMSRDPGLPLDIQLGLNLETLESDLQAAL 113

Query: 111 AALKKKEEDLEDAERRVCLEHSELNRAKEELLRREREIDVACSRHEKLEEELGQSNLKLV 170
            ALKKKEEDL+DA   V +EH+ELNRAKEEL R   EI VACS+HEKLEEEL Q+NL L 
Sbjct: 114 VALKKKEEDLQDAAGMVLMEHTELNRAKEELKRHAEEIAVACSKHEKLEEELKQANLNLA 173

Query: 171 SQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLKKSEEAAKIDSELKSKAQ 230
           S+AR IEDLKL+LK+RDQEI A +SALS K+ E++KMR+EL+KK+EEAAK +SEL+S A+
Sbjct: 174 SRARQIEDLKLQLKDRDQEIFAARSALSSKQDEMDKMRNELMKKTEEAAKKESELQSMAK 233

Query: 231 MLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEKLKVVEANLEKRTMEWLL 290
           +L+EANEVVKKQE E+Q L+K IQEKEEELE S+ LRK+EE+KLKV EANLEK+TM+WLL
Sbjct: 234 LLDEANEVVKKQEIELQELQKSIQEKEEELEESMMLRKLEEKKLKVAEANLEKKTMDWLL 293

Query: 291 SQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSSQKSLASSRKQMEEQEHL 350
           +++ LKKLAE+A++ M E+N T+++FRR K+LL DVRSELVSSQKSLASSR++M+EQE L
Sbjct: 294 AKEELKKLAEDAAKHMGESNKTMKEFRRAKRLLHDVRSELVSSQKSLASSRQKMQEQEKL 353

Query: 351 LGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEEL 410
           L KQL ELEEQK S+  YMTSLKDAQ+EVESERVKLRV E+RNKELE DLS++KEL+EEL
Sbjct: 354 LEKQLAELEEQKTSINHYMTSLKDAQIEVESERVKLRVAESRNKELEWDLSVKKELMEEL 413

Query: 411 QNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQNLKSKQ 470
           Q EL KEK SLQQ I E S LQ+EL +K TEFGE  NLL+VKES+LVEA+LEIQ+LKS+Q
Sbjct: 414 QEELRKEKSSLQQVIQETSFLQKELDQKTTEFGELHNLLQVKESELVEARLEIQHLKSEQ 473

Query: 471 ASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLVQAMDTLQEKDEHVLILQ 530
            SLQLIL+E+D EL NA++ LEE+N EV ELKM+M++RE+QL+QA   L+EK+EH+LI+Q
Sbjct: 474 VSLQLILKERDLELFNAQKKLEEVNQEVSELKMLMNNREDQLMQATTLLKEKEEHLLIMQ 533

Query: 531 NELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMPTDDMGLELMQQGLDKGNDN 590
           +EL+ TKLK SEAE+VVE+IVDLT+KLVI  K++E + + P DDMG  L+ Q  +K  D+
Sbjct: 534 HELNDTKLKFSEAESVVERIVDLTNKLVICTKDEECTATSPFDDMGQNLLHQLFEKPTDD 593

Query: 591 FRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVLGRLDAKEKELKKL-EE 649
           F+ Q K+LE EL+  RE+LR KE+EVLAA+RALT+KDEELK  L RLDA+EKEL+++ EE
Sbjct: 594 FKRQEKRLETELELTRESLRTKELEVLAAQRALTIKDEELKIALERLDAREKELRRMKEE 653

Query: 650 TVEDANDLRKLYALAQERFGEKSVGDLAIERLQLEAAQLEVEAATSALQKLTEMSGELLN 709
           T+EDAN L+ LYALAQER GEKSVGDLAIE+LQLEAAQLEVEAATSAL KL EMS ELL+
Sbjct: 654 TMEDANHLKNLYALAQERIGEKSVGDLAIEKLQLEAAQLEVEAATSALHKLAEMSCELLH 713

Query: 710 KASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVARLSVLTEQLVKEAGIVDG 768
             SLS++++TD  IF  + FDP +S+ ENNE  T+V +EVARLS +T+QLV+EAG+V  
Sbjct: 714 NVSLSVDSETDTAIFLPNGFDPWLSMHENNEHFTKVKTEVARLSAITDQLVQEAGVVGA 772




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255548884|ref|XP_002515498.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] gi|223545442|gb|EEF46947.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224092500|ref|XP_002309636.1| predicted protein [Populus trichocarpa] gi|222855612|gb|EEE93159.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356562046|ref|XP_003549286.1| PREDICTED: uncharacterized protein LOC100789623 [Glycine max] Back     alignment and taxonomy information
>gi|449525716|ref|XP_004169862.1| PREDICTED: uncharacterized LOC101208859 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437152|ref|XP_004136356.1| PREDICTED: uncharacterized protein LOC101208859 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357437005|ref|XP_003588778.1| hypothetical protein MTR_1g012620 [Medicago truncatula] gi|355477826|gb|AES59029.1| hypothetical protein MTR_1g012620 [Medicago truncatula] Back     alignment and taxonomy information
>gi|18417960|ref|NP_567889.1| Myosin heavy chain-related protein [Arabidopsis thaliana] gi|23297608|gb|AAN12990.1| unknown protein [Arabidopsis thaliana] gi|332660618|gb|AEE86018.1| Myosin heavy chain-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13430502|gb|AAK25873.1|AF360163_1 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2864624|emb|CAA16971.1| putative protein [Arabidopsis thaliana] gi|7270123|emb|CAB79937.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
TAIR|locus:2116500783 AT4G32190 "AT4G32190" [Arabido 0.942 0.928 0.453 2e-152
DICTYBASE|DDB_G02869851024 zipA "zipper-like domain-conta 0.599 0.451 0.212 7.9e-19
ZFIN|ZDB-GENE-030131-731 904 hmmr "hyaluronan-mediated moti 0.630 0.537 0.227 2.1e-16
UNIPROTKB|P93203697 MFP1 "MAR-binding filament-lik 0.605 0.670 0.215 7.7e-16
TAIR|locus:2181241 1181 AT5G27220 "AT5G27220" [Arabido 0.609 0.397 0.221 1.6e-14
WB|WBGene00010306 1133 F59A2.6 [Caenorhabditis elegan 0.647 0.440 0.212 4.2e-14
UNIPROTKB|E2R200 2684 CENPE "Uncharacterized protein 0.608 0.174 0.209 4.5e-14
UNIPROTKB|E1BRE51411 EEA1 "Uncharacterized protein" 0.609 0.333 0.209 5.6e-14
SGD|S0000022161790 USO1 "Protein involved in the 0.651 0.280 0.204 7.5e-14
UNIPROTKB|F1SQ111411 EEA1 "Uncharacterized protein" 0.526 0.287 0.216 2.5e-13
TAIR|locus:2116500 AT4G32190 "AT4G32190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1487 (528.5 bits), Expect = 2.0e-152, P = 2.0e-152
 Identities = 334/737 (45%), Positives = 473/737 (64%)

Query:    36 RRVRSLGL-VRAVLPDGKKSSVNGYGLGEPARILLERLFAQTQKLEERMSRDSGVGKDVQ 94
             RR R L L V++VL +  + ++N  G  E A +L ++LFA+T +LE + ++ S    D  
Sbjct:    43 RRKRHLLLSVQSVLHN-TRPNINDNGSAESANVLFDKLFARTHRLERQTNQHSVYPDDDD 101

Query:    95 FGL-NLEILESXXXXXXXXXXXXXXXXXXXXRRVCLEHSXXXXXXXXXXXXXXXIDVACS 153
                 NL +LES                    R++  + +               I  A  
Sbjct:   102 LPYSNLGVLESDLEAALVALLKREEDLHDAERKLLSDKNKLNRAKEELEKREKTISEASL 161

Query:   154 RHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQXXXXXXXXXXXXXXXXXXX 213
             +HE L+EEL ++N++L SQAR IE+LK +L+ERD+E AA+Q                   
Sbjct:   162 KHESLQEELKRANVELASQAREIEELKHKLRERDEERAALQSSLTLKEEELEKMRQEIAN 221

Query:   214 XXXXAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASXXXXXXXXXX 273
                  +   SE +SK+Q+L++ANEVVK+QE EI +L++ ++EKEEELE S          
Sbjct:   222 RSKEVSMAISEFESKSQLLSKANEVVKRQEGEIYALQRALEEKEEELEISKATKKLEQEK 281

Query:   274 XXXXXXXXXXRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRVKKLLSDVRSELVSS 333
                       +T EWL++QD + KL EE  +R+ E N+T+EDF +VKKLL+DVR EL+SS
Sbjct:   282 LRETEANLKKQTEEWLIAQDEVNKLKEETVKRLGEANETMEDFMKVKKLLTDVRFELISS 341

Query:   334 QKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEARN 393
             +++L  SR+QMEE+E LL KQL ELEEQ+KS+ SYM SL+DA  EVESERVKLRV EA+N
Sbjct:   342 REALVFSREQMEEKELLLEKQLEELEEQRKSVLSYMQSLRDAHTEVESERVKLRVVEAKN 401

Query:   394 KELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKE 453
               LER++S++KEL+E+L+ EL KEK  L+ A+ ++S +Q+EL +K   F  ++NLL+ KE
Sbjct:   402 FALEREISVQKELLEDLREELQKEKPLLELAMHDISVIQDELYKKANAFQVSQNLLQEKE 461

Query:   454 SDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVRELKMIMSSREEQLV 513
             S LVEAKLEIQ+LKS+QASL+L+L+EKD EL+ AR  L E+N EV ELK +M SRE+QL+
Sbjct:   462 SSLVEAKLEIQHLKSEQASLELLLQEKDEELAEARNKLGEVNQEVTELKALMISREDQLM 521

Query:   514 QAMDTLQEKDEHVLILQNELDGTKLKVSEAETVVEQIVDLTHKLVISNKNDESSTSMP-T 572
             +A + L+EKD H+  ++ EL  +KLKV+EAE VVE+I +LT++L++S  N ++  +M   
Sbjct:   522 EATEMLKEKDVHLHRIEGELGSSKLKVTEAEMVVERIAELTNRLLMSTTNGQNQNAMRIN 581

Query:   573 DDMGLELMQQGLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKT 632
             +++ ++ MQQ L+K +D++ ++ K+L +EL F RENLRMKEMEVLA +RALT KDEE+  
Sbjct:   582 NEISIDSMQQPLEKPHDDYGMENKRLVMELSFTRENLRMKEMEVLAVQRALTFKDEEINV 641

Query:   633 VLGRLDAXXXXXXXXXX-TVEDANDLRKLYALAQERFGEKSVGDXXXXXXXXXXXXXXXX 691
             V+GRL+A           T+ D+ DL+ LYALAQER GEK++GD                
Sbjct:   642 VMGRLEAKEQELKKLKEETINDSEDLKVLYALAQERVGEKTMGDLAIEMLQLEAANLEVE 701

Query:   692 XXTSALQKLTEMSGELLNKASLSIETDTDNTIFPESRFDPRISVIENNECLTEVGSEVAR 751
               TSALQKL +MS ELL +A +SIE DT +T+ PE  +        +NECL EV +EV R
Sbjct:   702 AATSALQKLAKMSTELLTQADMSIEADTTHTVMPERGYSEG-----SNECLGEVKTEVVR 756

Query:   752 LSVLTEQLVKEAGIVDG 768
             L  LTE+L++ AGIV G
Sbjct:   757 LWSLTEKLLENAGIVAG 773




GO:0000302 "response to reactive oxygen species" evidence=RCA
GO:0010039 "response to iron ion" evidence=RCA
GO:0055072 "iron ion homeostasis" evidence=RCA
DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-731 hmmr "hyaluronan-mediated motility receptor (RHAMM)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P93203 MFP1 "MAR-binding filament-like protein 1" [Solanum lycopersicum (taxid:4081)] Back     alignment and assigned GO terms
TAIR|locus:2181241 AT5G27220 "AT5G27220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00010306 F59A2.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2R200 CENPE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BRE5 EEA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000002216 USO1 "Protein involved in the ER to Golgi transport step of secretion" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQ11 EEA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-12
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-12
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-12
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-12
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-12
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-12
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-12
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-11
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-11
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-10
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 2e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-10
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-10
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-09
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-09
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-07
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 3e-07
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-07
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 6e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-07
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-06
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 3e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-05
COG1269 660 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su 4e-05
pfam05911767 pfam05911, DUF869, Plant protein of unknown functi 5e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-05
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 8e-05
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 1e-04
TIGR03185650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 1e-04
COG3096 1480 COG3096, MukB, Uncharacterized protein involved in 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 2e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-04
TIGR006181042 TIGR00618, sbcc, exonuclease SbcC 6e-04
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 0.002
pfam07888546 pfam07888, CALCOCO1, Calcium binding and coiled-co 0.002
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.003
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
 Score = 71.2 bits (175), Expect = 1e-12
 Identities = 68/301 (22%), Positives = 131/301 (43%), Gaps = 4/301 (1%)

Query: 154 RHEKLEEELGQSNLKLVSQARHIEDLKLRLKERDQEIAAMQSALSLKELELEKMRSELLK 213
           + E  E EL    L+L      +E+L+  LKE ++E+  + + L   E +LE++R E+ +
Sbjct: 219 KAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSE 278

Query: 214 KSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEELEASVALRKVEEEK 273
             EE  ++  EL + A  ++   +  +     + +L + ++E E +LE   +      E+
Sbjct: 279 LEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEE 338

Query: 274 LKVVEANLEKRTMEWLLSQDALKKLAEEASRRMEETNDTLED-FRRVKKLLSDVRSELVS 332
           L  +E  LE    E L S +A  +  E     +E   + LE+    ++  ++ +  ++ S
Sbjct: 339 LAELEEKLE-ELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIAS 397

Query: 333 SQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEVESERVKLRVTEAR 392
               +     ++E  E    +   E+EE  K L      LK+ Q E+E    +L   +  
Sbjct: 398 LNNEIERLEARLERLEDRRERLQQEIEELLKKLEE--AELKELQAELEELEEELEELQEE 455

Query: 393 NKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVK 452
            + LE  L   +E +EE +  L+  +  L Q    + SL+             + LL+ +
Sbjct: 456 LERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKALLKNQ 515

Query: 453 E 453
            
Sbjct: 516 S 516


SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|218806 pfam05911, DUF869, Plant protein of unknown function (DUF869) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information
>gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 771
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.65
PRK02224880 chromosome segregation protein; Provisional 99.64
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.61
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.56
PRK02224880 chromosome segregation protein; Provisional 99.54
PRK03918880 chromosome segregation protein; Provisional 99.52
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.45
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.45
PRK03918880 chromosome segregation protein; Provisional 99.45
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.4
PF10174775 Cast: RIM-binding protein of the cytomatrix active 99.39
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 99.37
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 99.34
PRK01156 895 chromosome segregation protein; Provisional 99.3
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.28
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 99.16
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 99.0
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.85
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.83
PRK01156895 chromosome segregation protein; Provisional 98.71
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.59
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.45
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 98.39
PF00038312 Filament: Intermediate filament protein; InterPro: 98.32
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.31
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.3
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.26
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.25
PRK04863 1486 mukB cell division protein MukB; Provisional 98.23
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 98.22
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.13
PF00038312 Filament: Intermediate filament protein; InterPro: 98.11
PRK04863 1486 mukB cell division protein MukB; Provisional 98.11
PHA02562562 46 endonuclease subunit; Provisional 98.08
PHA02562562 46 endonuclease subunit; Provisional 98.02
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.97
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.91
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.9
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.88
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 97.88
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.88
KOG0964 1200 consensus Structural maintenance of chromosome pro 97.81
PRK04778569 septation ring formation regulator EzrA; Provision 97.77
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.76
PRK04778569 septation ring formation regulator EzrA; Provision 97.75
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 97.74
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.72
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.71
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.7
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 97.67
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.67
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.63
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.54
PRK11637428 AmiB activator; Provisional 97.5
PRK11637428 AmiB activator; Provisional 97.44
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.37
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.37
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.35
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.26
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.26
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.23
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 97.15
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.14
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 97.1
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 97.03
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.03
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.95
PRK11281 1113 hypothetical protein; Provisional 96.92
PRK09039343 hypothetical protein; Validated 96.91
KOG0018 1141 consensus Structural maintenance of chromosome pro 96.9
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.89
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.85
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.79
PRK09039343 hypothetical protein; Validated 96.75
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.72
PRK10929 1109 putative mechanosensitive channel protein; Provisi 96.69
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.61
KOG0963 629 consensus Transcription factor/CCAAT displacement 96.61
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.59
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.49
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.47
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.41
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.4
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.34
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.27
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.23
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.02
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 95.96
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.92
COG3883265 Uncharacterized protein conserved in bacteria [Fun 95.87
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 95.71
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.69
PRK102461047 exonuclease subunit SbcC; Provisional 95.67
COG3883265 Uncharacterized protein conserved in bacteria [Fun 95.66
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.59
KOG4673 961 consensus Transcription factor TMF, TATA element m 95.53
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 95.51
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 95.45
KOG0979 1072 consensus Structural maintenance of chromosome pro 95.44
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.41
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.39
KOG1003205 consensus Actin filament-coating protein tropomyos 95.38
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 95.38
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 95.34
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 95.26
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.22
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.22
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.12
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.88
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.85
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 94.85
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.69
PF05010207 TACC: Transforming acidic coiled-coil-containing p 94.67
COG4942420 Membrane-bound metallopeptidase [Cell division and 94.62
PF05911769 DUF869: Plant protein of unknown function (DUF869) 94.53
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.49
TIGR00634563 recN DNA repair protein RecN. All proteins in this 94.46
PRK102461047 exonuclease subunit SbcC; Provisional 94.34
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.15
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 94.14
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 94.12
PF05010207 TACC: Transforming acidic coiled-coil-containing p 94.1
PF10186302 Atg14: UV radiation resistance protein and autopha 94.02
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.01
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 94.01
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.9
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 93.9
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.85
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.78
PRK11281 1113 hypothetical protein; Provisional 93.53
COG4942420 Membrane-bound metallopeptidase [Cell division and 93.51
PF05911769 DUF869: Plant protein of unknown function (DUF869) 93.22
KOG0018 1141 consensus Structural maintenance of chromosome pro 93.21
COG4372499 Uncharacterized protein conserved in bacteria with 93.13
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 93.02
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 93.0
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 92.99
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.76
PF10186302 Atg14: UV radiation resistance protein and autopha 92.54
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 92.41
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.34
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 92.32
PRK10929 1109 putative mechanosensitive channel protein; Provisi 92.13
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 92.09
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 91.97
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 91.42
TIGR00634563 recN DNA repair protein RecN. All proteins in this 91.32
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 91.29
COG4372499 Uncharacterized protein conserved in bacteria with 91.21
KOG0964 1200 consensus Structural maintenance of chromosome pro 91.15
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 90.98
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 90.85
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 90.6
PF13851201 GAS: Growth-arrest specific micro-tubule binding 90.6
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 90.6
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 90.53
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 90.36
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 89.93
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.77
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 89.62
KOG4677554 consensus Golgi integral membrane protein [Intrace 89.6
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 89.49
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 89.34
PF13870177 DUF4201: Domain of unknown function (DUF4201) 89.33
PF13870177 DUF4201: Domain of unknown function (DUF4201) 88.82
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 88.79
KOG4673961 consensus Transcription factor TMF, TATA element m 88.44
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 87.92
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 87.71
PRK10869553 recombination and repair protein; Provisional 87.41
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 87.31
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 87.26
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 87.21
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 87.07
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.81
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 86.52
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 86.32
COG5185622 HEC1 Protein involved in chromosome segregation, i 85.96
KOG1003205 consensus Actin filament-coating protein tropomyos 85.57
KOG0933 1174 consensus Structural maintenance of chromosome pro 85.54
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 85.49
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 85.28
PF135141111 AAA_27: AAA domain 85.24
PF13166712 AAA_13: AAA domain 85.13
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 85.02
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 85.0
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 84.13
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 84.0
KOG2196254 consensus Nuclear porin [Nuclear structure] 83.85
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 83.62
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 83.56
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 83.33
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 83.0
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 82.74
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 82.66
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 82.14
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 81.64
COG2433652 Uncharacterized conserved protein [Function unknow 81.47
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.39
COG4477570 EzrA Negative regulator of septation ring formatio 81.38
COG2433652 Uncharacterized conserved protein [Function unknow 81.23
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 81.19
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 80.37
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
Probab=99.65  E-value=3.3e-08  Score=118.52  Aligned_cols=112  Identities=21%  Similarity=0.275  Sum_probs=57.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhHHHHHHHHHHHHhHHHHHHHHHHH
Q 004160          386 LRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETENLLRVKESDLVEAKLEIQN  465 (771)
Q Consensus       386 l~~aqsE~kELErqLlqlekeIeeLr~qLqkekqeLEelqeEIesLQeELqelekELqElekeIeelEnELeeLq~eiEq  465 (771)
                      +..+..++..++..+..+...+..++..+......+..+...+..++.++..+...+..+...+......+..+...+..
T Consensus       672 ~~~l~~e~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~e~~~  751 (1179)
T TIGR02168       672 ILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQ  751 (1179)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34445566666666666666666666666666666666655555555555544445555555554444444444444444


Q ss_pred             HHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 004160          466 LKSKQASLQLILEEKDFELSNARQMLEELNNE  497 (771)
Q Consensus       466 LKsEIesLq~ELEEIdeELeeiqrrLeeLr~E  497 (771)
                      +...+..+...+..+..++..+...+..+...
T Consensus       752 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~  783 (1179)
T TIGR02168       752 LSKELTELEAEIEELEERLEEAEEELAEAEAE  783 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444444444444444444443333333333



SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.

>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2196 consensus Nuclear porin [Nuclear structure] Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-22
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-21
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-20
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-14
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-15
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-09
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-08
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-07
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 8e-08
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 5e-06
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 1e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-05
2xs1_A704 Programmed cell death 6-interacting protein; prote 2e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-05
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 2e-04
4dvy_P877 Cytotoxicity-associated immunodominant antigen; on 6e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score =  100 bits (250), Expect = 8e-22
 Identities = 66/335 (19%), Positives = 138/335 (41%), Gaps = 7/335 (2%)

Query: 200  KELELEKMRSELLKKSEEAAKIDSELKSKAQMLNEANEVVKKQETEIQSLRKVIQEKEEE 259
            +E E++    EL +  E   K ++ELK   Q   +  E     + ++Q+  ++  E EE 
Sbjct: 855  QEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEM 914

Query: 260  LEASVALRKVEEEKLKVVEANLEKRTMEWLLSQDALKKLAEEASRRMEETNDTLEDFRRV 319
                 A ++  EE L  +EA +E+        Q   KK+ ++    M +  + LE+    
Sbjct: 915  RVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQ----MLDLEEQLEEEEAA 970

Query: 320  KKLLSDVRSELVSSQKSLASSRKQMEEQEHLLGKQLVELEEQKKSLTSYMTSLKDAQVEV 379
            ++ L   +       K +      ME+Q + L K+   LEE+   LT+ +   ++    +
Sbjct: 971  RQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNL 1030

Query: 380  ESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKN 439
               + K    E+   ELE  L  E++  +EL+    K +       ++++ LQ ++    
Sbjct: 1031 TKLKNKH---ESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELK 1087

Query: 440  TEFGETENLLRVKESDLVEAKLEIQNLKSKQASLQLILEEKDFELSNARQMLEELNNEVR 499
             +  + E  L+   + L +   +  N   K   L+  + +   +L + +    +   + R
Sbjct: 1088 AQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKR 1147

Query: 500  ELKMIMSSREEQLVQAMDTLQEKDEHVLILQNELD 534
            +L   + + + +L   +DT   + E       + D
Sbjct: 1148 DLSEELEALKTELEDTLDTTATQQELRGSDYKDDD 1182


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 Back     alignment and structure
>4dvy_P Cytotoxicity-associated immunodominant antigen; oncoprotein; 3.30A {Helicobacter pylori} Length = 877 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.22
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.86
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.62
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.88
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.64
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.13
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.85
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.8
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.62
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.95
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 94.58
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.38
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.25
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.19
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.03
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 93.76
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 93.44
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 92.88
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 92.71
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 90.37
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 90.29
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.02
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 89.07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 88.67
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 88.06
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 87.86
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 86.46
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 85.91
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 85.79
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 85.47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 85.13
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 84.28
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 82.85
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 82.8
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=99.22  E-value=7.7e-07  Score=86.14  Aligned_cols=111  Identities=14%  Similarity=0.142  Sum_probs=49.9

Q ss_pred             HHHhhhHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhHHHHH
Q 004160          367 SYMTSLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEKYSLQQAIDEVSSLQEELGRKNTEFGETE  446 (771)
Q Consensus       367 s~~~~l~~a~~e~~~~~~~l~~aqsE~kELErqLlqlekeIeeLr~qLqkekqeLEelqeEIesLQeELqelekELqEle  446 (771)
                      .+...+..++.++..-...+..+......+...+..+...+..+...+.....++..+..++..+..++..+...+..+.
T Consensus        38 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  117 (284)
T 1c1g_A           38 QLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAE  117 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444444444444444444555555555555555555555555555555555544444444444444444444444444


Q ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHH
Q 004160          447 NLLRVKESDLVEAKLEIQNLKSKQASLQLIL  477 (771)
Q Consensus       447 keIeelEnELeeLq~eiEqLKsEIesLq~EL  477 (771)
                      ..+......+..+...+..+...+..+...+
T Consensus       118 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l  148 (284)
T 1c1g_A          118 KAADESERGMKVIESRAQKDEEKMEIQEIQL  148 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhhhhHHHHHHHHH
Confidence            4444333333333333333333333333333



>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 94.57
>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]
Probab=94.57  E-value=1.1  Score=37.62  Aligned_cols=32  Identities=6%  Similarity=0.137  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHhHHHHHH
Q 004160          351 LGKQLVELEEQKKSLTSYMTSLKDAQVEVESE  382 (771)
Q Consensus       351 l~~q~~el~~q~~~~~s~~~~l~~a~~e~~~~  382 (771)
                      +..++..+.+....+.....-+....-++..-
T Consensus        10 ~~~~~~~~~~~~~~~~~~~~k~~~~e~~~~~~   41 (185)
T d2ap3a1          10 YLKQVDKIKDDEEPIKTVGKKIAELDEKKKKL   41 (185)
T ss_dssp             HHHHHHHHHHTTHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444444444444444444444444444333