Citrus Sinensis ID: 004197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------77
MVESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFLFEKV
cccHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEEEEEEcccccccccccccccccEEEccccccccccccccHHHcccccEEEEEccccccccccHHHHccccccEEEccccccccccHHHHHHcccccEEEEcccccccccHHHcccccccEEEccccccccccccccccccccccEEEccccccccEEEccccccccccHHHHcccccccEEEEEEEccccccccHHHHcccccEEEccccccccccccccccccccccEEcccccccccEEEEEEcccccccccccccccccEEEcccccccEEccccccccccccccEEEEEcccccEEcccccccccccccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEEcccccccccccccccccccccccEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccHHHHHHHcHHHHHHHccHHHHHHHccccHHHEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEEEccccHHHccccccccccEEEEEccccccccccccHHHHHcccccEEEEcccccccccccHHHHHHHccEEEccccccccccHHHHHcccccEEEEcccccHHHccHHHHHHccccEEEccccccccEccHHHHHHHHcccEEEEcccccEEEccccccccccccHHHHHHcccccEEEcccccccccccccccHcccEEEEEEccccccccccccHHHHHHHHHHHHHHcccHHcccccccccccccEEEccccccccHcccHcccccccHHHHccccccHccHEEEccccHHHHHHHcccccccccccccccEEEEcccHHHHHHccccccccccccccEEEEcccccHHcccccHHHccccccEEEEEcccHcHHHHcccccccccccccccEEEEcccccccccccccccccccccccccEEEEcccccHHccccHHHHHHHHcccEEEEcccHHHHHHcccccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccccEccccccccccccEEEEcccccEEEEccc
MVESIVTVVLEFVKclappierrlGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIEQAAKFIddevttnkrclmglcpnlktryrlSKKAETEEKGLAMQTALIDVNVSIIGvygmggigkTTLVKEFARRAIEDKLCDMVVfsedgsnkffsMHDVVRDVAISIAFRDKIAFAVrnkdvwkwpdaDALKKYFAIFLKDSiindipevlespqlefllispknsfvapnvsenffkRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLcldqsilgdidIAIIGKLGNLEILSFWRSDIVHLPKALGQLtklrlldltdcfhlkviaPDVISSLIRLEELYMGNCSIEWEVERVnsersnasldelmllpwlTTIEINikndiilpegfFARKLERFKISIGNESFMASLPvakdwfrsrshfliNNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLfdldtnglpqlkllwvqnnpdffcivdsmemvacdafpllesltlhNLINMQRICIDRlkvesfnklktikvencdelsNIFWlstakclprlerVAVINCSKMKEIFAIGgeadvvlpnlealeiseinvdkiwhynhlpimlphfQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQeiisedrvdhvtprfvFQRVttltlqdlpelrclypgmhtlewpalKFLVVSGCDKLKIFgadlsqnnevdqlgipaqrplflfekv
MVESIVTVVLEfvkclappierrlgylRNYNANFRNLKAEidklkdesrsiqhrvseaerkgekieekVKKWLVSANNTIEQAakfiddevttnkrclmglcpnlktryrLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEdgsnkffsmHDVVRDVAISIAFRDKIAFavrnkdvwkwpdADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSfvapnvsenffkrtkklrvlDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTikvencdelsNIFWlstakclprLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIisedrvdhvtpRFVFQrvttltlqdlpELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADlsqnnevdqlgipaqrplflfekv
MVESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFLFEKV
****IVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAE****************************VKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSK*****EKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFL****
MVESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSI*****************VKKWLVSANNTIEQAAK*********KRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNK**W*WPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLK***********RLEELYMGNCSIEWEV**********SLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIG*********LEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRV*HVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQ**EVDQLGIPAQRPLFLFEKV
MVESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFLFEKV
MVESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFLFEK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVESIVTVVLEFVKCLAPPIERRLGYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGEKIEEKVKKWLVSANNTIEQAAKFIDDEVTTNKRCLMGLCPNLKTRYRLSKKAETEEKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAIEDKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCDKLKIFGADLSQNNEVDQLGIPAQRPLFLFEKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query769 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.592 0.462 0.225 2e-17
O81825919 Probable disease resistan no no 0.569 0.476 0.240 3e-16
Q42484909 Disease resistance protei no no 0.492 0.416 0.226 5e-16
O22727 967 Probable disease resistan no no 0.175 0.139 0.264 9e-08
O64789 925 Probable disease resistan no no 0.174 0.144 0.260 3e-06
Q7XA40992 Putative disease resistan N/A no 0.599 0.464 0.242 3e-06
Q9LVT4843 Probable disease resistan no no 0.288 0.263 0.265 6e-06
Q940K0889 Probable disease resistan no no 0.174 0.150 0.260 6e-06
Q9LVT3 948 Probable disease resistan no no 0.214 0.174 0.242 6e-06
B0W6M9628 Leucine-rich repeat prote N/A no 0.114 0.140 0.406 9e-06
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score = 91.7 bits (226), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 117/520 (22%), Positives = 238/520 (45%), Gaps = 64/520 (12%)

Query: 170 EDGSNK-FFSMHDVVRDVAISIAFRDK------IAFAVRNKDVWKWPDADALKKYFAIFL 222
           EDG  +    MHDVVRD AI I    +      +      +D+ +   A +L++   + L
Sbjct: 452 EDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRR---VSL 508

Query: 223 KDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPS- 281
            ++ +  +P+++E   ++  ++  + +F+   V   F +    LR+L+L+  R+ S PS 
Sbjct: 509 MNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSC 568

Query: 282 SIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDL 341
           S+  L +L +L L +     + +  +  L  LE+L    + I+  P+ L +L + R LDL
Sbjct: 569 SLLRLFSLHSLFL-RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDL 627

Query: 342 TDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEI 401
           +   HL+ I   V+S L  LE L M +    W V+   +++  A+++E+  L  L  + I
Sbjct: 628 SRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSI 686

Query: 402 NIKNDIIL--PEGFFARKLERFKISIGNESFMASLPVAKDWFRSRSHFLINNNRESLREL 459
            + +   L      + ++L++F++ +G                  S +++    +  R  
Sbjct: 687 RLHSSPFLLNKRNTWIKRLKKFQLVVG------------------SRYILRTRHDKRRLT 728

Query: 460 KLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDL--DTNGLPQLKLLWVQNNPDFF 517
              L+ + V    L A      L L+  QG++ ++  L  D  G   LK L ++N     
Sbjct: 729 ISHLNVSQVSIGWLLAYTT--SLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIEN----- 781

Query: 518 CIVDS---MEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKT----------- 563
            I+++   +EMV+ +      S  L  L N++ + + R+ +E+F++L+T           
Sbjct: 782 VIINTNSWVEMVSTNTSK-QSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKI 840

Query: 564 IKVENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEI 623
           I++  C +L  +        +P LE + +  C  ++ +          +PNL  L++  +
Sbjct: 841 IEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNL 900

Query: 624 -NVDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLAS 662
            N+  I ++  +      ++ L ++ V HC++L  + ++S
Sbjct: 901 PNLVSICNWGEV------WECLEQVEVIHCNQLNCLPISS 934
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query769
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.780 0.243 0.354 2e-91
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.715 0.418 0.349 2e-85
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.747 0.502 0.349 8e-85
255574526 1232 Disease resistance protein RFL1, putativ 0.759 0.474 0.352 2e-84
255563252 1603 Disease resistance protein RPS5, putativ 0.526 0.252 0.450 9e-84
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.715 0.411 0.370 2e-83
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.775 0.444 0.349 8e-81
358344919 1995 NBS/LRR resistance protein-like protein 0.728 0.280 0.357 3e-80
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.572 0.463 0.392 4e-75
357439285 1531 Cc-nbs resistance protein [Medicago trun 0.733 0.368 0.336 5e-75
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 244/688 (35%), Positives = 370/688 (53%), Gaps = 88/688 (12%)

Query: 140  GMGGIGKTTLVKEFARRAIE--DKLCDMVVFSEDGSNKFFSMHDVVRDVAISIAFRDKIA 197
            G+G   + T VK    R ++  + L    +  E   +    MHDVV + A  +A RD   
Sbjct: 374  GLGLFNQRTTVKAARNRLLKVVNDLKRSCLLLEGDDDDEVRMHDVVHNFATLVASRDHHV 433

Query: 198  FAVR-NKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLEFLLISPKNSFVAPNVS 256
            FAV  +  + +WP+ D L+++ AI L D  I  +PEV E P L+  L+  K+S  +  + 
Sbjct: 434  FAVACDSGLEEWPEKDILEQFTAISLPDCKIPKLPEVFECPDLQSFLLYNKDS--SLKIP 491

Query: 257  ENFFKRTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEIL 316
            +NFF R KKL+++DL+ + L  +P S+  L NL+TLCLD+  L DI  A IG+L  L++L
Sbjct: 492  DNFFSRMKKLKLMDLSNVHLSPMPLSLQCLENLQTLCLDRCTLEDI--AAIGELKKLQVL 549

Query: 317  SFWRSDIVHLPKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVE 376
            SF  S +V LP+ +G+LT+L+LLDL+ C  L+VI   V+S L +LEELYMGN  ++WE E
Sbjct: 550  SFIGSTMVQLPREVGKLTRLQLLDLSRCQKLEVIPKGVLSCLTKLEELYMGNSFVQWESE 609

Query: 377  RVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKISIGNESFMASLPV 436
              + +R+NASLDEL LLP L T+E++I N  ILP   F+ KL+ +K+ IG E        
Sbjct: 610  EHDGDRNNASLDELKLLPNLVTLELHIINAEILPRDVFSEKLDLYKVFIGEEW------- 662

Query: 437  AKDWFRSRSHFLINNNRESLRELKLKLDFT-DVRSMKLQAINKVEYLWLDKLQGVKNVLF 495
               WF            E+ R LKLKL+ + ++  +K+  +   E L+LD+L+GV+NVL+
Sbjct: 663  --SWF---------GKYEASRTLKLKLNSSIEIEKVKVLLMT-TEDLYLDELEGVRNVLY 710

Query: 496  DLDTNGLPQLKLLWVQNNPDFFCIVDSMEMV-ACDAFPLLESLTLHNLINMQRICIDRLK 554
            +LD  G PQLK L +QN+ +   IVD + M     AFP LESL + NL N+ +IC  +L 
Sbjct: 711  ELDGQGFPQLKHLHIQNSSEIQYIVDCLSMGNHYIAFPRLESLLVDNLNNLGQICYGQLM 770

Query: 555  VESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVINCS------------------ 596
              SF+KL+ +KVE+C+ L N+F+ S  + L +LE + V +C+                  
Sbjct: 771  SGSFSKLRKLKVEHCNALKNLFYFSMFRGLVQLEEIDVSSCNIMEEIVVEEIEDDSGRDE 830

Query: 597  ------------------------KMKEIFAI-GGEADVV-------------LPNLEAL 618
                                    +M+++  +  G A ++               NL  L
Sbjct: 831  IIKPIRLRTLTLEYLPRFTSFCSQRMQKLAGLDAGCAQIISETPSVLFGQKIEFSNLLNL 890

Query: 619  EISEIN-VDKIWHYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVN 677
            ++S IN ++KIW  N +       Q+LT LIV  C KL Y+F +SM+ +  QL+ L+I +
Sbjct: 891  KLSSINNMEKIWR-NQVKEPPSSVQNLTSLIVEGCGKLSYLFTSSMVENLSQLEYLEISD 949

Query: 678  CRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCLYPGMHTLEWPALKFLVVSGCD 737
            C  ++EII  + +     +  F  + TL L+ LP L     G + +E P+L  L +  C 
Sbjct: 950  CSFMEEIIVAEGLTKHNSKLHFPILHTLKLKSLPNLIRFCFG-NLIECPSLNALRIENCP 1008

Query: 738  K-LKIFGADLSQNNEVDQLGIPAQRPLF 764
            + LK   +  S N E ++ G      LF
Sbjct: 1009 RLLKFISSSASTNMEANRGGRETNSTLF 1036

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358344919|ref|XP_003636533.1| NBS/LRR resistance protein-like protein [Medicago truncatula] gi|355502468|gb|AES83671.1| NBS/LRR resistance protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357439285|ref|XP_003589919.1| Cc-nbs resistance protein [Medicago truncatula] gi|355478967|gb|AES60170.1| Cc-nbs resistance protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query769
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.602 0.470 0.231 9.6e-21
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.156 0.133 0.28 6e-18
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.609 0.510 0.229 1.2e-16
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.206 0.179 0.321 3.4e-15
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.326 0.280 0.268 8.6e-13
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.309 0.251 0.229 1.2e-14
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.136 0.108 0.333 1.8e-14
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.249 0.213 0.261 6.2e-13
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.236 0.205 0.300 6.7e-13
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.400 0.365 0.252 2.1e-12
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 9.6e-21, Sum P(3) = 9.6e-21
 Identities = 119/513 (23%), Positives = 237/513 (46%)

Query:   170 EDGSNK-FFSMHDVVRDVAISI--AFRDKIAFAVRN----KDVWKWPDADALKKYFAIFL 222
             EDG  +    MHDVVRD AI I  + +D     V +    +D+ +   A +L++   + L
Sbjct:   452 EDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRR---VSL 508

Query:   223 KDSIINDIPEVLESPQLEFLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRMRLLSLPS- 281
              ++ +  +P+++E   ++  ++  + +F+   V   F +    LR+L+L+  R+ S PS 
Sbjct:   509 MNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSC 568

Query:   282 SIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDL 341
             S+  L +L +L L +     + +  +  L  LE+L    + I+  P+ L +L + R LDL
Sbjct:   569 SLLRLFSLHSLFL-RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDL 627

Query:   342 TDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEI 401
             +   HL+ I   V+S L  LE L M +    W V+   +++  A+++E+  L  L  + I
Sbjct:   628 SRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSI 686

Query:   402 NIKNDIIL--PEGFFARKLERFKISIGNESFMASLPVAKDWFR-SRSHFLINNNRESLRE 458
              + +   L      + ++L++F++ +G+   + +     D  R + SH  +N ++ S+  
Sbjct:   687 RLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRT---RHDKRRLTISH--LNVSQVSIGW 741

Query:   459 LKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNVLFDLDTNGLPQLKLLWVQN---NPD 515
             L   L +T   S+ L     +E + + KL          D  G   LK L ++N   N +
Sbjct:   742 L---LAYTT--SLALNHCQGIEAM-MKKLVS--------DNKGFKNLKSLTIENVIINTN 787

Query:   516 FFC--IVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKVEN---CD 570
              +   +  +    + D   LL +L   +L  +       L+     KL+T+K+     C 
Sbjct:   788 SWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCR 847

Query:   571 ELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEI-NVDKIW 629
             +L  +        +P LE + +  C  ++ +          +PNL  L++  + N+  I 
Sbjct:   848 KLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSIC 907

Query:   630 HYNHLPIMLPHFQSLTRLIVWHCHKLKYIFLAS 662
             ++  +      ++ L ++ V HC++L  + ++S
Sbjct:   908 NWGEV------WECLEQVEVIHCNQLNCLPISS 934
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query769
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 44.9 bits (106), Expect = 2e-04
 Identities = 43/168 (25%), Positives = 74/168 (44%), Gaps = 29/168 (17%)

Query: 534 LESLTLHNLINMQRICIDRLKVESFNKLKTIKVENCDELSNIFWLSTAKCLPRLERVAVI 593
           LE+L L +  ++  +      ++  NKL+ + +  C+ L     L T   L  L R+ + 
Sbjct: 659 LETLKLSDCSSLVEL---PSSIQYLNKLEDLDMSRCENLEI---LPTGINLKSLYRLNLS 712

Query: 594 NCSKMKEIFAIGGE---------------ADVVLPNLEALEISEINVDKIWHYNH----L 634
            CS++K    I                  +++ L NL+ L + E+  +K+W        L
Sbjct: 713 GCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPL 772

Query: 635 PIMLPHFQSLTRLIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQ 682
             ML    SLTRL +     L  + L S I++  +L+ L+I NC  L+
Sbjct: 773 MTMLSP--SLTRLFLSDIPSL--VELPSSIQNLHKLEHLEIENCINLE 816

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 769
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.45
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG0617264 consensus Ras suppressor protein (contains leucine 99.38
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.34
KOG4237498 consensus Extracellular matrix protein slit, conta 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG4341483 consensus F-box protein containing LRR [General fu 99.04
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.02
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
KOG4341483 consensus F-box protein containing LRR [General fu 98.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.71
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.64
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.57
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.49
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.45
PLN03150623 hypothetical protein; Provisional 98.42
PLN03150623 hypothetical protein; Provisional 98.25
PRK15386 426 type III secretion protein GogB; Provisional 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.01
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.96
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.95
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.92
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.32
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.18
cd01128249 rho_factor Transcription termination factor rho is 97.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.88
PRK09376416 rho transcription termination factor Rho; Provisio 96.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.35
PRK08118167 topology modulation protein; Reviewed 96.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.98
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.91
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.76
TIGR00767415 rho transcription termination factor Rho. Members 95.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.54
PRK06696223 uridine kinase; Validated 95.26
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.08
PRK07261171 topology modulation protein; Provisional 94.88
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.85
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.48
PHA00729226 NTP-binding motif containing protein 94.3
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.28
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 94.28
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 94.27
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.24
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.22
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.22
PRK06547172 hypothetical protein; Provisional 94.16
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.08
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.06
PRK05480209 uridine/cytidine kinase; Provisional 94.03
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.88
PTZ00301210 uridine kinase; Provisional 93.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.74
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 93.72
PRK08233182 hypothetical protein; Provisional 93.65
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.63
PRK07667193 uridine kinase; Provisional 93.49
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.44
PF13173128 AAA_14: AAA domain 93.35
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.34
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.29
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.21
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.15
PRK06762166 hypothetical protein; Provisional 92.8
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 92.75
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.69
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 92.68
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.62
PF05729166 NACHT: NACHT domain 92.55
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.5
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 92.41
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 92.33
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 92.31
PRK03839180 putative kinase; Provisional 92.26
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 92.26
PRK04040188 adenylate kinase; Provisional 92.18
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.06
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.93
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 91.87
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 91.83
PRK00625173 shikimate kinase; Provisional 91.71
PRK05541176 adenylylsulfate kinase; Provisional 91.66
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.6
PRK11331459 5-methylcytosine-specific restriction enzyme subun 91.52
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 91.47
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 91.44
PRK06217183 hypothetical protein; Validated 91.42
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.41
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 91.32
PRK14974336 cell division protein FtsY; Provisional 91.27
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.26
cd03116159 MobB Molybdenum is an essential trace element in t 91.19
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 91.09
PRK00889175 adenylylsulfate kinase; Provisional 91.06
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.04
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 90.97
PRK09270229 nucleoside triphosphate hydrolase domain-containin 90.87
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 90.77
TIGR01287275 nifH nitrogenase iron protein. This model describe 90.72
PRK13236296 nitrogenase reductase; Reviewed 90.67
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.59
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 90.54
PRK00131175 aroK shikimate kinase; Reviewed 90.51
PRK06893229 DNA replication initiation factor; Validated 90.45
TIGR00763775 lon ATP-dependent protease La. This protein is ind 90.42
PRK13695174 putative NTPase; Provisional 90.35
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 90.33
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 90.13
PRK06526254 transposase; Provisional 90.01
PLN02348395 phosphoribulokinase 90.0
PRK03846198 adenylylsulfate kinase; Provisional 89.93
PRK13975196 thymidylate kinase; Provisional 89.89
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 89.88
PRK13230279 nitrogenase reductase-like protein; Reviewed 89.86
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 89.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.82
PRK13947171 shikimate kinase; Provisional 89.74
PRK10416318 signal recognition particle-docking protein FtsY; 89.73
PF11868192 DUF3388: Protein of unknown function (DUF3388); In 89.67
cd02117212 NifH_like This family contains the NifH (iron prot 89.64
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 89.58
PRK13949169 shikimate kinase; Provisional 89.58
PRK00300205 gmk guanylate kinase; Provisional 89.57
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 89.56
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 89.55
PRK09183259 transposase/IS protein; Provisional 89.55
PRK13232273 nifH nitrogenase reductase; Reviewed 89.53
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 89.53
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.49
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 89.47
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 89.43
PRK12339197 2-phosphoglycerate kinase; Provisional 89.4
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 89.32
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 89.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 89.3
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 89.26
PRK05057172 aroK shikimate kinase I; Reviewed 89.2
PRK08084235 DNA replication initiation factor; Provisional 89.18
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 89.16
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 89.09
PRK00411394 cdc6 cell division control protein 6; Reviewed 89.08
PRK13946184 shikimate kinase; Provisional 89.06
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 89.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.01
smart0037026 LRR Leucine-rich repeats, outliers. 89.01
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 88.98
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 88.93
PLN02796347 D-glycerate 3-kinase 88.92
PLN02200234 adenylate kinase family protein 88.91
cd02040270 NifH NifH gene encodes component II (iron protein) 88.91
smart0037026 LRR Leucine-rich repeats, outliers. 88.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.91
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 88.89
PF00005137 ABC_tran: ABC transporter This structure is on hol 88.86
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 88.86
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 88.76
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 88.76
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 88.73
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 88.7
PRK14495452 putative molybdopterin-guanine dinucleotide biosyn 88.7
PTZ00202550 tuzin; Provisional 88.61
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.6
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 88.59
PRK06851367 hypothetical protein; Provisional 88.57
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 88.56
KOG2028554 consensus ATPase related to the helicase subunit o 88.55
PRK04182180 cytidylate kinase; Provisional 88.53
PF00004132 AAA: ATPase family associated with various cellula 88.52
smart00382148 AAA ATPases associated with a variety of cellular 88.52
cd03114148 ArgK-like The function of this protein family is u 88.51
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 88.43
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 88.41
COG1484254 DnaC DNA replication protein [DNA replication, rec 88.38
PRK14530215 adenylate kinase; Provisional 88.35
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 88.21
PRK08099399 bifunctional DNA-binding transcriptional repressor 88.11
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 87.95
PRK13948182 shikimate kinase; Provisional 87.94
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 87.91
PRK13235274 nifH nitrogenase reductase; Reviewed 87.9
PRK09825176 idnK D-gluconate kinase; Provisional 87.86
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 87.84
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 87.84
cd02034116 CooC The accessory protein CooC, which contains a 87.64
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 87.52
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 87.34
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 87.33
PRK07933213 thymidylate kinase; Validated 87.28
PRK09435332 membrane ATPase/protein kinase; Provisional 87.27
PRK13233275 nifH nitrogenase reductase; Reviewed 87.27
PRK13768253 GTPase; Provisional 87.25
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.16
PRK03731171 aroL shikimate kinase II; Reviewed 87.13
PLN02318656 phosphoribulokinase/uridine kinase 87.1
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 87.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 87.02
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 86.99
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 86.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 86.86
PRK08181269 transposase; Validated 86.85
PRK05439311 pantothenate kinase; Provisional 86.84
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 86.81
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 86.75
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 86.7
PLN03046460 D-glycerate 3-kinase; Provisional 86.68
COG1100219 GTPase SAR1 and related small G proteins [General 86.66
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 86.6
PRK00698205 tmk thymidylate kinase; Validated 86.55
cd02032267 Bchl_like This family of proteins contains bchL an 86.47
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 86.46
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 86.45
COG3638258 ABC-type phosphate/phosphonate transport system, A 86.29
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 86.28
TIGR00064272 ftsY signal recognition particle-docking protein F 86.24
PRK15453290 phosphoribulokinase; Provisional 86.22
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 86.19
PRK13231264 nitrogenase reductase-like protein; Reviewed 86.16
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 86.08
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 86.07
PRK08939306 primosomal protein DnaI; Reviewed 86.06
KOG3308225 consensus Uncharacterized protein of the uridine k 86.05
COG1123539 ATPase components of various ABC-type transport sy 86.03
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 86.02
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 85.95
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 85.93
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 85.85
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 85.82
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 85.8
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 85.8
cd03115173 SRP The signal recognition particle (SRP) mediates 85.56
PRK00771437 signal recognition particle protein Srp54; Provisi 85.53
PRK06761282 hypothetical protein; Provisional 85.39
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 85.32
PRK13342413 recombination factor protein RarA; Reviewed 85.23
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 85.22
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 85.22
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 85.18
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 85.16
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 85.1
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 85.08
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 85.06
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 85.04
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 84.97
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 84.96
cd03269210 ABC_putative_ATPase This subfamily is involved in 84.91
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 84.91
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 84.9
COG1936180 Predicted nucleotide kinase (related to CMP and AM 84.86
PRK09087226 hypothetical protein; Validated 84.85
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 84.84
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 84.83
PRK14527191 adenylate kinase; Provisional 84.83
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 84.74
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 84.74
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 84.72
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 84.64
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 84.61
COG1126240 GlnQ ABC-type polar amino acid transport system, A 84.61
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 84.61
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 84.6
PRK08727233 hypothetical protein; Validated 84.57
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 84.56
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 84.53
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 84.48
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 84.36
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 84.3
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 84.22
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 84.16
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 84.06
PRK01184184 hypothetical protein; Provisional 84.05
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 84.03
COG0703172 AroK Shikimate kinase [Amino acid transport and me 84.03
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 84.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 84.02
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 84.01
PRK08903227 DnaA regulatory inactivator Hda; Validated 84.01
COG0410237 LivF ABC-type branched-chain amino acid transport 84.0
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 83.97
PRK00454196 engB GTP-binding protein YsxC; Reviewed 83.95
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 83.93
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 83.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 83.9
TIGR00231161 small_GTP small GTP-binding protein domain. This m 83.86
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 83.86
PLN02165334 adenylate isopentenyltransferase 83.86
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 83.82
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 83.78
PRK07429327 phosphoribulokinase; Provisional 83.77
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 83.73
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 83.69
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 83.64
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 83.63
COG2256436 MGS1 ATPase related to the helicase subunit of the 83.62
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 83.62
PRK13234295 nifH nitrogenase reductase; Reviewed 83.61
PF1355562 AAA_29: P-loop containing region of AAA domain 83.56
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 83.54
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 83.46
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 83.43
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 83.34
TIGR02928365 orc1/cdc6 family replication initiation protein. M 83.34
PRK08154309 anaerobic benzoate catabolism transcriptional regu 83.34
cd00876160 Ras Ras family. The Ras family of the Ras superfam 83.31
cd00154159 Rab Rab family. Rab GTPases form the largest famil 83.3
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 83.3
COG0003322 ArsA Predicted ATPase involved in chromosome parti 83.3
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 83.29
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 83.27
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 83.26
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 83.2
TIGR00101199 ureG urease accessory protein UreG. This model rep 83.16
PRK13341725 recombination factor protein RarA/unknown domain f 83.12
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 83.12
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 83.09
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 83.07
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 83.07
cd04171164 SelB SelB subfamily. SelB is an elongation factor 83.04
CHL00072290 chlL photochlorophyllide reductase subunit L 83.01
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 83.0
PRK08356195 hypothetical protein; Provisional 82.93
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 82.92
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 82.92
PRK10536262 hypothetical protein; Provisional 82.92
PRK10619257 histidine/lysine/arginine/ornithine transporter su 82.91
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 82.89
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 82.87
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 82.87
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 82.86
PRK05642234 DNA replication initiation factor; Validated 82.82
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 82.82
PRK10646153 ADP-binding protein; Provisional 82.79
TIGR00959428 ffh signal recognition particle protein. This mode 82.78
PF07726131 AAA_3: ATPase family associated with various cellu 82.7
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 82.69
cd03216163 ABC_Carb_Monos_I This family represents the domain 82.67
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 82.67
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 82.67
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 82.65
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 82.65
PLN02924220 thymidylate kinase 82.61
PRK10867433 signal recognition particle protein; Provisional 82.58
PTZ00088229 adenylate kinase 1; Provisional 82.57
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 82.56
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 82.55
cd03246173 ABCC_Protease_Secretion This family represents the 82.54
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 82.49
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 82.47
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 82.47
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 82.46
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 82.43
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 82.42
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 82.37
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 82.36
PRK06620214 hypothetical protein; Validated 82.36
COG2255332 RuvB Holliday junction resolvasome, helicase subun 82.33
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 82.3
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 82.27
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 82.24
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 82.22
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 82.21
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 82.19
PRK13973213 thymidylate kinase; Provisional 82.19
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 82.18
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 82.15
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 82.13
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 82.12
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 82.11
PRK00023225 cmk cytidylate kinase; Provisional 82.09
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 82.08
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 82.04
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 82.02
PRK14242253 phosphate transporter ATP-binding protein; Provisi 81.99
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 81.98
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 81.97
PRK10908222 cell division protein FtsE; Provisional 81.96
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 81.95
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 81.95
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 81.94
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 81.92
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 81.88
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 81.85
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 81.84
PRK14238271 phosphate transporter ATP-binding protein; Provisi 81.77
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 81.75
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 81.75
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 81.68
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 81.62
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 81.58
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 81.57
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 81.53
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 81.52
cd03215182 ABC_Carb_Monos_II This family represents domain II 81.48
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 81.47
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 81.45
COG4240300 Predicted kinase [General function prediction only 81.45
PRK14738206 gmk guanylate kinase; Provisional 81.44
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 81.44
PRK06835329 DNA replication protein DnaC; Validated 81.43
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 81.4
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 81.39
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 81.39
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 81.36
PRK14241258 phosphate transporter ATP-binding protein; Provisi 81.35
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 81.27
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 81.26
PRK12377248 putative replication protein; Provisional 81.21
PRK09473330 oppD oligopeptide transporter ATP-binding componen 81.18
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 81.13
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 81.13
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 81.12
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 81.11
cd04123162 Rab21 Rab21 subfamily. The localization and functi 81.09
PRK13976209 thymidylate kinase; Provisional 80.99
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 80.97
PRK04220301 2-phosphoglycerate kinase; Provisional 80.92
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 80.91
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 80.9
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 80.9
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 80.87
COG1127263 Ttg2A ABC-type transport system involved in resist 80.86
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 80.85
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 80.85
PRK14730195 coaE dephospho-CoA kinase; Provisional 80.85
COG0488530 Uup ATPase components of ABC transporters with dup 80.83
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 80.81
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 80.78
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 80.77
PRK14239252 phosphate transporter ATP-binding protein; Provisi 80.75
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 80.75
PRK02496184 adk adenylate kinase; Provisional 80.75
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 80.75
cd01878204 HflX HflX subfamily. A distinct conserved domain w 80.74
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 80.71
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 80.65
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 80.63
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 80.59
PRK12402337 replication factor C small subunit 2; Reviewed 80.58
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 80.48
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 80.43
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 80.43
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 80.43
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 80.35
PRK14243264 phosphate transporter ATP-binding protein; Provisi 80.33
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 80.3
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 80.29
TIGR02237209 recomb_radB DNA repair and recombination protein R 80.27
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 80.26
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 80.24
PRK14737186 gmk guanylate kinase; Provisional 80.24
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 80.23
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 80.14
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 80.13
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 80.11
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 80.09
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-40  Score=373.63  Aligned_cols=326  Identities=27%  Similarity=0.401  Sum_probs=255.8

Q ss_pred             hhhHHHHHHHhhhcchhhHHHHhhhHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcchhhHHHHHHHHHHHHHHHH
Q 004197            2 VESIVTVVLEFVKCLAPPIERRLGYLRNYNANFRNLKAEIDKLKDESRSIQHRVSEAERKGEKIEEKVKKWLVSANNTIE   81 (769)
Q Consensus         2 a~~~v~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~a~~~~~~~~~~~~~W~~~~~~~~~   81 (769)
                      |++.++..+++   +++.+.++..+       +.+..+++..|++.+..++.++++|+++... ...+..|.+.+++++|
T Consensus         1 ~~~~~s~~~~~---~~~~l~~~~~~-------~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~-~~~~~~~~e~~~~~~~   69 (889)
T KOG4658|consen    1 MGACVSFGVEK---LDQLLNRESEC-------LDGKDNYILELKENLKALQSALEDLDAKRDD-LERRVNWEEDVGDLVY   69 (889)
T ss_pred             CCeEEEEehhh---HHHHHHHHHHH-------HhchHHHHHHHHHHHHHHHHHHHHHHhhcch-HHHHHHHHHHHHHHHH
Confidence            34566667777   88889999888       8888889999999999999999999988655 6788999999999999


Q ss_pred             HHHhhhhhhhh-----------------cccccccccCC-Ccchhcccchhhhhh-------------------------
Q 004197           82 QAAKFIDDEVT-----------------TNKRCLMGLCP-NLKTRYRLSKKAETE-------------------------  118 (769)
Q Consensus        82 ~~ed~~d~~~~-----------------~~~~c~~~~~~-~~~~~~~i~~~~~~~-------------------------  118 (769)
                      +++|+++.+..                 ..+.|+...|+ +....|.+++++..+                         
T Consensus        70 ~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~  149 (889)
T KOG4658|consen   70 LAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREK  149 (889)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhh
Confidence            99999865411                 12234433343 333444444444433                         


Q ss_pred             ---------------hhHHHHHHHhhcCCccEEEEEccCCCchHHHHHHHHHHhh-hhcCCCeEEEE-------------
Q 004197          119 ---------------EKGLAMQTALIDVNVSIIGVYGMGGIGKTTLVKEFARRAI-EDKLCDMVVFS-------------  169 (769)
Q Consensus       119 ---------------~~~~~i~~~l~~~~~~vi~I~G~gG~GKTtla~~v~~~~~-~~~~F~~~~~~-------------  169 (769)
                                     ...+.+.+.|.+++..++||+||||+||||||+.|||+.. ++++||.++||             
T Consensus       150 ~e~~~~~~~~~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~  229 (889)
T KOG4658|consen  150 VETRPIQSESDVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQ  229 (889)
T ss_pred             cccCCCCccccccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHH
Confidence                           0125677778888889999999999999999999999988 99999999999             


Q ss_pred             --------------------------------------------------------------------------------
Q 004197          170 --------------------------------------------------------------------------------  169 (769)
Q Consensus       170 --------------------------------------------------------------------------------  169 (769)
                                                                                                      
T Consensus       230 ~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~  309 (889)
T KOG4658|consen  230 TILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVD  309 (889)
T ss_pred             HHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCC
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 004197          170 --------------------------------------------------------------------------------  169 (769)
Q Consensus       170 --------------------------------------------------------------------------------  169 (769)
                                                                                                      
T Consensus       310 ~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~  389 (889)
T KOG4658|consen  310 YPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAAD  389 (889)
T ss_pred             ccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCC
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 004197          170 --------------------------------------------------------------------------------  169 (769)
Q Consensus       170 --------------------------------------------------------------------------------  169 (769)
                                                                                                      
T Consensus       390 ~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll  469 (889)
T KOG4658|consen  390 FSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLL  469 (889)
T ss_pred             CCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             --Ec--CCCceEehhHHHHHHHHHHhh-----ccceEEEEeCCcccccCCccccCcceEEEeecCCCCCCCCccCCCCcE
Q 004197          170 --ED--GSNKFFSMHDVVRDVAISIAF-----RDKIAFAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPEVLESPQLE  240 (769)
Q Consensus       170 --~~--~~~~~~~~hdl~~dl~~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~lr~L~l~~~~~~~l~~~~~~~~Lr  240 (769)
                        ..  ++...|+|||+|||+|.+++.     ++. .+...+.+....|....+..+|++++.++.+..++....+++|+
T Consensus       470 ~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~  548 (889)
T KOG4658|consen  470 IEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLR  548 (889)
T ss_pred             hhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccc
Confidence              11  355789999999999999998     555 33333335555677777889999999999999999888888999


Q ss_pred             -EEecCCCC-ccccCCcchHhhhcCCcccEEEecCc-ccCCCCccccccCCccEEEeccccccccChhhhhccCCCcEEE
Q 004197          241 -FLLISPKN-SFVAPNVSENFFKRTKKLRVLDLTRM-RLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILS  317 (769)
Q Consensus       241 -l~l~~~~~-~~~~~~~~~~~~~~l~~Lr~L~L~~~-~i~~lp~~i~~l~~L~~L~L~~~~l~~l~p~~i~~L~~L~~L~  317 (769)
                       |.+..+.. ...++   .++|..++.||||||++| .+..+|++|+.|.|||||+++++.++.+ |..+++|+.|++|+
T Consensus       549 tLll~~n~~~l~~is---~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~L-P~~l~~Lk~L~~Ln  624 (889)
T KOG4658|consen  549 TLLLQRNSDWLLEIS---GEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHL-PSGLGNLKKLIYLN  624 (889)
T ss_pred             eEEEeecchhhhhcC---HHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCcccc-chHHHHHHhhheec
Confidence             88887763 56677   788999999999999976 4568898888888888888888888888 88888888888888


Q ss_pred             eecC-CCcccchhhccCCCCcEEEccC
Q 004197          318 FWRS-DIVHLPKALGQLTKLRLLDLTD  343 (769)
Q Consensus       318 l~~~-~l~~lp~~i~~l~~L~~L~l~~  343 (769)
                      +..+ .+..+|.....|.+||+|.+..
T Consensus       625 l~~~~~l~~~~~i~~~L~~Lr~L~l~~  651 (889)
T KOG4658|consen  625 LEVTGRLESIPGILLELQSLRVLRLPR  651 (889)
T ss_pred             cccccccccccchhhhcccccEEEeec
Confidence            8887 3444455555577777776655

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF11868 DUF3388: Protein of unknown function (DUF3388); InterPro: IPR024514 This domain is found in a family of bacterial proteins that are functionally uncharacterised Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query769
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 96.1 bits (238), Expect = 2e-20
 Identities = 94/600 (15%), Positives = 205/600 (34%), Gaps = 109/600 (18%)

Query: 21  ERRLGYLRNYNANFRNLKAEID--KLKDESRSIQHRVSEAERK---GEK-IEEKVKK--W 72
           E +  Y    +          D   ++D  +SI   +S+ E       K       +  W
Sbjct: 13  EHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSI---LSKEEIDHIIMSKDAVSGTLRLFW 69

Query: 73  LVSANNTIEQAAKFIDDEVTTNKRCLMG------LCPNLKTRYRLSKKAET--------- 117
            + +    E   KF+++ +  N + LM         P++ TR  + ++            
Sbjct: 70  TLLSKQE-EMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAK 128

Query: 118 -----EEKGLAMQTALIDVNVS-IIGVYGMGGIGKTTLVKEFAR-RAIEDKLCDMVV--- 167
                 +  L ++ AL+++  +  + + G+ G GKT +  +      ++ K+   +    
Sbjct: 129 YNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLN 188

Query: 168 FSEDGSNK--FFSMHDVVRDVAISIAFRDKIAFAVR-NKDVWKWPDADALKKYFAI-FLK 223
                S +     +  ++  +  +   R   +  ++      +      L++       +
Sbjct: 189 LKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQ----AELRRLLKSKPYE 244

Query: 224 DS--IINDI--PEVLESPQLEF-----LLISPKNSFVAPNVSENFFKRTKKLRVLDLTRM 274
           +   ++ ++   +   +    F     +L++ +   V   +S      T  + +   +  
Sbjct: 245 NCLLVLLNVQNAKAWNA----FNLSCKILLTTRFKQVTDFLSAA---TTTHISLDHHSMT 297

Query: 275 RLLSLPSSIDLL---VNLRTLCLDQSILGDID---IAIIGKL--GNLEILSFWR-SDIVH 325
             L+      LL   ++ R   L + +L   +   ++II +     L     W+  +   
Sbjct: 298 --LTPDEVKSLLLKYLDCRPQDLPREVL-TTNPRRLSIIAESIRDGLATWDNWKHVNCDK 354

Query: 326 LPKALGQ-LTKLRLLDLTDCFHLKVIAP-DV-ISSLIRLEELYMGNCSIEWEVERVNSER 382
           L   +   L  L   +    F    + P    I +++ L  ++     I+ +V  V ++ 
Sbjct: 355 LTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTIL-LSLIWFD--VIKSDVMVVVNKL 411

Query: 383 SNASLDELMLLPWLTTIEINIKNDIIL-----PEGFFA--RKL-ERFKISIGNESFMASL 434
              SL  +   P  +TI I     I L      E  +A  R + + + I    +S     
Sbjct: 412 HKYSL--VEKQPKESTISI---PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIP 466

Query: 435 PVAKD-WFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDKLQGVKNV 493
           P     ++    H L N        L   + F D R ++ Q I      W +    + N 
Sbjct: 467 PYLDQYFYSHIGHHLKNIEHPERMTLFRMV-FLDFRFLE-QKIRHDSTAW-NASGSILNT 523

Query: 494 LFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRL 553
           L  L        K     N+P +  +V+++     D  P +E     NLI  +   + R+
Sbjct: 524 LQQLKF-----YKPYICDNDPKYERLVNAIL----DFLPKIE----ENLICSKYTDLLRI 570
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query769
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.54
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.48
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.64
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.81
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.72
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.5
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.38
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.26
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.53
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.46
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.13
1xjc_A169 MOBB protein homolog; structural genomics, midwest 92.91
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.8
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.53
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.51
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.48
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.36
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.22
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.2
3fwy_A314 Light-independent protochlorophyllide reductase I 92.2
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.97
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.84
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 91.77
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.73
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.71
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 91.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 91.56
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.53
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.47
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.42
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.38
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.32
2kjq_A149 DNAA-related protein; solution structure, NESG, st 91.31
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.3
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.13
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 90.99
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 90.87
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.84
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.67
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.67
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.66
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.62
2fna_A357 Conserved hypothetical protein; structural genomic 90.61
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 90.58
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.57
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.55
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 90.52
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.49
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.49
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.45
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.44
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 90.38
1via_A175 Shikimate kinase; structural genomics, transferase 90.37
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.3
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.24
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.24
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.16
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 90.16
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.12
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 90.04
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.03
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.02
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 90.01
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 89.97
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 89.88
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 89.87
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 89.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.75
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.75
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.72
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.71
2hf9_A226 Probable hydrogenase nickel incorporation protein 89.69
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 89.69
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.68
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.65
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.64
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 89.57
2xxa_A433 Signal recognition particle protein; protein trans 89.53
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.44
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.44
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.36
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.35
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.35
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.29
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 89.25
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.16
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 89.09
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 89.09
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.01
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.93
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.87
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 88.87
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.83
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 88.78
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.65
2vli_A183 Antibiotic resistance protein; transferase, tunica 88.5
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.48
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 88.41
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.41
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 88.38
3bos_A242 Putative DNA replication factor; P-loop containing 88.3
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 88.1
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 88.07
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.01
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 87.97
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 87.9
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.84
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 87.83
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 87.69
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.67
3end_A307 Light-independent protochlorophyllide reductase ir 87.65
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 87.56
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 87.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.41
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 87.36
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.31
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 87.31
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.29
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 87.28
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 87.22
2v1u_A387 Cell division control protein 6 homolog; DNA repli 87.2
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.18
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.13
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 87.05
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 86.89
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.88
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 86.87
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 86.69
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 86.66
3r20_A233 Cytidylate kinase; structural genomics, seattle st 86.65
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.54
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 86.53
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.48
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 86.43
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.34
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 86.34
1ji0_A240 ABC transporter; ATP binding protein, structural g 86.19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 86.18
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 86.17
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 86.06
2og2_A359 Putative signal recognition particle receptor; nuc 86.01
1g6h_A257 High-affinity branched-chain amino acid transport 86.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.99
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.99
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 85.99
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.93
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 85.92
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 85.9
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 85.71
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 85.7
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 85.69
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 85.67
2ghi_A260 Transport protein; multidrug resistance protein, M 85.42
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 85.34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 85.3
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 85.25
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 85.22
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 85.22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 85.21
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 85.07
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 85.02
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 85.02
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 84.99
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 84.92
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.9
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 84.87
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 84.86
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 84.85
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 84.75
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 84.73
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 84.71
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 84.32
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 84.29
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 84.17
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 84.14
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 84.09
3tlx_A243 Adenylate kinase 2; structural genomics, structura 84.05
2wji_A165 Ferrous iron transport protein B homolog; membrane 83.96
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 83.93
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 83.85
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 83.76
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 83.67
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 83.54
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 83.48
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 83.46
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 83.44
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 83.43
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 83.41
2eyu_A261 Twitching motility protein PILT; pilus retraction 83.4
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 83.39
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 83.34
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 83.28
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 83.05
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 82.99
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 82.98
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 82.95
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 82.86
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 82.84
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 82.8
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 82.76
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 82.7
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 82.52
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 82.48
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 82.46
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 82.35
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 82.29
2cvh_A220 DNA repair and recombination protein RADB; filamen 82.22
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 82.08
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 82.07
3kta_A182 Chromosome segregation protein SMC; structural mai 82.07
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 82.02
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 81.76
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 81.7
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 81.68
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 81.56
3co5_A143 Putative two-component system transcriptional RES 81.52
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 81.48
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 81.29
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 81.24
3pvs_A447 Replication-associated recombination protein A; ma 81.09
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 81.04
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 81.02
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 80.92
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 80.84
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 80.76
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.74
2ged_A193 SR-beta, signal recognition particle receptor beta 80.59
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 80.59
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 80.5
3t1o_A198 Gliding protein MGLA; G domain containing protein, 80.32
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 80.32
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 80.26
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 80.13
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=6.5e-35  Score=331.73  Aligned_cols=507  Identities=17%  Similarity=0.108  Sum_probs=339.6

Q ss_pred             EEEeCCcccccCCccccCcceEEEeecCCCCCCCC--ccCCCCcE-EEecCCCCccccCCcchHhhhcCCcccEEEecCc
Q 004197          198 FAVRNKDVWKWPDADALKKYFAIFLKDSIINDIPE--VLESPQLE-FLLISPKNSFVAPNVSENFFKRTKKLRVLDLTRM  274 (769)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~lr~L~l~~~~~~~l~~--~~~~~~Lr-l~l~~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~  274 (769)
                      +...+.+++.+|. ..++++++|++++|.+..++.  ..++++|+ +.+.++... .++   .+.|.++++|++|++++|
T Consensus        16 ~~c~~~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~-~i~---~~~~~~l~~L~~L~Ls~n   90 (606)
T 3vq2_A           16 YQCMDQKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIE-TIE---DKAWHGLHHLSNLILTGN   90 (606)
T ss_dssp             EECTTSCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCC-EEC---TTTTTTCTTCCEEECTTC
T ss_pred             eEccCCCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCccc-ccC---HHHhhchhhcCEeECCCC
Confidence            4555667777776 567899999999999988775  33899999 999887544 444   466789999999999999


Q ss_pred             ccCCC-CccccccCCccEEEeccccccccChhhhhccCCCcEEEeecCCCc--ccchhhccCCCCcEEEccCCcCccccC
Q 004197          275 RLLSL-PSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIV--HLPKALGQLTKLRLLDLTDCFHLKVIA  351 (769)
Q Consensus       275 ~i~~l-p~~i~~l~~L~~L~L~~~~l~~l~p~~i~~L~~L~~L~l~~~~l~--~lp~~i~~l~~L~~L~l~~~~~l~~~~  351 (769)
                      .++.+ |..|+++++|++|++++|.++.++|..++++++|++|++++|.+.  .+|..++++++|++|++++|. +..++
T Consensus        91 ~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~-l~~~~  169 (606)
T 3vq2_A           91 PIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNY-IQTIT  169 (606)
T ss_dssp             CCCCCCTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSC-CCEEC
T ss_pred             cccccChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCc-ceecC
Confidence            99977 888999999999999999999986688999999999999999988  579999999999999999986 66666


Q ss_pred             hhhhcCCCCcc----EEEccCCccccceeccccccccCCchhhcCCCCccEEEEEeeCCC--CCCcccc-cccccEEEEE
Q 004197          352 PDVISSLIRLE----ELYMGNCSIEWEVERVNSERSNASLDELMLLPWLTTIEINIKNDI--ILPEGFF-ARKLERFKIS  424 (769)
Q Consensus       352 ~~~~~~L~~L~----~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~~L~l~~~~~~--~~~~~~~-~~~L~~l~i~  424 (769)
                      ...++.+++|+    +|++++|.+....+           ..+ ...+|+.|+++++...  ..|..+. .+.++.+.+.
T Consensus       170 ~~~~~~l~~L~~~l~~L~l~~n~l~~~~~-----------~~~-~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~  237 (606)
T 3vq2_A          170 VNDLQFLRENPQVNLSLDMSLNPIDFIQD-----------QAF-QGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLI  237 (606)
T ss_dssp             TTTTHHHHHCTTCCCEEECTTCCCCEECT-----------TTT-TTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEE
T ss_pred             hhhhhhhhccccccceeeccCCCcceeCc-----------ccc-cCceeeeeeccCCccchhHHHHHhcccccccccccc
Confidence            55466666655    79998887763222           222 2236778887777543  1222222 4444444443


Q ss_pred             EcCCcccccccccc-ccc----------------c-ccccccccCcccccceEEeeccccccccccccccccccEEEecc
Q 004197          425 IGNESFMASLPVAK-DWF----------------R-SRSHFLINNNRESLRELKLKLDFTDVRSMKLQAINKVEYLWLDK  486 (769)
Q Consensus       425 ~~~~~~~~~l~~~~-~~~----------------~-~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~l~~~~~L~~L~l~~  486 (769)
                      .........++... .+.                . -....+....+++++.+++..+.....+ .+..+++|+.|++.+
T Consensus       238 ~~~~~~~~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~-~l~~~~~L~~L~l~~  316 (606)
T 3vq2_A          238 LGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLE-DVPKHFKWQSLSIIR  316 (606)
T ss_dssp             EECCTTSCCCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGGGSCGGGTTCSEEEEESCCCCCCC-CCCTTCCCSEEEEES
T ss_pred             ccccccCCcccccChHHhhhhhhccHhheeccccccccccccccccCCCCCEEEecCccchhhh-hccccccCCEEEccc
Confidence            33221111110000 000                0 0001111345677888888877755444 467778888888888


Q ss_pred             cCCcccccccCCCCCCCCCceEEEecCCCcceeccCccccccccCCccceeeccccccccccccccccccccCCccEEEE
Q 004197          487 LQGVKNVLFDLDTNGLPQLKLLWVQNNPDFFCIVDSMEMVACDAFPLLESLTLHNLINMQRICIDRLKVESFNKLKTIKV  566 (769)
Q Consensus       487 ~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~~~~~f~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l  566 (769)
                      +.. ...+.   . .+++|+.|++.++.....+       ....+++|+.|.++++. ++...........+++|+.|++
T Consensus       317 n~l-~~lp~---~-~l~~L~~L~l~~n~~~~~~-------~~~~l~~L~~L~ls~n~-l~~~~~~~~~~~~~~~L~~L~L  383 (606)
T 3vq2_A          317 CQL-KQFPT---L-DLPFLKSLTLTMNKGSISF-------KKVALPSLSYLDLSRNA-LSFSGCCSYSDLGTNSLRHLDL  383 (606)
T ss_dssp             CCC-SSCCC---C-CCSSCCEEEEESCSSCEEC-------CCCCCTTCCEEECCSSC-EEEEEECCHHHHCCSCCCEEEC
T ss_pred             ccC-ccccc---C-CCCccceeeccCCcCccch-------hhccCCCCCEEECcCCc-cCCCcchhhhhccCCcccEeEC
Confidence            776 44442   3 7888888888888544332       44567888888888753 2322111112456788888888


Q ss_pred             cCCCCCccccchHHhhcCCCCcEEEEccCchhhhhhhcCCcccccCCcccccccccccceeccCCCCCCCccCcCCCccE
Q 004197          567 ENCDELSNIFWLSTAKCLPRLERVAVINCSKMKEIFAIGGEADVVLPNLEALEISEINVDKIWHYNHLPIMLPHFQSLTR  646 (769)
Q Consensus       567 ~~c~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~L~~L~L~~~~l~~i~~~~~~~~~l~~l~~L~~  646 (769)
                      ++|. +..++  ..+..+++|+.|++++|......+..   .+..+++|+.|++++|+++..     .+..+..+++|+.
T Consensus       384 ~~n~-l~~~~--~~~~~l~~L~~L~l~~n~l~~~~~~~---~~~~l~~L~~L~l~~n~l~~~-----~~~~~~~l~~L~~  452 (606)
T 3vq2_A          384 SFNG-AIIMS--ANFMGLEELQHLDFQHSTLKRVTEFS---AFLSLEKLLYLDISYTNTKID-----FDGIFLGLTSLNT  452 (606)
T ss_dssp             CSCS-EEEEC--CCCTTCTTCCEEECTTSEEESTTTTT---TTTTCTTCCEEECTTSCCEEC-----CTTTTTTCTTCCE
T ss_pred             CCCc-cccch--hhccCCCCCCeeECCCCccCCccChh---hhhccccCCEEECcCCCCCcc-----chhhhcCCCCCCE
Confidence            8875 55554  25567788888888887543332211   234578888888888877664     3345667788888


Q ss_pred             EEEecCCCcceecchhhHhhcccCcEEeEccccccceeeccccccCCcCeeeecccCccccccCcccccc-cCCCccccC
Q 004197          647 LIVWHCHKLKYIFLASMIRSFEQLQQLDIVNCRGLQEIISEDRVDHVTPRFVFQRVTTLTLQDLPELRCL-YPGMHTLEW  725 (769)
Q Consensus       647 L~l~~c~~l~~l~~~~~~~~l~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l-~~~~~~l~~  725 (769)
                      |++++|.--... .+..+.++++|++|++++| .++.+++. .      ...+++|++|++++|+ ++.+ |.....  +
T Consensus       453 L~l~~n~l~~~~-~~~~~~~l~~L~~L~Ls~n-~l~~~~~~-~------~~~l~~L~~L~Ls~N~-l~~~~~~~~~~--l  520 (606)
T 3vq2_A          453 LKMAGNSFKDNT-LSNVFANTTNLTFLDLSKC-QLEQISWG-V------FDTLHRLQLLNMSHNN-LLFLDSSHYNQ--L  520 (606)
T ss_dssp             EECTTCEEGGGE-ECSCCTTCTTCCEEECTTS-CCCEECTT-T------TTTCTTCCEEECCSSC-CSCEEGGGTTT--C
T ss_pred             EECCCCcCCCcc-hHHhhccCCCCCEEECCCC-cCCccChh-h------hcccccCCEEECCCCc-CCCcCHHHccC--C
Confidence            888886433222 1345677788888888887 55554321 1      3345778888888864 4444 444443  3


Q ss_pred             CCcceEEEecCCCceeeccCCCCcc-cccccCCCCC
Q 004197          726 PALKFLVVSGCDKLKIFGADLSQNN-EVDQLGIPAQ  760 (769)
Q Consensus       726 ~~L~~L~i~~C~~L~~l~~~~~~~~-~l~~l~i~~~  760 (769)
                      ++|++|++++|. ++.+|.....++ .|+.+++.++
T Consensus       521 ~~L~~L~l~~N~-l~~~p~~~~~l~~~L~~l~l~~N  555 (606)
T 3vq2_A          521 YSLSTLDCSFNR-IETSKGILQHFPKSLAFFNLTNN  555 (606)
T ss_dssp             TTCCEEECTTSC-CCCEESCGGGSCTTCCEEECCSC
T ss_pred             CcCCEEECCCCc-CcccCHhHhhhcccCcEEEccCC
Confidence            788888888884 778887776665 4777777654
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 769
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 48.1 bits (113), Expect = 2e-06
 Identities = 43/276 (15%), Positives = 81/276 (29%), Gaps = 31/276 (11%)

Query: 266 LRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVH 325
           LRV+  + + L  +P  +    +   L L  + + +I       L NL  L    + I  
Sbjct: 12  LRVVQCSDLGLEKVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISK 69

Query: 326 L-PKALGQLTKLRLLDLTDCFHLKVIAPDVISSLIRLEELYMGNCSIEWEV--------- 375
           + P A   L KL  L L+    LK +   +  +L  L         +   V         
Sbjct: 70  ISPGAFAPLVKLERLYLSKN-QLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIV 128

Query: 376 ---ERVNSERSNASLDELMLLPWLTTIEINIKNDIILPEGFFARKLERFKIS---IGNES 429
                   + S         +  L+ I I   N   +P+G     L    +    I    
Sbjct: 129 VELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLP-PSLTELHLDGNKITKVD 187

Query: 430 FMASLPVAKDWFRSRSHFLINNNRESLRELKLKLDFTDVRSMKLQAI-------NKVEYL 482
             +   +        S   I+            L    + + KL  +         ++ +
Sbjct: 188 AASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVV 247

Query: 483 WLD--KLQGVKNVLFDLD--TNGLPQLKLLWVQNNP 514
           +L    +  + +  F              + + +NP
Sbjct: 248 YLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNP 283
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query769
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.67
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.5
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.37
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.89
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.82
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.63
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.53
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.45
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.13
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.02
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.83
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.82
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.73
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.37
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.27
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.05
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 92.9
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.77
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.69
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.68
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.55
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.52
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.47
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.24
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.88
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.64
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.21
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.87
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 90.84
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.77
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.46
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.3
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 90.28
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.25
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.12
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 89.97
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.97
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.85
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.8
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.59
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.57
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.07
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.98
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.87
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.77
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.7
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.62
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.36
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.35
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.34
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.23
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 88.12
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.05
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 87.98
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.87
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 87.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.87
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 87.84
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 87.84
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 87.67
d1ls1a2207 GTPase domain of the signal sequence recognition p 87.66
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 87.6
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 87.6
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 87.46
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 87.44
d2awna2232 Maltose transport protein MalK, N-terminal domain 87.42
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.28
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.27
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.18
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 86.92
d1okkd2207 GTPase domain of the signal recognition particle r 86.8
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 86.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.71
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 86.58
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.58
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.3
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 86.22
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.14
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 86.01
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.98
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.95
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 85.74
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 85.73
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.73
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 85.66
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 85.66
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 85.58
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 85.43
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.43
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.21
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.11
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.91
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 84.81
d1vmaa2213 GTPase domain of the signal recognition particle r 84.58
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.57
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.47
d2qy9a2211 GTPase domain of the signal recognition particle r 84.32
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.24
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 84.08
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 83.8
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.58
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 83.49
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 83.12
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.05
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 82.92
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.84
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 82.84
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 82.82
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 82.82
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.44
d2hyda1255 Putative multidrug export ATP-binding/permease pro 82.39
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.06
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.97
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.51
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.47
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 80.98
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.72
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 80.7
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.62
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.48
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 80.4
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 80.35
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 80.16
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 80.1
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.07
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.85  E-value=6.8e-20  Score=192.98  Aligned_cols=80  Identities=23%  Similarity=0.302  Sum_probs=47.7

Q ss_pred             cCCcccEEEecCcccCCCCccccccCCccEEEeccccccccChhhhhccCCCcEEEeecCCCcccchhhccCCCCcEEEc
Q 004197          262 RTKKLRVLDLTRMRLLSLPSSIDLLVNLRTLCLDQSILGDIDIAIIGKLGNLEILSFWRSDIVHLPKALGQLTKLRLLDL  341 (769)
Q Consensus       262 ~l~~Lr~L~L~~~~i~~lp~~i~~l~~L~~L~L~~~~l~~l~p~~i~~L~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~l  341 (769)
                      .+.+|++|++++++|+++. .+..+++|++|++++|.|+++ | .++++++|++|++++|.+..++. ++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l-~-~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDI-T-PLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCC-G-GGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCC-c-cccCCcccccccccccccccccc-cccccccccccc
Confidence            4455666666666666552 456666666666666666666 3 26666666666666666655542 556666666666


Q ss_pred             cCCc
Q 004197          342 TDCF  345 (769)
Q Consensus       342 ~~~~  345 (769)
                      .++.
T Consensus       118 ~~~~  121 (384)
T d2omza2         118 FNNQ  121 (384)
T ss_dssp             CSSC
T ss_pred             cccc
Confidence            5543
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure