Citrus Sinensis ID: 004241

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------

MECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLGALPENERNRKEQPMIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

cccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHcccccccccccccccccHHHHHHccccccccccccHHHHHHHHHcccHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHcccccccEEEccccccccEEEEEEEHHHHHHHHHHccccc

ccHHHHHHHHHHHHHHHcccccccEcccccccccccccHHHHccccEcEccccccEEEEccccccccccccccccccHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccHHEEEEEHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcHcccccccccccccccccccccccccccccccccEEcccccccccHHcHHHHHHccccHHHHHccccEEEcccccHHHHHHHHHHcccccEEEEcccccEEEEEEHHHHHHHHHcccccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEHHHHHHHHHHHHHcc

MECKLQLLLWQEHLqwhccssssrvipssyqcnksepscfklkqkkylsfsnstkslrlrplgalpenernrkeqpmiigidghevgnsGVIISSCLVGLLTGIGVVLFNKGVHEIRdffwdgipyggaswlrekpipaiwIRVVLVPACGGFIVSILNQLRYAlsldddddddvqqvqdksyppphpqaqakddisvitvssttslptiYYDYLKIAFQPLLKAVAACITlgtgnslgpegpsveiGKSIAKGvgnlfdrrprrkVSLVAAgsaagissgfNAAVAGCFFAVesviwpssaadssaslaYTTSMVILSAVIASVVSevglgsepafkvpeydfrspgelpLYLLLGVLCGLISLTLSRCTTYMLAIVDNlqkdngipkavfpVMGGLAVGLIALMfpeilywgfenvdillesrpfvkgLTADMLLQLVAAKIVATSLCRasglvggyyapslfigaaTGMAYGKFINFAiaqsnptihfSILEvaspqaygLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGavglsswftsgqmrrrdvkETKVAVHANTNRKRQFEIYtsrtrglsssdllaeeepyAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCsadgetccvpctatpnmNLLSALILMDrygvnqvpvvmehipgqrgqlvglLDRESIILACRFCDFFL

MECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLsfsnstkslrlrplgalpenernrkeQPMIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKsyppphpqaqakddisvITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTgnslgpegpsvEIGKSIAKGvgnlfdrrpRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLsswftsgqmrrrdvketkvavhantnrkrqfeiytsrtrglsssdllaEEEPYAINLCEVESSLCIDDWNLEVEElkrrvfvsevmrtrYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

MECKlqlllwqehlqwhCCssssrvipssYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLGALPENERNRKEQPMIIGIDGHEVGNSGVIISSClvglltgigvvlFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLdddddddvqqvqdKSYPPPHPQAQAKDDisvitvssttsLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVaagsaagissgfnaaVAGCFFAVESVIWPssaadssaslaYTTsmvilsaviasvvsEVGLGSEPAFKVPEYDFRSPgelplylllgvlcglisltlSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

**CKLQLLLWQEHLQWHCCSSSSRVIPSSYQ*******CFK***********************************MIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYAL******************************ISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSL******VEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRR**V**TKVAVHAN****RQFEIYT**********LLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFF*

**CKLQLLLWQEHLQWHCCSSSSRVIP****************************************************GIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVA****************RTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQ******KLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

MECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLGALPENERNRKEQPMIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDK***********KDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKY*********LLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

*ECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLG*******************GHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQ******KLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		766	2.2.26 [Sep-21-2011]
Q8GX93		710	Chloride channel protein	yes	no	0.808	0.871	0.635	0.0
Q8RXR2		781	Chloride channel protein	no	no	0.802	0.787	0.411	1e-118
Q8XTT4		429	Putative chloride channel	yes	no	0.436	0.778	0.290	1e-27
A8ALD3		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.305	2e-25
B4TK31		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.296	1e-24
B5FJ02		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.296	1e-24
B5F8R6		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.296	1e-24
B5RHE1		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.296	1e-24
A9MPK6		473	H(+)/Cl(-) exchange trans	N/A	no	0.378	0.613	0.296	1e-24
C0Q5R6		473	H(+)/Cl(-) exchange trans	yes	no	0.378	0.613	0.293	3e-24

>sp\|Q8GX93\|CLCE_ARATH Chloride channel protein CLC-e OS=Arabidopsis thaliana GN=CLC-E PE=2 SV=2	Back alignment and function desciption

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/670 (63%), Positives = 501/670 (74%), Gaps = 51/670 (7%)

Query: 92  IISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACG 151
           I S+CLVG+LTG+ VVLFN  VH +RDF WDGIP  GASWLRE PI + W+RV+LVP  G
Sbjct: 77  IASACLVGVLTGVSVVLFNNCVHLLRDFSWDGIPDRGASWLREAPIGSNWLRVILVPTIG 136

Query: 152 GFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIY 211
           G +VSILNQLR +      D                               S +SL    
Sbjct: 137 GLVVSILNQLRESAGKSTGD-------------------------------SHSSL---- 161

Query: 212 YDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVA 271
            D +K   +P LK VAAC+TLGTGNSLGPEGPSVEIG SIAKGV +LF++ P+   SL+A
Sbjct: 162 -DRVKAVLRPFLKTVAACVTLGTGNSLGPEGPSVEIGASIAKGVNSLFNKSPQTGFSLLA 220

Query: 272 AGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGL 331
           AGSAAGISSGFNAAVAGCFFAVESV+WPSS+ DSS SL  TTSMVILSAV ASVVSE+GL
Sbjct: 221 AGSAAGISSGFNAAVAGCFFAVESVLWPSSSTDSSTSLPNTTSMVILSAVTASVVSEIGL 280

Query: 332 GSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAV 391
           GSEPAFKVP+YDFRSPGELPLYLLLG LCGL+SL LSRCT+ M + VD+L KD GIPKAV
Sbjct: 281 GSEPAFKVPDYDFRSPGELPLYLLLGALCGLVSLALSRCTSSMTSAVDSLNKDAGIPKAV 340

Query: 392 FPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCR 451
           FPVMGGL+VG+IAL++PE+LYWGF+NVDILLE RPFVKGL+AD+LLQLVA KI AT+ CR
Sbjct: 341 FPVMGGLSVGIIALVYPEVLYWGFQNVDILLEKRPFVKGLSADLLLQLVAVKIAATAWCR 400

Query: 452 ASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATL 511
           ASGLVGGYYAPSLFIG A GMAYGKFI  A+AQ NP  + SILEVASPQAYGLVGMAATL
Sbjct: 401 ASGLVGGYYAPSLFIGGAAGMAYGKFIGLALAQ-NPDFNLSILEVASPQAYGLVGMAATL 459

Query: 512 AGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNR 571
           AGVCQVPLT+VLLLFELTQDYRIVLPLLGAVG+SSW TSGQ +R++ +ETK        R
Sbjct: 460 AGVCQVPLTAVLLLFELTQDYRIVLPLLGAVGMSSWITSGQSKRQETRETK------ETR 513

Query: 572 KRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMR 631
           KR+ +      + L+SSD    +E    NLCEVESSLC+DD   + EEL + +FVSE MR
Sbjct: 514 KRKSQ---EAVQSLTSSD----DESSTNNLCEVESSLCLDDSLNQSEELPKSIFVSEAMR 566

Query: 632 TRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSK 691
           TR+ TV+M+T L EALT ML EKQSCA+IVD DNI +G+LTL DI+EFSK  +   +R K
Sbjct: 567 TRFATVMMSTSLEEALTRMLIEKQSCALIVDPDNIFLGILTLSDIQEFSKARKEGNNRPK 626

Query: 692 -LLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLL 750
            + V+++CS  G  C VP T TP+M+LL+A  +M+++ ++ V VV   I   R   VG+L
Sbjct: 627 DIFVNDICSRSGGKCKVPWTVTPDMDLLAAQTIMNKHELSHVAVVSGSIDAPRIHPVGVL 686

Query: 751 DRESIILACR 760
           DRE I L  R
Sbjct: 687 DRECITLTRR 696

Voltage-gated chloride channel.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8RXR2\|CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana GN=CLC-F PE=2 SV=2	Back alignment and function description

>sp\|Q8XTT4\|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2	Back alignment and function description

>sp\|A8ALD3\|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B4TK31\|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5FJ02\|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5F8R6\|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5RHE1\|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|A9MPK6\|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|C0Q5R6\|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		766
297744440		653	unnamed protein product [Vitis vinifera]	0.826	0.969	0.688	0.0
225428374		733	PREDICTED: chloride channel protein CLC-	0.818	0.855	0.691	0.0
147820635		1444	hypothetical protein VITISV_002674 [Viti	0.797	0.423	0.687	0.0
255546644		759	voltage-gated clc-type chloride channel,	0.831	0.839	0.671	0.0
334187188		749	chloride channel protein CLC-e [Arabidop	0.809	0.827	0.636	0.0
289541483		711	chloride channel E [Eutrema halophilum]	0.821	0.884	0.627	0.0
297798378		715	predicted protein [Arabidopsis lyrata su	0.852	0.913	0.611	0.0
18418749		710	chloride channel protein CLC-e [Arabidop	0.808	0.871	0.635	0.0
449475886		779	PREDICTED: LOW QUALITY PROTEIN: chloride	0.875	0.861	0.598	0.0
449444604		791	PREDICTED: chloride channel protein CLC-	0.839	0.812	0.624	0.0

>gi\|297744440\|emb\|CBI37702.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/677 (68%), Positives = 534/677 (78%), Gaps = 44/677 (6%)

Query: 85  EVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRV 144
           E GN   I+SSC VGLLTGIG+VLFN  VH IRDF WDGIPY GASWLRE+PI AIW RV
Sbjct: 3   EEGNLA-ILSSCFVGLLTGIGIVLFNNAVHVIRDFSWDGIPYRGASWLREEPIEAIWERV 61

Query: 145 VLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSST 204
           +LVP CGG +VS LN LR AL                         Q+  D ++I+    
Sbjct: 62  ILVPLCGGLLVSGLNVLRDAL-------------------------QSPGDGNLIS---- 92

Query: 205 TSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPR 264
                     +K A QP LKAVAAC+TLGTGNSLGPEGPSVEIG SIAKGV +LFD+  +
Sbjct: 93  ---------NIKAALQPFLKAVAACVTLGTGNSLGPEGPSVEIGASIAKGVSSLFDKSSK 143

Query: 265 RKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIAS 324
           RKVSLVAAGSAAGISSGFNAA AGCFFAVESV+WPS+A DSS SL  TTSMVILSAVIAS
Sbjct: 144 RKVSLVAAGSAAGISSGFNAAFAGCFFAVESVLWPSTA-DSSLSLQNTTSMVILSAVIAS 202

Query: 325 VVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKD 384
           VVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLG+LCGL+SL LS+CT+YML  +DN+ K 
Sbjct: 203 VVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGILCGLVSLALSKCTSYMLVTIDNVHKA 262

Query: 385 NGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKI 444
            GIP+A FPV+GGL+VGLIAL +PEILYWGFENVDILLESRPFVKGL+AD+LLQLVA KI
Sbjct: 263 VGIPRAAFPVLGGLSVGLIALAYPEILYWGFENVDILLESRPFVKGLSADLLLQLVAVKI 322

Query: 445 VATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGL 504
           VATSLCRASGLVGGYYAPSLFIGAATGMAYGKFI FAI+QSNP  H SILEVASPQAYGL
Sbjct: 323 VATSLCRASGLVGGYYAPSLFIGAATGMAYGKFITFAISQSNPMFHLSILEVASPQAYGL 382

Query: 505 VGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVA 564
           VGMAATLAGVCQVPLT+VLLLFELTQDYRIVLPLLGAVGLSSW TS Q +R+DV +    
Sbjct: 383 VGMAATLAGVCQVPLTAVLLLFELTQDYRIVLPLLGAVGLSSWTTSRQAKRKDVGDPGKL 442

Query: 565 VHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRV 624
              N  +    ++ +     LSSS  +A +  +A NLCEVESSLC+DD N E +EL++R+
Sbjct: 443 KEGNAQKT---DLSSHDPSVLSSSYSVAAKASHASNLCEVESSLCVDDSNSETKELEKRI 499

Query: 625 FVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQ 684
           FVS+ MRTRYVTVLM+TLLIEA++L+L EKQ+CA+IVD+D++LIGLLTL DI+EFS+  +
Sbjct: 500 FVSQAMRTRYVTVLMSTLLIEAVSLLLEEKQTCAVIVDDDHLLIGLLTLEDIQEFSEREK 559

Query: 685 AKTSRSK-LLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQR 743
           A+  RSK +LVSEMCS DGE C VP T TP MNL SA ++M+  GVNQ+PV+ +H+   +
Sbjct: 560 ARIRRSKEVLVSEMCSLDGEKCRVPWTVTPGMNLFSAQMIMNTLGVNQLPVISDHVEDHK 619

Query: 744 GQLVGLLDRESIILACR 760
           G  VGLLDRE I LA R
Sbjct: 620 GHPVGLLDRECISLAFR 636

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225428374\|ref\|XP_002280150.1\| PREDICTED: chloride channel protein CLC-e [Vitis vinifera] gi\|301318140\|gb\|ADK66985.1\| chloride channel ClC7 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147820635\|emb\|CAN72098.1\| hypothetical protein VITISV_002674 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255546644\|ref\|XP_002514381.1\| voltage-gated clc-type chloride channel, putative [Ricinus communis] gi\|223546478\|gb\|EEF47977.1\| voltage-gated clc-type chloride channel, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|334187188\|ref\|NP_001190924.1\| chloride channel protein CLC-e [Arabidopsis thaliana] gi\|332661111\|gb\|AEE86511.1\| chloride channel protein CLC-e [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|289541483\|gb\|ADD09862.1\| chloride channel E [Eutrema halophilum]	Back alignment and taxonomy information

>gi\|297798378\|ref\|XP_002867073.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297312909\|gb\|EFH43332.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|18418749\|ref\|NP_567985.1\| chloride channel protein CLC-e [Arabidopsis thaliana] gi\|41688502\|sp\|Q8GX93.2\|CLCE_ARATH RecName: Full=Chloride channel protein CLC-e; Short=AtCLC-e; AltName: Full=CBS domain-containing protein CBSCLC3 gi\|332661110\|gb\|AEE86510.1\| chloride channel protein CLC-e [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449475886\|ref\|XP_004154579.1\| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-e-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449444604\|ref\|XP_004140064.1\| PREDICTED: chloride channel protein CLC-e-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		766
TAIR\|locus:2020542		781	CLC-F "chloride channel F" [Ar	0.680	0.667	0.381	3.4e-92
TIGR_CMR\|GSU_2363		614	GSU_2363 "chloride channel fam	0.181	0.226	0.363	6.9e-26
UNIPROTKB\|P37019		473	clcA "ClcA" [Escherichia coli	0.250	0.405	0.306	2.8e-15
TIGR_CMR\|SPO_1208		581	SPO_1208 "voltage-gated chlori	0.203	0.268	0.321	5.7e-14
UNIPROTKB\|Q9KM62		468	clcA "H(+)/Cl(-) exchange tran	0.173	0.284	0.333	2.8e-13
TIGR_CMR\|VC_A0526		468	VC_A0526 "conserved hypothetic	0.173	0.284	0.333	2.8e-13
UNIPROTKB\|P76175		418	clcB "chloride ion transporter	0.204	0.375	0.306	3.2e-10
FB\|FBgn0036566		882	ClC-c "Chloride channel-c" [Dr	0.220	0.191	0.259	1.3e-09
SGD\|S000003801		779	GEF1 "Voltage-gated chloride c	0.218	0.214	0.273	3.7e-08
POMBASE\|SPBC19C7.11		766	SPBC19C7.11 "ClC chloride chan	0.203	0.203	0.239	1.4e-07

TAIR\|locus:2020542 CLC-F "chloride channel F" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 798 (286.0 bits), Expect = 3.4e-92, Sum P(2) = 3.4e-92
 Identities = 212/556 (38%), Positives = 286/556 (51%)

Query:   213 DYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVXX 272
             D+L     P++KA+ A +TLGTG SLGPEGPSV+IGKS A G   + +    R+++L   
Sbjct:   220 DFLA-GIYPVIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFALMMENNRERRIALTAA 278

Query:   273 XXXXXXXXXXXXXVAGCFFAVESVIWPXXXXXXXXXXXYTTXXXXXXXXXXXXXXEVGLG 332
                          VAGCFFA+E+V+ P           +TT                 LG
Sbjct:   279 GAASGIASGFNAAVAGCFFAIETVLRPLRAENSPP---FTTAMIILASVISSTVSNALLG 335

Query:   333 SEPAFKVPEYDFRSPXXXXXXXXXXXXXXXXXXXXSRCTTYMLAIVDNLQKDNGIPKAVF 392
             ++ AF VP YD +S                     SR  T+     D ++   G+P  V 
Sbjct:   336 TQSAFTVPSYDLKSAAELPLYLILGMLCGAVSVVFSRLVTWFTKSFDFIKDKFGLPAIVC 395

Query:   393 PVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRA 452
             P +GGL  G+IAL +P ILYWGF NV+ +L +          +L QL AAK+VAT+LC+ 
Sbjct:   396 PALGGLGAGIIALKYPGILYWGFTNVEEILHTGKSASAPGIWLLAQLAAAKVVATALCKG 455

Query:   453 SGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLA 512
             SGLVGG YAPSL IGAA G  +G      I ++ P        VA PQAY LVGMAATLA
Sbjct:   456 SGLVGGLYAPSLMIGAAVGAVFGGSAAEIINRAIP----GNAAVAQPQAYALVGMAATLA 511

Query:   513 GVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTS--GQMRRRDVKETKVAVHANTN 570
              +C VPLTSVLLLFELT+DYRI+LPL+GAVGL+ W  S   Q +  D  E +      ++
Sbjct:   512 SMCSVPLTSVLLLFELTKDYRILLPLMGAVGLAIWVPSVANQGKESDSSEGRSTGRGYSS 571

Query:   571 ---RKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVS 627
                 +R+ E     T    S +L   E P        + +  +D+  + +E+LK    V 
Sbjct:   572 LSPSERKTEGVWRHTDNADSLELTVIENP--------DHNSFLDEETI-LEDLK----VM 618

Query:   628 EVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEF-SKYAQAK 686
              VM   YV V   T L EA  ++    Q+C M+VD+D+ L G+LT GDI  + S  A   
Sbjct:   619 RVMSKNYVKVSSGTTLREARNILKESHQNCIMVVDDDDFLAGILTHGDIRRYLSNNASTI 678

Query:   687 TSRSKLLVSEMC----SADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVM--EHI- 739
                +   VS +C    S  G+   +  T  P+  +  A  LM+  GV Q+PVV   E I 
Sbjct:   679 LDENTCPVSSVCTKKISYRGQERGL-LTCYPDATVGVAKELMEARGVKQLPVVKRGEVIH 737

Query:   740 PGQRGQLVGLLDRESI 755
              G+R +L+GLL  +SI
Sbjct:   738 KGKRRKLLGLLHYDSI 753

GO:0005216 "ion channel activity" evidence=IEA

GO:0005247 "voltage-gated chloride channel activity" evidence=IEA;ISS

GO:0006821 "chloride transport" evidence=IEA;ISS

GO:0016020 "membrane" evidence=IEA;ISS

GO:0055085 "transmembrane transport" evidence=IEA

GO:0009507 "chloroplast" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

TIGR_CMR\|GSU_2363 GSU_2363 "chloride channel family protein, putative" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

UNIPROTKB\|P37019 clcA "ClcA" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_1208 SPO_1208 "voltage-gated chloride channel family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KM62 clcA "H(+)/Cl(-) exchange transporter ClcA" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_A0526 VC_A0526 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|P76175 clcB "chloride ion transporter ClcB" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

FB\|FBgn0036566 ClC-c "Chloride channel-c" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

SGD\|S000003801 GEF1 "Voltage-gated chloride channel localized to the golgi, the endosomal" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

POMBASE\|SPBC19C7.11 SPBC19C7.11 "ClC chloride channel (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8GX93	CLCE_ARATH	No assigned EC number	0.6358	0.8080	0.8718	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00036320001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (623 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		766
cd00400		383	cd00400, Voltage_gated_ClC, CLC voltage-gated chlo	5e-98
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	7e-79
COG0038		443	COG0038, EriC, Chloride channel protein EriC [Inor	1e-61
cd01031		402	cd01031, EriC, ClC chloride channel EriC	2e-58
PRK01862		574	PRK01862, PRK01862, putative voltage-gated ClC-typ	3e-47
PRK05277		438	PRK05277, PRK05277, chloride channel protein; Prov	2e-46
cd01034		390	cd01034, EriC_like, ClC chloride channel family	4e-33
cd04592		133	cd04592, CBS_pair_EriC_assoc_euk, This cd contains	4e-33
cd01033		388	cd01033, ClC_like, Putative ClC chloride channel	2e-30
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	5e-24
PRK01610		418	PRK01610, PRK01610, putative voltage-gated ClC-typ	3e-23
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	1e-21
cd03683		426	cd03683, ClC_1_like, ClC-1-like chloride channel p	7e-18
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	8e-15
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	4e-11
cd03685		466	cd03685, ClC_6_like, ClC-6-like chloride channel p	4e-11
cd03682		378	cd03682, ClC_sycA_like, ClC sycA-like chloride cha	2e-10
cd04587		113	cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd	3e-10
cd04604		114	cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain	2e-09
pfam00571		57	pfam00571, CBS, CBS domain	2e-09
cd04593		115	cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con	6e-09
cd04636		132	cd04636, CBS_pair_23, The CBS domain, named after	1e-08
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	1e-07
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont	4e-07
cd04586		135	cd04586, CBS_pair_BON_assoc, This cd contains two	2e-06
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c	3e-06
cd04607		113	cd04607, CBS_pair_NTP_transferase_assoc, This cd c	6e-06
cd04803		122	cd04803, CBS_pair_15, The CBS domain, named after	7e-06
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two	8e-06
cd04623		113	cd04623, CBS_pair_10, The CBS domain, named after	9e-06
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two	1e-05
cd04620		115	cd04620, CBS_pair_7, The CBS domain, named after h	1e-05
cd04611		111	cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co	2e-05
cd04801		114	cd04801, CBS_pair_M50_like, This cd contains two t	3e-05
cd04604		114	cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain	4e-05
cd04639		111	cd04639, CBS_pair_26, The CBS domain, named after	4e-05
cd04613		114	cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con	5e-05
cd04583		109	cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai	9e-05
PRK05567		486	PRK05567, PRK05567, inosine 5'-monophosphate dehyd	1e-04
cd04600		124	cd04600, CBS_pair_HPP_assoc, This cd contains two	2e-04
pfam00478		467	pfam00478, IMPDH, IMP dehydrogenase / GMP reductas	3e-04
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	3e-04
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after	4e-04
PRK03655		414	PRK03655, PRK03655, putative ion channel protein;	5e-04
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	6e-04
TIGR00393		268	TIGR00393, kpsF, KpsF/GutQ family protein	6e-04
pfam00571		57	pfam00571, CBS, CBS domain	0.001
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	0.001
cd04606		109	cd04606, CBS_pair_Mg_transporter, This cd contains	0.001
TIGR01302		450	TIGR01302, IMP_dehydrog, inosine-5'-monophosphate	0.002
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after h	0.002
cd04590		111	cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain	0.003
cd04597		113	cd04597, CBS_pair_DRTGG_assoc2, This cd contains t	0.003

>gnl\|CDD\|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel	Back alignment and domain information

 Score =  308 bits (791), Expect = 5e-98
 Identities = 152/449 (33%), Positives = 230/449 (51%), Gaps = 67/449 (14%)

Query: 99  GLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSIL 158
           G+L+G+G VLF   +  +++  + G+P   A+           + ++LVP  GG +V +L
Sbjct: 1   GVLSGLGAVLFRLLIELLQNLLFGGLPGELAAG------SLSPLYILLVPVIGGLLVGLL 54

Query: 159 NQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIA 218
            +L                    +     P+                 +  I     ++ 
Sbjct: 55  VRLL-----------------GPARGHGIPEV----------------IEAIALGGGRLP 81

Query: 219 F-QPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAG 277
               L+K +A+ +TLG+G S+G EGP V+IG +I   +G         +  LVA G+AAG
Sbjct: 82  LRVALVKFLASALTLGSGGSVGREGPIVQIGAAIGSWLGRRLRLSRNDRRILVACGAAAG 141

Query: 278 ISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAF 337
           I++ FNA +AG  FA+E ++   S A        +   V+L++V A++VS +  G+EPAF
Sbjct: 142 IAAAFNAPLAGALFAIEVLLGEYSVA--------SLIPVLLASVAAALVSRLLFGAEPAF 193

Query: 338 KVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGG 397
            VP YD  S  ELPLYLLLG+L GL+ +   R    +  +   L     IP  + P +GG
Sbjct: 194 GVPLYDPLSLLELPLYLLLGLLAGLVGVLFVRLLYKIERLFRRL----PIPPWLRPALGG 249

Query: 398 LAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVG 457
           L +GL+ L  P++L  G+  + + L        L+  +LL L+  K++AT+L   SG  G
Sbjct: 250 LLLGLLGLFLPQVLGSGYGAILLALAG-----ELSLLLLLLLLLLKLLATALTLGSGFPG 304

Query: 458 GYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQV 517
           G +APSLFIGAA G A+G  +                 VASP AY LVGMAA LA V + 
Sbjct: 305 GVFAPSLFIGAALGAAFGLLLP----------ALFPGLVASPGAYALVGMAALLAAVLRA 354

Query: 518 PLTSVLLLFELTQDYRIVLPLLGAVGLSS 546
           PLT++LL+ ELT DY ++LPL+ AV ++ 
Sbjct: 355 PLTAILLVLELTGDYSLLLPLMLAVVIAY 383

The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function. Length = 383

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238504 cd01031, EriC, ClC chloride channel EriC	Back alignment and domain information

>gnl\|CDD\|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|235385 PRK05277, PRK05277, chloride channel protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238506 cd01034, EriC_like, ClC chloride channel family	Back alignment and domain information

>gnl\|CDD\|239965 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>gnl\|CDD\|238505 cd01033, ClC_like, Putative ClC chloride channel	Back alignment and domain information

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|234963 PRK01610, PRK01610, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239654 cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>gnl\|CDD\|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>gnl\|CDD\|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>gnl\|CDD\|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>gnl\|CDD\|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>gnl\|CDD\|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>gnl\|CDD\|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>gnl\|CDD\|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>gnl\|CDD\|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|235148 PRK03655, PRK03655, putative ion channel protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|129488 TIGR00393, kpsF, KpsF/GutQ family protein	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>gnl\|CDD\|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>gnl\|CDD\|239970 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		766
PRK01862		574	putative voltage-gated ClC-type chloride channel C	100.0
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	100.0
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	100.0
PRK01610		418	putative voltage-gated ClC-type chloride channel C	100.0
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	100.0
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	100.0
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	100.0
PRK05277		438	chloride channel protein; Provisional	100.0
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	100.0
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	100.0
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	100.0
cd01034		390	EriC_like ClC chloride channel family. These prote	100.0
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	100.0
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	100.0
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	100.0
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	100.0
PRK03655		414	putative ion channel protein; Provisional	100.0
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	100.0
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.8
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.76
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	99.72
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	99.71
PRK05277		438	chloride channel protein; Provisional	99.69
COG2524		294	Predicted transcriptional regulator, contains C-te	99.67
cd01034		390	EriC_like ClC chloride channel family. These prote	99.63
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	99.61
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	99.6
PRK01610		418	putative voltage-gated ClC-type chloride channel C	99.57
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	99.54
COG3620		187	Predicted transcriptional regulator with C-termina	99.54
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	99.53
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.52
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	99.51
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	99.49
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	99.49
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	99.48
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	99.48
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.47
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	99.45
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	99.44
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	99.44
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	99.43
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	99.43
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	99.42
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	99.42
PRK03655		414	putative ion channel protein; Provisional	99.42
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	99.41
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	99.41
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	99.41
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	99.4
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	99.39
COG4109		432	Predicted transcriptional regulator containing CBS	99.39
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	99.39
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	99.39
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	99.39
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	99.39
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	99.38
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	99.38
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	99.38
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	99.38
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	99.37
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	99.37
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	99.37
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	99.37
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	99.37
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	99.36
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	99.36
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	99.35
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	99.35
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	99.35
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	99.35
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	99.34
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	99.34
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	99.34
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	99.34
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	99.34
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	99.33
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	99.33
COG2905		610	Predicted signal-transduction protein containing c	99.33
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	99.33
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	99.33
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.33
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	99.32
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	99.32
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	99.31
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	99.31
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	99.31
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	99.31
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.31
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	99.31
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	99.31
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	99.3
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	99.3
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	99.3
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	99.3
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	99.3
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.3
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	99.29
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	99.29
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	99.29
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	99.28
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.28
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	99.28
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	99.28
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	99.28
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	99.27
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	99.27
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	99.26
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.25
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	99.24
COG0517		117	FOG: CBS domain [General function prediction only]	99.24
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	99.23
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	99.21
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.21
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	99.2
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	99.19
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	99.17
PRK14869		546	putative manganese-dependent inorganic pyrophospha	99.17
PRK11573		413	hypothetical protein; Provisional	99.16
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	99.14
COG1253		429	TlyC Hemolysins and related proteins containing CB	98.99
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	98.92
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.73
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.68
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	98.64
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	98.62
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	98.61
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	98.6
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	98.58
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	98.43
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	98.35
COG3448		382	CBS-domain-containing membrane protein [Signal tra	98.3
COG2524		294	Predicted transcriptional regulator, contains C-te	98.06
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	97.98
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	97.95
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	97.92
PRK14869		546	putative manganese-dependent inorganic pyrophospha	97.87
COG3620		187	Predicted transcriptional regulator with C-termina	97.86
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	97.8
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	97.76
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	97.71
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	97.67
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	97.65
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	97.63
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	97.59
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	97.57
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	97.57
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	97.57
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	97.53
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	97.52
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	97.51
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	97.49
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	97.49
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	97.47
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	97.47
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	97.46
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	97.43
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	97.43
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	97.4
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	97.4
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	97.39
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	97.39
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	97.38
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	97.38
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	97.38
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	97.38
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	97.38
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	97.37
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	97.37
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	97.35
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	97.34
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	97.33
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	97.32
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	97.32
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	97.31
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	97.3
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	97.3
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.29
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	97.28
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	97.27
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	97.26
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	97.26
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	97.26
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	97.26
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	97.25
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	97.24
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	97.24
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	97.24
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	97.24
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	97.23
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	97.23
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.22
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	97.22
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	97.21
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	97.21
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	97.21
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	97.2
COG4109		432	Predicted transcriptional regulator containing CBS	97.18
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	97.17
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	97.16
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	97.15
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	97.13
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	97.13
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	97.08
PLN02274		505	inosine-5'-monophosphate dehydrogenase	97.07
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	97.05
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	97.05
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	97.04
COG0517		117	FOG: CBS domain [General function prediction only]	97.01
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	96.98
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	96.98
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	96.94
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	96.9
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	96.81
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	96.78
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	96.75
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	96.74
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	96.74
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	96.73
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	96.72
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	96.71
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	96.65
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	96.58
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	96.55
COG2905		610	Predicted signal-transduction protein containing c	96.17
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	95.94
PRK11573		413	hypothetical protein; Provisional	95.27
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	95.19
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	94.91
COG1253		429	TlyC Hemolysins and related proteins containing CB	94.24
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	94.11
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	93.42
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	90.47
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	86.95
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	86.92
KOG2118		498	consensus Predicted membrane protein, contains two	85.28

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.8e-79  Score=712.53  Aligned_cols=550  Identities=27%  Similarity=0.405  Sum_probs=454.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCcCCccccccCCCchhHHHHHHHHHHHHHHHHHHHHHHhhhcCCC
Q 004241           90 GVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDD  169 (766)
Q Consensus        90 ~~~l~~~lvG~l~Gl~a~lf~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~l~p~~ggl~~g~l~~~~~~~~~~~  169 (766)
                      .++++++++|+++|+++.+|+++++++++++|+..+.    +... ....+|++.+++|++||+++++++++....++  
T Consensus        23 ~~~~~~~~vG~~~Gl~~~~f~~~~~~~~~~~~~~~~~----~~~~-~~~~~~~~~~~~p~~ggli~~~~~~~~~~~~~--   95 (574)
T PRK01862         23 TMLIWSAIVGIGGAFATTAFREGIELIQHLISGHSGS----FVEM-AKSLPWYVRVWLPAAGGFLAGCVLLLANRGAR--   95 (574)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcch----HHHH-hhcccHHHHHHHHHHHHHHHHHHHHHhccccc--
Confidence            4678999999999999999999999999999875321    1111 11235666788999999999988664333211  


Q ss_pred             CCCcchhhccccCCCCCCCcccccccchhhhhcccCCCCccccchhhhhhHHHHHHHHHHHHhhcCCccCCchhHHHHHH
Q 004241          170 DDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGK  249 (766)
Q Consensus       170 ~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~k~~~~~lslgsG~s~G~EGP~v~iGa  249 (766)
                      + + +++++.+...                           +.+...++++.+.|++++++++++|+|+|||||++|+|+
T Consensus        96 ~-~-g~~~~~~~~~---------------------------~~~~~~~~~~~~~k~~~~~l~i~~G~s~G~EgP~v~~ga  146 (574)
T PRK01862         96 K-G-GKTDYMEAVA---------------------------LGDGVVPVRQSLWRSASSLLTIGSGGSIGREGPMVQLAA  146 (574)
T ss_pred             c-C-CcHHHHHHHH---------------------------cCCCCCChHHHHHHHHHHHHHHHcCCCcCCcchHHHHHH
Confidence            1 2 2333322100                           011112345567899999999999999999999999999


Q ss_pred             HHHHHHhhhhCCCchhhHHHHhhhhhHHHHHhhcchhHHHHHHHHhhccccccccchhhhhhHHHHHHHHHHHHHHHHHh
Q 004241          250 SIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEV  329 (766)
Q Consensus       250 ~ig~~l~~~~~~~~~~~r~l~~~G~aAGiaa~F~aPi~G~lFa~E~~~~~~~~~~~~~~~~~~~~~~~~aa~~a~~v~~~  329 (766)
                      ++|++++++++++++++|.+++||+|||+||+||||++|++|++|+++.+       ++.+.+.+ +++++++|+++++.
T Consensus       147 ~~~~~~~~~~~~~~~~~r~l~~~G~aAglaa~F~aPl~g~lFa~E~~~~~-------~~~~~~~~-~~~as~~a~~v~~~  218 (574)
T PRK01862        147 LAASLVGRFAHFDPPRLRLLVACGAAAGITSAYNAPIAGAFFVAEIVLGS-------IAMESFGP-LVVASVVANIVMRE  218 (574)
T ss_pred             HHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHhhh-------ccHHHHHH-HHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998764       23455555 68899999999999


Q ss_pred             hcCCCCccccCcCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCchhHHHHHHHHHHHHHHHHhcc
Q 004241          330 GLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPE  409 (766)
Q Consensus       330 ~~g~~~~f~~~~~~~~~~~el~~~i~lGv~~Gl~g~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~lggllvg~i~~~~P~  409 (766)
                      +.|+++.|.++.++..+..++++++++|++||++|.+|+++..+.++++++    .+.+.+++++++|++++++.+++|+
T Consensus       219 ~~g~~~~~~~~~~~~~~~~~~~~~~~lGv~~G~~~~~f~~~~~~~~~~~~~----~~~~~~~~~~~~gl~~g~l~~~~p~  294 (574)
T PRK01862        219 FAGYQPPYEMPVFPAVTGWEVLLFVALGVLCGAAAPQFLRLLDASKNQFKR----LPVPLPVRLALGGLLVGVISVWVPE  294 (574)
T ss_pred             HcCCCceeeCCCcCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc----cCCchhHHHHHHHHHHHHHHHHHHH
Confidence            899999999886665567889999999999999999999988776554432    3345667889999999999999999


Q ss_pred             cccCCHHHHHHHHccCCCcccccHHHHHHHHHHHHHHHHHhhhcCCccceechHhHHHHHHhHHHHHHHHHhhhcCCCcc
Q 004241          410 ILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTI  489 (766)
Q Consensus       410 ~~g~G~~~i~~ll~~~~~~~~~~~~~l~~~~~~K~~~t~lt~gsG~~gG~f~Psl~iGa~~G~~~g~~~~~~~~~~~~~~  489 (766)
                      .+|+||+.++.++++.     .+...++.++++|+++|++|+|+|+|||+|+|++++||++|+++|++++.+++.     
T Consensus       295 ~~g~G~~~i~~~~~~~-----~~~~~l~~~~~~K~~~t~~t~g~G~~GG~f~P~l~iGa~~G~~~g~~~~~~~~~-----  364 (574)
T PRK01862        295 VWGNGYSVVNTILHAP-----WTWQALVAVLVAKLIATAATAGSGAVGGVFTPTLFVGAVVGSLFGLAMHALWPG-----  364 (574)
T ss_pred             HhcCCHHHHHHHHcCC-----chHHHHHHHHHHHHHHHHHHHccCCCccchhhHHHHHHHHHHHHHHHHHHhCCC-----
Confidence            9999999999988764     345566777899999999999999999999999999999999999999876553     


Q ss_pred             ccccccccchHHHHHHHHHHHHHHhcCchHHHHHHHHHHhCCchhHHHHHHHHHHHHHHHhhhccCCcchhhHHHhhhcc
Q 004241          490 HFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANT  569 (766)
Q Consensus       490 ~~~~~~~~~p~~~alvGaaa~lag~~~aPls~~viv~Eltg~~~~llP~mia~~va~~v~~~~~~~~~~~~~~~~~~~~~  569 (766)
                           ....|..|+++||+|++++++|+|++++++++|+|+++++++|+|+++++|+++++. ++.+++|+.....+.  
T Consensus       365 -----~~~~~~~~a~vGmaa~~aa~~~aPlt~i~l~~Elt~~~~~~~P~~ia~~~a~~v~~~-~~~~~iy~~~~~~~~--  436 (574)
T PRK01862        365 -----HTSAPFAYAMVGMGAFLAGATQAPLMAILMIFEMTLSYQVVLPLMVSCVVAYFTARA-LGTTSMYEITLRRHQ--  436 (574)
T ss_pred             -----cccchHHHHHHHHHHHHHHHHccHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHH-hCCCChHHHHHHhcc--
Confidence                 224578899999999999999999999999999999999999999999999998764 467889987542100  


Q ss_pred             ccccchhhccccccCCCCccccccchhhhhhhhhhccccccccchhhhhhhccccccccccccceeEEeCCccHHHHHHH
Q 004241          570 NRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTL  649 (766)
Q Consensus       570 ~~~~~~~~~p~~~~~l~~~~~l~~~~~~~~~l~~~~s~~~~~d~~~~~~~~l~~~~V~diM~~~~~~V~~~~tl~eal~~  649 (766)
                                                                  .+.+.+.++.++++|+|+++..++++++++.|+.+.
T Consensus       437 --------------------------------------------~~~~~~~L~~~~V~dim~~~~~~v~~~~tl~ea~~~  472 (574)
T PRK01862        437 --------------------------------------------DEAERERLRTTQMRELIQPAQTVVPPTASVADMTRV  472 (574)
T ss_pred             --------------------------------------------ccchhhHHhhCcHHHHhcCCCceeCCCCCHHHHHHH
Confidence                                                        012356788899999999999999999999999999


Q ss_pred             HHHcCCcEEEEecCCCcEEEEEehhhHHHHHHHHhhhccccchhHhhhcccCCCCccCCeEeCCCCCHHHHHHHHHHcCC
Q 004241          650 MLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGV  729 (766)
Q Consensus       650 m~~~~~~~~pVvd~~g~lvGiVt~~dL~~~l~~~~~~~~~~~~~V~dvm~~~~~~~~~~~~V~~d~sL~eal~~m~~~~~  729 (766)
                      |.+++.+.+||+|++++++|+|+.+|+.+.+.+.+   ...+.+++|+|++      ++.++++|+++.|++++|.+++.
T Consensus       473 l~~~~~~~~~VvD~~g~lvGiVt~~dL~~~l~~~~---~~~~~~v~dim~~------~~~~v~~d~~L~~al~~m~~~~~  543 (574)
T PRK01862        473 FLEYPVKYLYVVDDDGRFRGAVALKDITSDLLDKR---DTTDKTAADYAHT------PFPLLTPDMPLGDALEHFMAFQG  543 (574)
T ss_pred             HHhCCCceEEEEcCCCeEEEEEEHHHHHHHhhccc---ccccchHHHhccC------CCeeECCCCCHHHHHHHHHhcCC
Confidence            99999999999999999999999999987654321   1123578999988      78899999999999999999999


Q ss_pred             CEEEEEeccCCCCCCcEEEEEeHHHHHHHhhc
Q 004241          730 NQVPVVMEHIPGQRGQLVGLLDRESIILACRF  761 (766)
Q Consensus       730 ~~lpVVde~~~~~~g~lvGIVt~~DIl~~~~~  761 (766)
                      +++||||+++   +++++|+||++|+++++++
T Consensus       544 ~~lpVVd~~~---~~~liGvIt~~DIl~~l~~  572 (574)
T PRK01862        544 ERLPVVESEA---SPTLAGVVYKTSLLDAYRR  572 (574)
T ss_pred             CeeeeEeCCC---CCeEEEEEEHHHHHHHHHh
Confidence            9999999621   2589999999999998865

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		766
2ht2_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		1e-11
2ez0_A		473	Crystal Structure Of The S107aE148QY445A MUTANT OF		2e-11
2htk_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		2e-11
3det_A		473	Structure Of The E418a, Y445a Doubly Ungated Mutant		2e-11
2ht3_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		2e-11
3ejz_A		473	Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C		2e-11
3ejy_A		473	Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE		3e-11
1kpk_A		473	Crystal Structure Of The Clc Chloride Channel From		3e-11
2exy_A		473	Crystal Structure Of The E148q Mutant Of Ecclc, Fab		3e-11
2ht4_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		3e-11
2htl_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		3e-11
2hlf_A		444	Structure Of The Escherichis Coli Clc Chloride Chan		7e-11
2r9h_A		444	Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com		1e-10
1ots_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		1e-10
4ftp_A		465	Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT		1e-10
2fec_A		465	Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE		1e-10
1otu_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		1e-10
1ott_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		1e-10
4ene_A		446	Structure Of The N- And C-Terminal Trimmed Clc-Ec1		2e-10
3nmo_A		465	Crystal Structure Of An Engineered Monomeric Clc-Ec		5e-10
1kpl_A		473	Crystal Structure Of The Clc Chloride Channel From		1e-09
3nd0_A		466	X-Ray Crystal Structure Of A Slow Cyanobacterial Cl		9e-08

>pdb|2HT2|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445h Mutant And Fab Complex Length = 473