Citrus Sinensis ID: 004320

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-
MSASLAPFERPRPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDESLHRCSISADSHVDNSGSEDSSDEENLDMKNNGYHDAQNEVDPESDDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGDPGDQVVEQQGKQKKGNENSITEMEVSSVLPAGESYHSMGEILSSVDPGHPLSVSGLESSAEKPVGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQRLEITKNDLRHRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFSSSRGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNHNSQQSFSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
cccccccccccccccccccccccccEEEEEccccccccEEEEEEEccEEEEEccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEcccHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccccccccccccccccccccccEEEEEEEEHHHcccccccc
ccccccccccccccccccEEEcccEEEEEccccccccccEEEEEEccEEEEEEcccccccccccccccccccEEcccccEEEcccccccEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHccccccccEcccHHHHHHHcccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcHHcccccHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHcccccccccccEHcHHHHHHEEEEEEEHHHHHHEcccc
msaslapferprpgasntvfksgplfisskgigwkswkKRWFILTRTSLvffkndpsalpqrggevnltlggidlnnsgsvvvredKKLLTvlfpdgrdgraftlkaetsEDLYEWKTALELALAQAPSaalvmghngifrndtndtiegsfhqwrdkrpvkslvvgRPILLaledidggpSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEqgktefsadedaHVIGDCVKHVlrelpsspvpasCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTIsshahenrmtpsaVAACMAPLllrpllageceleddfdmngdNSAQLLAAANAANNAQAIIATLLEEYenifddeslhrcsisadshvdnsgsedssdeenldmknngyhdaqnevdpesdddperahsgklsessgyagsdlydykalggddsdvgsprnnnasaessklpidpiqigdpgdQVVEQQgkqkkgnensitemevssvlpagesyhsmgeilssvdpghplsvsglessaekpvgkgtssnfsakrsafwgrsnarktssvesidssgeEELAIQRLEITKNDLRHRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLsmssgqfsssrgmdskTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRyqnvqnhnsqqsfssnifnlpirlpfLAFQYLVLKLTIVCGMMVNFQS
msaslapferprpgasntvfksgplfisskgigwkswkKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLggidlnnsgsvvvredKKLLtvlfpdgrdgraftlkaetsEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGsfhqwrdkrpvksLVVGRPILLAledidggpSFLEKALRFLEKFGTKVEGIlrqaadveevdRRVQEYEQgktefsadedaHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRsailetfpepnRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDESLHRCSISadshvdnsgsedssDEENLDMKNNGYHDAQNEVDPESDDDPERAHsgklsessgyagSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGDPGDQVVEQQGkqkkgnensitemEVSSVLPAGESYHSMGEILSSVDPGHPLSVSGlessaekpvgkgtssnfsakrsafwgrsnarktssvesidssgeeeLAIQRLEITKNDLRHRIAKEargnailqaSLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGlsmssgqfsssrgmdSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNHNSQQSFSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
MSASLAPFERPRPGASNTVFKSGPLFisskgigwkswkkRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSaqllaaanaannaqaiiaTLLEEYENIFDDESLHRCSISADSHVdnsgsedssdeenldMKNNGYHDAQNEVDPESDDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGDPGDqvveqqgkqkkgnenSITEMEVSSVLPAGESYHSMGEILSSVDPGHPLSVSGLESSAEKPVGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQRLEITKNDLRHRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLsmssgqfsssrgmdsKTRaeleeialaeaDVARLKQKVAElhhqlnqqrqhhYGSLSDACDRYqnvqnhnsqqsfssnIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
******************VFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVD****************EDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISS*******TPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDESLHRC*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************FSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNF**
************************LFISSKGIGWKSWKKRWFILTRTSLVFF***********************************KLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELA*******************************************GRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAY***********MRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLR**************************ANAANNAQAIIATLLEEYENIFDDE************************************************************************************************************************************************************************************************************************************************************************************************************ALAEADVAR************************************************LPIRLPFLAFQYLVLKLTIVCGMMVNFQ*
***********RPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDESLHRCSIS*****************NLDMKNNGYHDAQN*********************SGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGDPGD****************ITEMEVSSVLPAGESYHSMGEILSSVDPGHPLSV*****************NFSAKRSAFW*******************EELAIQRLEITKNDLRHRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMS**************RAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNHNSQQSFSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
****************NTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSA********NLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPS*******************EGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDD*************************************************************************************************************************************************************************************************************EELAIQRLEITKNDLRHRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMS*****S*RGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHH**********YQN*******QSFSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASLAPFERPRPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDESLHRCSISADSHVDNSGSEDSSDEENLDMKNNGYHDAQNEVDPESDDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGDPGDQVVEQQGKQKKGNENSITEMEVSSVLPAGESYHSMGEILSSVDPGHPLSVSGLESSAEKPVGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQRLEITKNDLRHRIAKEARGNAILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRAALEVGLSMSSGQFSSSRGMDSKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHYGSLSDACDRYQNVQNHNSQQSFSSNIFNLPIRLPFLAFQYLVLKLTIVCGMMVNFQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query761 2.2.26 [Sep-21-2011]
Q8N264748 Rho GTPase-activating pro yes no 0.519 0.528 0.232 7e-15
Q8C4V1747 Rho GTPase-activating pro yes no 0.484 0.493 0.225 7e-14
Q5U2Z7748 Rho GTPase-activating pro yes no 0.511 0.520 0.223 1e-13
Q8BL80702 Rho GTPase-activating pro no no 0.404 0.438 0.240 2e-13
Q91YM21499 Rho GTPase-activating pro no no 0.207 0.105 0.267 6e-13
P811281513 Rho GTPase-activating pro yes no 0.207 0.104 0.267 1e-12
P835091500 Rho GTPase-activating pro no no 0.207 0.105 0.260 1e-12
Q9NRY41499 Rho GTPase-activating pro no no 0.207 0.105 0.260 2e-12
Q9P2F6 1191 Rho GTPase-activating pro no no 0.289 0.184 0.262 1e-11
Q5ZMM3475 Rho GTPase-activating pro no no 0.416 0.667 0.214 3e-11
>sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 111/477 (23%), Positives = 177/477 (37%), Gaps = 82/477 (17%)

Query: 9   ERPRPG-ASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALPQRGGEVN 67
           E P+ G       K G  ++  +G   K+W  RWF+L    L +FK++    P       
Sbjct: 9   ENPQQGQGRQNAIKCG--WLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKP------- 59

Query: 68  LTLGGIDL--NNSGSVVVREDK--KLLTVLFPDGRDGR------AFTLKAETSEDLYEWK 117
             LG I L  N        E+   K L  + P G   R      ++ L A T  D+ +W 
Sbjct: 60  --LGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWV 117

Query: 118 TALELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDI 177
            ++   +   P         GIF     DT+        +KR    L             
Sbjct: 118 KSIRRVIW-GPFGG------GIFGQKLEDTVR------YEKRYGNRL------------- 151

Query: 178 DGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQG-KTEFSADEDAHVIGD 236
              P  +E+ + F+ + G K EG+ R       V      ++ G K  F ++ D H +  
Sbjct: 152 --APMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVAS 209

Query: 237 CVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAI-LETFPEPNRRLLQRILR 295
            +K  LRELP   +P +     L   K+  KE        A  +++ P  N  LL+ I R
Sbjct: 210 LLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICR 269

Query: 296 MMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAAN 355
            +  + S++  N+M+   +A    P +LRP      ++ED            L       
Sbjct: 270 FLDEVQSYSGVNKMSVQNLATVFGPNILRP------KVEDP-----------LTIMEGTV 312

Query: 356 NAQAIIATLLEEYENIFDDESLHRCSISADSHVDNSGSEDSSDEENLDMKNNGYHDAQNE 415
             Q +++ ++          S H C    D+ +  S  +D     N   K       QN+
Sbjct: 313 VVQQLMSVMI----------SKHDCLFPKDAELQ-SKPQDGVSNNNEIQKKATMGQLQNK 361

Query: 416 VDPESDDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLP 472
            +  + D P R  S   SES   +  +     AL G  S   SP+N+    + S+ P
Sbjct: 362 ENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSG--SKTNSPKNSVHKLDVSRSP 416
Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.
Homo sapiens (taxid: 9606)
>sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=2 SV=2 Back     alignment and function description
>sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=2 SV=2 Back     alignment and function description
>sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 Back     alignment and function description
>sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 Back     alignment and function description
>sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 Back     alignment and function description
>sp|P83509|RHG35_CANFA Rho GTPase-activating protein 35 OS=Canis familiaris GN=ARHGAP35 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 Back     alignment and function description
>sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
296083863 886 unnamed protein product [Vitis vinifera] 0.964 0.828 0.862 0.0
224105983 872 predicted protein [Populus trichocarpa] 0.956 0.834 0.877 0.0
359479285 884 PREDICTED: uncharacterized protein LOC10 0.961 0.828 0.861 0.0
224055297 876 predicted protein [Populus trichocarpa] 0.955 0.829 0.850 0.0
449442585 870 PREDICTED: uncharacterized protein LOC10 0.952 0.833 0.842 0.0
357493921 920 Rho GTPase-activating protein [Medicago 0.950 0.785 0.766 0.0
356499307 870 PREDICTED: uncharacterized protein LOC10 0.952 0.833 0.825 0.0
255570167821 Rho GTPase activator, putative [Ricinus 0.889 0.824 0.856 0.0
356554157861 PREDICTED: uncharacterized protein LOC10 0.946 0.836 0.815 0.0
79328136822 Rho GTPase activation protein [Arabidops 0.947 0.877 0.740 0.0
>gi|296083863|emb|CBI24251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/735 (86%), Positives = 676/735 (91%), Gaps = 1/735 (0%)

Query: 1   MSASLAPFERPRPGASNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKNDPSALP 60
           MSASLA  ERPR G S TVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFK+DP+ALP
Sbjct: 1   MSASLAALERPRIGPSTTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFFKSDPNALP 60

Query: 61  QRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTAL 120
           QRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAE+SEDLY WKTAL
Sbjct: 61  QRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAESSEDLYGWKTAL 120

Query: 121 ELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGG 180
           E ALAQAPSAALVMGHNGIFRNDT+DT+EGSF QWRDKR VKSLVVGRPILLALEDIDGG
Sbjct: 121 EQALAQAPSAALVMGHNGIFRNDTSDTMEGSFCQWRDKRTVKSLVVGRPILLALEDIDGG 180

Query: 181 PSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKH 240
           PSFLEKALRFLEKFG KVEGILRQ+ADVEEVDRRVQEYEQGKTEF ADEDAHV+GDCVKH
Sbjct: 181 PSFLEKALRFLEKFGIKVEGILRQSADVEEVDRRVQEYEQGKTEFGADEDAHVVGDCVKH 240

Query: 241 VLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTI 300
           VLRELPSSPVPASCCTALLEAYKIDRK+AR+SAMRSAILETFPEPNRRLLQRIL+MMH I
Sbjct: 241 VLRELPSSPVPASCCTALLEAYKIDRKDARVSAMRSAILETFPEPNRRLLQRILKMMHAI 300

Query: 301 SSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAI 360
           SSHA ENRMTP AVAACMAPLLLRPLLAGECELEDDFDMNGD+SAQLLAAANAANNAQAI
Sbjct: 301 SSHASENRMTPPAVAACMAPLLLRPLLAGECELEDDFDMNGDSSAQLLAAANAANNAQAI 360

Query: 361 IATLLEEYENIFDDESLHRCSISADSHVDNSGSEDSSDEENLDMKNNGYHDAQNEVDPES 420
           I TLLEEYENIFDD++LHRCSISADS ++NSGSEDS+D+EN+DM++NGYHDA+NEVDP++
Sbjct: 361 ITTLLEEYENIFDDDNLHRCSISADSRIENSGSEDSTDDENIDMRDNGYHDAENEVDPDT 420

Query: 421 DDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGD 480
           +DDPER HSGKLSESSGYAGSDLYDYKA G DDSDVGSP +N AS  +S L +D   + D
Sbjct: 421 EDDPERVHSGKLSESSGYAGSDLYDYKAFGVDDSDVGSPTDNRASEVNSNL-LDSQPVRD 479

Query: 481 PGDQVVEQQGKQKKGNENSITEMEVSSVLPAGESYHSMGEILSSVDPGHPLSVSGLESSA 540
              Q++EQQ KQ KG+E+ I EM+  S+LPA ES  SMGEIL+S+DPG PL VSGLESSA
Sbjct: 480 SNIQIIEQQDKQNKGSESPINEMDSPSILPAVESQRSMGEILASMDPGLPLPVSGLESSA 539

Query: 541 EKPVGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQRLEITKNDLRHRIAK 600
           EK VGK TSSN + KRS FWGRS ARKT S ES+DSSGEEELAIQRLEITKNDLRHRIAK
Sbjct: 540 EKAVGKLTSSNPNGKRSTFWGRSTARKTPSTESVDSSGEEELAIQRLEITKNDLRHRIAK 599

Query: 601 EARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFSS 660
           EARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSM SGQFS+
Sbjct: 600 EARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMPSGQFSN 659

Query: 661 SRGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNH 720
           SRGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNH
Sbjct: 660 SRGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHHYGSLSDACDRYQNVQNH 719

Query: 721 NSQQSFSSNIFNLPI 735
           +SQQ F    F+  +
Sbjct: 720 SSQQKFLQQDFDTTL 734

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224105983|ref|XP_002314002.1| predicted protein [Populus trichocarpa] gi|222850410|gb|EEE87957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359479285|ref|XP_002276277.2| PREDICTED: uncharacterized protein LOC100246624 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224055297|ref|XP_002298467.1| predicted protein [Populus trichocarpa] gi|222845725|gb|EEE83272.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449442585|ref|XP_004139062.1| PREDICTED: uncharacterized protein LOC101220273 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357493921|ref|XP_003617249.1| Rho GTPase-activating protein [Medicago truncatula] gi|355518584|gb|AET00208.1| Rho GTPase-activating protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356499307|ref|XP_003518483.1| PREDICTED: uncharacterized protein LOC100820132 [Glycine max] Back     alignment and taxonomy information
>gi|255570167|ref|XP_002526044.1| Rho GTPase activator, putative [Ricinus communis] gi|223534625|gb|EEF36321.1| Rho GTPase activator, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356554157|ref|XP_003545415.1| PREDICTED: uncharacterized protein LOC100817923 [Glycine max] Back     alignment and taxonomy information
>gi|79328136|ref|NP_001031904.1| Rho GTPase activation protein [Arabidopsis thaliana] gi|332005314|gb|AED92697.1| Rho GTPase activation protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
TAIR|locus:2150265 870 AT5G19390 [Arabidopsis thalian 0.923 0.808 0.646 2.3e-229
TAIR|locus:2176992827 AT5G12150 [Arabidopsis thalian 0.613 0.564 0.684 2.1e-226
ZFIN|ZDB-GENE-090313-87698 arhgap22 "Rho GTPase activatin 0.190 0.207 0.265 4.8e-13
UNIPROTKB|E2RFM4749 ARHGAP24 "Uncharacterized prot 0.190 0.193 0.272 8.1e-13
UNIPROTKB|D4A814312 D4A814 "Uncharacterized protei 0.189 0.461 0.272 7.7e-12
UNIPROTKB|Q8N264748 ARHGAP24 "Rho GTPase-activatin 0.190 0.193 0.272 1.6e-11
UNIPROTKB|H9KZU21494 ARHGAP35 "Uncharacterized prot 0.189 0.096 0.278 1.8e-11
ZFIN|ZDB-GENE-060526-441530 arhgap35 "Rho GTPase activatin 0.218 0.108 0.272 3.8e-11
MGI|MGI:19294941499 Grlf1 "glucocorticoid receptor 0.189 0.096 0.272 1e-10
UNIPROTKB|E1B8011500 ARHGAP35 "Uncharacterized prot 0.214 0.108 0.253 1.7e-10
TAIR|locus:2150265 AT5G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2213 (784.1 bits), Expect = 2.3e-229, P = 2.3e-229
 Identities = 462/715 (64%), Positives = 521/715 (72%)

Query:     1 MSASLAPFERPRPGASNTVFKSGPLFXXXXXXXXXXXXXRWFILTRTSLVFFKNDPSALP 60
             M ASLA  ERPR  ASNTVFKSGPLF             RWFILTRTSLVFFKNDP  LP
Sbjct:     1 MEASLAALERPRGSASNTVFKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPGTLP 60

Query:    61 QRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLYEWKTAL 120
             Q+GGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAET EDLYEWKTAL
Sbjct:    61 QKGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETFEDLYEWKTAL 120

Query:   121 ELALAQAPSAALVMGHNGIFRNDTNDTIEGSFHQWRDKRPVKSLVVGRPILLALEDIDGG 180
             E ALAQAP+AAL+MG NGIFR +TN+ IEG     R+KRP+KSLVVGRPILLALEDIDG 
Sbjct:   121 EQALAQAPNAALIMGQNGIFRAETNEAIEG-----REKRPLKSLVVGRPILLALEDIDGS 175

Query:   181 PSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADEDAHVIGDCVKH 240
             PSFLEKAL+F+EK+GTK+EGILRQ+ADVEEV+RRVQEYEQGKTEF+ DED HV+GDC+KH
Sbjct:   176 PSFLEKALQFIEKYGTKIEGILRQSADVEEVERRVQEYEQGKTEFTFDEDPHVVGDCIKH 235

Query:   241 VLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTI 300
             VLRELPSSPV ASCCTALLEAY+I+ KEARIS++RSAI ETFPEPNRRLLQRIL+MMHTI
Sbjct:   236 VLRELPSSPVSASCCTALLEAYRIESKEARISSLRSAIAETFPEPNRRLLQRILKMMHTI 295

Query:   301 SSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSXXXXXXXXXXXXXXXX 360
             SSH+HENRM P+AVAACMAPLLLRPLLAGEC+LEDDFD   DNS                
Sbjct:   296 SSHSHENRMNPNAVAACMAPLLLRPLLAGECDLEDDFDGGEDNSAQLLAAANAANNAQAI 355

Query:   361 XXTLLEEYENIFDDESLHRCSISADSHVXXXXXXXXXXXXXXXMKNNGYHDAQNEVDPES 420
                LLE+Y +IFD+E++ RCSIS +SH+               MKN GYH+A NEV+P +
Sbjct:   356 ITVLLEDYGSIFDEENIQRCSISTESHIGNSGPDDSSDDDNN-MKN-GYHNADNEVEPVT 413

Query:   421 DDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNASAESSKLPIDPIQIGD 480
             DDD +RA SGK+SESSG  GSDLY+YK    DDSD+ SPR+ N    +S +  D + + +
Sbjct:   414 DDDNDRALSGKMSESSGCTGSDLYEYKGFVADDSDIESPRDTNGPRCNSNIRTDHL-MRN 472

Query:   481 PGDXXXXXXXXXXXXXXXSITEMEVSSVLP-AGESYHSMGEILSSVDPGHPLSVSGLESS 539
             P                   T+  V+S L    ESY   G  L+    G+ L+  GLES 
Sbjct:   473 P--FVNSTDQQAGEQIGDDPTKYGVNSCLAHVSESYQQSGTGLNVPTHGNTLAAPGLESP 530

Query:   540 AEKPVGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQRLEITKNDLRHRIA 599
             + K V KGT S+  AKR+ FWGR +ARK S+  S DSSGE+ELAIQRLE TKN+LR RIA
Sbjct:   531 SAKSVNKGTPSSVHAKRATFWGRGSARKISTDGSFDSSGEDELAIQRLETTKNELRQRIA 590

Query:   600 KEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLXXXXXXXX 659
             KEARGNAILQASLERRKQALHERRL+LEQDVSRLQEQLQAERDLRAALEVGL        
Sbjct:   591 KEARGNAILQASLERRKQALHERRLSLEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFS 650

Query:   660 XXXXXXXKTRXXXXXXXXXXXDVARLKQKVAEXXXXXXXXXXXXYGSLSDACDRY 714
                    KTR           DVARLKQKVAE            +GS SDA D +
Sbjct:   651 SHGVDS-KTRAELEEIALAEADVARLKQKVAELHHQLNQQRQTHFGSFSDARDTH 704
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0035091 "phosphatidylinositol binding" evidence=ISS
GO:0005100 "Rho GTPase activator activity" evidence=ISS
TAIR|locus:2176992 AT5G12150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-87 arhgap22 "Rho GTPase activating protein 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFM4 ARHGAP24 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A814 D4A814 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N264 ARHGAP24 "Rho GTPase-activating protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZU2 ARHGAP35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-44 arhgap35 "Rho GTPase activating protein 35b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1929494 Grlf1 "glucocorticoid receptor DNA binding factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1B801 ARHGAP35 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
pfam00620152 pfam00620, RhoGAP, RhoGAP domain 3e-39
cd00159169 cd00159, RhoGAP, RhoGAP: GTPase-activator protein 1e-36
smart00324174 smart00324, RhoGAP, GTPase-activator protein for R 2e-30
pfam1438988 pfam14389, Lzipper-MIP1, Leucine-zipper of ternary 1e-25
cd04373185 cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase- 2e-18
cd04403187 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_ 1e-16
cd04404195 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGA 8e-15
cd04393189 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP 3e-14
cd04376206 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (G 4e-14
cd04377186 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGA 1e-13
cd04402192 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP 3e-13
cd04374203 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activato 2e-12
smart00233102 smart00233, PH, Pleckstrin homology domain 4e-12
cd04384195 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPas 5e-12
cd04375220 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase- 6e-12
cd04390199 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24 1e-11
pfam00169101 pfam00169, PH, PH domain 1e-11
cd04389187 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase- 2e-11
cd04385184 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase- 2e-11
cd04407186 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: Rho 5e-11
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 8e-11
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 2e-10
cd04379207 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase- 5e-10
cd04395196 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP 7e-10
cd04383188 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPas 8e-10
cd04386203 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTP 8e-09
cd04409211 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPas 1e-08
cd04406186 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: Rho 5e-08
cd04391216 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP 7e-08
cd04394202 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGA 1e-07
cd04378203 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: Rho 2e-07
cd04398192 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPas 2e-07
cd04372194 cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGA 3e-07
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 6e-07
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 7e-07
cd04387196 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-ac 1e-06
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 1e-06
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 2e-06
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 4e-06
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 5e-06
cd04392208 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP 6e-06
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 1e-05
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 1e-05
cd04408200 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase- 1e-05
cd1327991 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) d 3e-05
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 4e-05
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 5e-05
cd04381182 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTP 2e-04
cd13297123 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h 2e-04
cd04382193 cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGA 2e-04
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 2e-04
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 2e-04
cd04400190 cd04400, RhoGAP_fBEM3, RhoGAP_fBEM3: RhoGAP (GTPas 3e-04
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 3e-04
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 4e-04
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 5e-04
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 5e-04
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 6e-04
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
cd01256112 cd01256, PH_dynamin, Dynamin pleckstrin homology ( 0.002
>gnl|CDD|216027 pfam00620, RhoGAP, RhoGAP domain Back     alignment and domain information 
 Score =  141 bits (358), Expect = 3e-39
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 3/147 (2%)

Query: 181 PSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFSADE--DAHVIGDCV 238
           P  +EK + FLEK G   EGI R +     +    + ++ G+      E  D HV+   +
Sbjct: 1   PLIVEKCVEFLEKRGLDTEGIFRVSGSASRIKELREAFDSGEDVDLDLEEEDVHVVASLL 60

Query: 239 KHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMH 298
           K  LRELP   +        +EA K + +E R+ A+R  +L   P  NR  L+ +L  ++
Sbjct: 61  KLFLRELPEPLLTFELYEEFIEAAKSEDEEERVEALR-ELLRKLPPANRDTLRYLLAHLN 119

Query: 299 TISSHAHENRMTPSAVAACMAPLLLRP 325
            ++ ++  N+M    +A    P LLRP
Sbjct: 120 RVAQNSEVNKMNAHNLAIVFGPTLLRP 146

GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. Length = 152
>gnl|CDD|238090 cd00159, RhoGAP, RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases Back     alignment and domain information
>gnl|CDD|214618 smart00324, RhoGAP, GTPase-activator protein for Rho-like GTPases Back     alignment and domain information
>gnl|CDD|206557 pfam14389, Lzipper-MIP1, Leucine-zipper of ternary complex factor MIP1 Back     alignment and domain information
>gnl|CDD|239838 cd04373, RhoGAP_p190, RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins Back     alignment and domain information
>gnl|CDD|239868 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains Back     alignment and domain information
>gnl|CDD|239869 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) Back     alignment and domain information
>gnl|CDD|239858 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins Back     alignment and domain information
>gnl|CDD|239841 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins Back     alignment and domain information
>gnl|CDD|239842 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins Back     alignment and domain information
>gnl|CDD|239867 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins Back     alignment and domain information
>gnl|CDD|239839 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|239849 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA Back     alignment and domain information
>gnl|CDD|239840 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins Back     alignment and domain information
>gnl|CDD|239855 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|239854 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain Back     alignment and domain information
>gnl|CDD|239850 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs Back     alignment and domain information
>gnl|CDD|239872 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239844 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins Back     alignment and domain information
>gnl|CDD|239860 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins Back     alignment and domain information
>gnl|CDD|239848 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs Back     alignment and domain information
>gnl|CDD|239851 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins Back     alignment and domain information
>gnl|CDD|239874 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>gnl|CDD|239871 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA Back     alignment and domain information
>gnl|CDD|239856 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins Back     alignment and domain information
>gnl|CDD|239859 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins Back     alignment and domain information
>gnl|CDD|239843 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>gnl|CDD|239863 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins Back     alignment and domain information
>gnl|CDD|239837 cd04372, RhoGAP_chimaerin, RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|239852 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239857 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|239873 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) Back     alignment and domain information
>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|239846 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin Back     alignment and domain information
>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 Back     alignment and domain information
>gnl|CDD|239847 cd04382, RhoGAP_MgcRacGAP, RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|239865 cd04400, RhoGAP_fBEM3, RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|241287 cd01256, PH_dynamin, Dynamin pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 761
KOG4271 1100 consensus Rho-GTPase activating protein [Signal tr 100.0
cd04402192 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac 100.0
cd04372194 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- 100.0
cd04386203 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa 100.0
KOG1451812 consensus Oligophrenin-1 and related Rho GTPase-ac 100.0
cd04390199 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas 100.0
cd04391216 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac 100.0
cd04407186 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas 100.0
cd04375220 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator 100.0
cd04381182 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa 100.0
cd04384195 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato 100.0
cd04397213 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato 100.0
cd04383188 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato 100.0
cd04403187 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G 100.0
cd04395196 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac 100.0
cd04404195 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- 100.0
cd04408200 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator 100.0
cd04406186 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas 100.0
cd04394202 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- 100.0
cd04396225 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas 100.0
cd04376206 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti 100.0
cd04398192 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato 100.0
cd04400190 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato 100.0
cd04377186 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- 100.0
cd04378203 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas 100.0
cd04373185 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator 100.0
cd04409211 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato 100.0
cd04387196 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr 100.0
cd04393189 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac 100.0
cd04392208 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac 100.0
cd04379207 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator 100.0
KOG4407 1973 consensus Predicted Rho GTPase-activating protein 100.0
cd04385184 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator 100.0
cd04399212 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activato 100.0
cd04382193 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- 100.0
cd04374203 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein 100.0
cd04389187 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator 100.0
cd04388200 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr 100.0
KOG11171186 consensus Rho- and Arf-GTPase activating protein A 100.0
KOG1450650 consensus Predicted Rho GTPase-activating protein 99.97
smart00324174 RhoGAP GTPase-activator protein for Rho-like GTPas 99.97
KOG4270577 consensus GTPase-activator protein [Signal transdu 99.97
KOG2200674 consensus Tumour suppressor protein p122-RhoGAP/DL 99.97
cd04380220 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato 99.96
cd00159169 RhoGAP RhoGAP: GTPase-activator protein (GAP) for 99.96
KOG42691112 consensus Rac GTPase-activating protein BCR/ABR [S 99.96
PF00620151 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members 99.95
KOG4406467 consensus CDC42 Rho GTPase-activating protein [Sig 99.95
KOG2710412 consensus Rho GTPase-activating protein [Signal tr 99.94
KOG4724741 consensus Predicted Rho GTPase-activating protein 99.92
PF1438988 Lzipper-MIP1: Leucine-zipper of ternary complex fa 99.91
KOG1453918 consensus Chimaerin and related Rho GTPase activat 99.9
KOG3564604 consensus GTPase-activating protein [General funct 99.88
KOG42711100 consensus Rho-GTPase activating protein [Signal tr 99.73
KOG1452442 consensus Predicted Rho GTPase-activating protein 99.71
cd04405235 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPas 99.66
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.66
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.65
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.62
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.59
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.58
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.57
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.56
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.54
cd04401198 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activato 99.53
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.53
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.5
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.49
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.48
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.45
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.44
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.39
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.38
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.34
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.33
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.3
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.28
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.26
KOG4370514 consensus Ral-GTPase effector RLIP76 [Signal trans 99.23
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.21
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.16
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.12
KOG3565640 consensus Cdc42-interacting protein CIP4 [Cytoskel 99.09
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.08
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.05
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.02
PF1540989 PH_8: Pleckstrin homology domain 98.99
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.97
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.81
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.79
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.71
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.69
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.69
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.57
KOG4724741 consensus Predicted Rho GTPase-activating protein 98.55
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.48
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 98.46
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.42
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.42
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.29
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 98.19
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.17
PF08101420 DUF1708: Domain of unknown function (DUF1708); Int 98.16
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 98.1
KOG3751622 consensus Growth factor receptor-bound proteins (G 97.75
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 97.66
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 97.62
PLN00188719 enhanced disease resistance protein (EDR2); Provis 97.59
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 97.57
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 97.53
PTZ00267478 NIMA-related protein kinase; Provisional 97.49
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.33
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.33
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 96.86
KOG0248936 consensus Cytoplasmic protein Max-1, contains PH, 96.78
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 96.65
KOG35431218 consensus Ca2+-dependent activator protein [Signal 96.58
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 96.48
PTZ00283496 serine/threonine protein kinase; Provisional 96.4
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 96.28
PLN02866 1068 phospholipase D 96.28
PF15408104 PH_7: Pleckstrin homology domain 96.19
KOG3723851 consensus PH domain protein Melted [Signal transdu 95.8
KOG1453918 consensus Chimaerin and related Rho GTPase activat 95.79
KOG35311036 consensus Rho guanine nucleotide exchange factor C 95.74
PF15406112 PH_6: Pleckstrin homology domain 95.19
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 95.06
KOG1739611 consensus Serine/threonine protein kinase GPBP [Si 95.06
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 94.81
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.69
PF15404185 PH_4: Pleckstrin homology domain 94.45
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 93.82
KOG1449 670 consensus Predicted Rho GTPase-activating protein 93.49
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 93.4
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.08
KOG1449670 consensus Predicted Rho GTPase-activating protein 92.2
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.97
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 90.65
KOG1737799 consensus Oxysterol-binding protein [Lipid transpo 90.14
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 90.06
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 89.97
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 89.95
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 89.7
PF10186302 Atg14: UV radiation resistance protein and autopha 89.7
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 89.63
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 89.34
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 89.34
PF12240205 Angiomotin_C: Angiomotin C terminal; InterPro: IPR 88.98
KOG3549505 consensus Syntrophins (type gamma) [Extracellular 88.95
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 86.74
cd0008972 HR1 Protein kinase C-related kinase homology regio 86.12
KOG1738638 consensus Membrane-associated guanylate kinase-int 84.28
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 83.47
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 82.09
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 81.11
PF00038312 Filament: Intermediate filament protein; InterPro: 80.92
KOG3551506 consensus Syntrophins (type beta) [Extracellular s 80.6
PF15411116 PH_10: Pleckstrin homology domain 80.48
>KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-45  Score=417.68  Aligned_cols=618  Identities=31%  Similarity=0.345  Sum_probs=499.5

Q ss_pred             CCCCceEEEEecChHHHHHHHHHHHHHHhcCCcc-hhhccCCCcccCCCCccccCc-cccccCCCCCCCcccccchHHHh
Q 004320           97 GRDGRAFTLKAETSEDLYEWKTALELALAQAPSA-ALVMGHNGIFRNDTNDTIEGS-FHQWRDKRPVKSLVVGRPILLAL  174 (761)
Q Consensus        97 ~~~grty~LqAeSeeE~~eWI~AL~~aI~~aP~~-a~~~g~~~if~~~~~~~~e~s-~~~~k~k~~~~~~vFGvpL~~ll  174 (761)
                      ..+++.|...+++..++.+|-.+++.+...||+. +.+++|+|+|+.+..++..+. .-.++...++.+.+||+|..-.+
T Consensus       286 ~~~a~~fsdKmeti~d~le~e~rye~~~~~Aperdalil~higfv~~~t~~tc~s~~~c~d~~~t~llss~~~rps~g~l  365 (1100)
T KOG4271|consen  286 ELDAKPFSDKMETIQDVLEEEARYEAALKQAPERDALILKHIGFVYHPTKETCPSCPACVDAKITPLLSSVLGRPSLGAL  365 (1100)
T ss_pred             hhccccccchhHHHHHHHHhHHHHHHHHHhCcchhhhhhhcCceeeCCCCCCCCCccchhhhccchhhhhhhcCcchhhh
Confidence            3457889999999999999999999999999998 889999999999998876553 55567778889999999998889


Q ss_pred             hhcCCCcHHHHHHHHHHHhcCCCcCC---ccccCC-CHHHHHHHHHHHh-cCCccC--CCCCCcc--chHHhHH--Hhhh
Q 004320          175 EDIDGGPSFLEKALRFLEKFGTKVEG---ILRQAA-DVEEVDRRVQEYE-QGKTEF--SADEDAH--VIGDCVK--HVLR  243 (761)
Q Consensus       175 ~~~~~VP~il~~~i~~L~~~Gl~~EG---IFR~sg-~~~~v~~L~~~ld-~g~~~~--~~~~D~h--~vAslLK--~fLR  243 (761)
                      +..++-|.+..+.+.+|..+|+..||   |-|.++ +...|+.-...|+ .|...+  ....+||  .|...++  .-||
T Consensus       366 e~~d~sp~~~~knL~~l~~~Gl~~E~~n~I~~qsa~D~~~id~kiyE~s~dgkt~~~v~~~~~ph~s~v~e~Ie~~~~lr  445 (1100)
T KOG4271|consen  366 ENSDGSPNIDEKNLVILGKDGLAGEGANEIRRQSADDVYVIDGKIYELSIDGKTRLPVNSFQQPHLSYVGESIEKSHSLR  445 (1100)
T ss_pred             hhhcCCcccchhhhhhhhhcccchhhhHHHHHhcccchhhhhhhhhhcccccccccchhhhcCcchhHHHhhhhhhhhhh
Confidence            98899999999999999999999999   999999 7777877777775 565333  3335898  6888888  8899


Q ss_pred             cCCCCCCChhhHHHHHHH--HhcCCHHHHHHHHHHHHHhh--CChhHHH----HHHHHHHHHHHHHhccccCCCCcc-ch
Q 004320          244 ELPSSPVPASCCTALLEA--YKIDRKEARISAMRSAILET--FPEPNRR----LLQRILRMMHTISSHAHENRMTPS-AV  314 (761)
Q Consensus       244 eLPePLlp~~ly~~ll~~--~~~~~~e~ri~~lk~lIl~~--LP~~N~~----lL~~Ll~fL~~Va~~s~~NkMta~-NL  314 (761)
                      .++..+.|..+|..+..+  +...-.+.|+..++..|++.  .|.+|+.    ++.+|+.++..+..++..|.|++. ..
T Consensus       446 ~~~~~~~~~~~C~~ld~a~gY~~~~Ne~riss~~~aices~~~p~pnnk~~~d~~LRivm~m~~g~~~s~~ni~n~~~~s  525 (1100)
T KOG4271|consen  446 QQGQQIAPKLQCVFLDEASGYGRDINEKRISSVLKAICESRNSPEPNNKDLADLDLRIVMCMMCGDPFSADNILNPVLAS  525 (1100)
T ss_pred             hcccccCCccccccccccccccccccHHHHHHHHHHHHhhcCCCccccchhHHHHHHHHHHHhcCCchhhhhhcChhhHH
Confidence            999999999999988877  66555678999999999888  8998888    888999999999999999999999 99


Q ss_pred             hhhccc-cccC-CCCCCCCccccc-cCCCCCchHH----HHHHHHHhh-HHHHHHHHHHHhcccccCCccccccCCCCCC
Q 004320          315 AACMAP-LLLR-PLLAGECELEDD-FDMNGDNSAQ----LLAAANAAN-NAQAIIATLLEEYENIFDDESLHRCSISADS  386 (761)
Q Consensus       315 AivfaP-~Llr-~~~~~~~~le~~-~~~~g~~~aq----l~~a~~~~~-~~~~iVe~LIen~~~IF~~~~~~~~s~s~~s  386 (761)
                      +.|.+| .|++ |-..+.|.++.+ |+..++..++    ++.|...++ .++.+|-.+++.|..||.+.....+..+..+
T Consensus       526 ~aCkS~~llL~~pI~~~krrie~~~f~v~~de~vh~~~~~~sA~~~An~~aQ~iI~~~l~D~~si~~~~gl~~~~~s~~s  605 (1100)
T KOG4271|consen  526 AACKSPHLLLRLPIGAGKRRIELSSFDVRKDELVHGYIVLYSAKRKANMEAQDIIPVALTDYASIFLDNGLSREQLSEGS  605 (1100)
T ss_pred             HHhcChHHHHhcccccccceecccccccccchhHHHHHHHHHHHhhccchHhhhhhHHhhcchhhhcccchhhhhccccc
Confidence            999999 5777 556788888886 9999999999    777777777 5999999999999999999987776665554


Q ss_pred             CCCCCC--CCCCCCccccccCCCCCCCCCCCCCCCCCCCcccccCCCCCCCCCCCCCCccccccCCCCCCCCCCCCCCCc
Q 004320          387 HVDNSG--SEDSSDEENLDMKNNGYHDAQNEVDPESDDDPERAHSGKLSESSGYAGSDLYDYKALGGDDSDVGSPRNNNA  464 (761)
Q Consensus       387 s~~~s~--~e~ssd~~~~~~~d~~~~s~e~e~~~~~d~~~e~~~s~~~s~~~~~~~~d~~~~~~~~~~~s~~~~~~~~~~  464 (761)
                      .+..+.  +.++.+.+.+...-..-.+-.+.++-..+.|+.........+.+..+.+|++.|.+.+..+++.++++.-..
T Consensus       606 ~iats~pl~q~~~~~es~~~~~~D~~e~~im~e~s~~~dn~~~a~~~tee~~~~Sp~~s~~~~~~~~~d~d~ds~p~~Sp  685 (1100)
T KOG4271|consen  606 EIATSIPLSQPSHKLESFTPFFSDVVEKKIMIEGSHMSDNAAEACSTTEEVFNFSPRDSSPYCNSNLQDSDEDSPPSYSP  685 (1100)
T ss_pred             ccccccccCCCchhccccccccccccchhhccccccCCccccccccCchhhcCCChhhcccccCCCccccCCCCCCCcCC
Confidence            444222  133333222222222222222222222333333334566666777888899999999999999998876555


Q ss_pred             ccccCCCCCCCCCCCCCCchhHHhhhccccCCCCccccccccccCCCCCCcCccccccccCCCCCCCC-CCCCCCccccc
Q 004320          465 SAESSKLPIDPIQIGDPGDQVVEQQGKQKKGNENSITEMEVSSVLPAGESYHSMGEILSSVDPGHPLS-VSGLESSAEKP  543 (761)
Q Consensus       465 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  543 (761)
                      +...+.++..+...|.....                +.+...+.....+.+++...|+....|+.|.+ +++....+.|+
T Consensus       686 ~~e~t~lsst~k~~S~~~~d----------------~g~~~~~i~~~~~n~~~~r~i~~Vs~pi~Pk~vs~dvt~~a~kp  749 (1100)
T KOG4271|consen  686 FREDTSLSSTSKDHSKLSMD----------------LGGNDVGISFTMNNFESKRNINKVSPPIKPKAVSPDVTFDATKP  749 (1100)
T ss_pred             ccCcccccCCcccccccccc----------------ccCCCCCcccccchhHhhhhcccCCCCCCCCcCCCCcccccccC
Confidence            55555665544332222211                11122344555666777788777777877776 45566777777


Q ss_pred             -CCCCCCCCCCCCcccccccCcccCCCCcccCCCCchHHHHHHH-----hhhhhHHHHHHHHHHhhhhhhhhhhHHHhhH
Q 004320          544 -VGKGTSSNFSAKRSAFWGRSNARKTSSVESIDSSGEEELAIQR-----LEITKNDLRHRIAKEARGNAILQASLERRKQ  617 (761)
Q Consensus       544 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~lq~~~~~~k~  617 (761)
                       .+-+..+...++|...|||+.+.|++.+|++|.+++|++.|||     ++.+|.|+|+||+||+|+|+.|||++++|++
T Consensus       750 ~~sls~asi~~~~Rks~~~~~~g~~~l~~es~~~s~eD~~~~~r~e~~ni~~~k~dsq~Ri~k~~k~~~~~QaSder~nk  829 (1100)
T KOG4271|consen  750 DLSLSDASIRDGQRKSVSGRTWGPKDLFDESDYASPEDAVVKPRNEEENIYSVKDDSQQRIIKEIKNNNKLQASDERRNK  829 (1100)
T ss_pred             cccccccccccCccccccCCCCCcccCCchhcccCcchhhhcccccccceeecchhhhhHHHHHhhcchhhhhhhhhccc
Confidence             4444566677889999999999999999999999999999999     9999999999999999999999999999999


Q ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHh--hcCCCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004320          618 ALHERRLALE-QDVSRLQEQLQAERDLRAALEVG--LSMSSGQFSSSRGMDSKTRAELEEIALAEADVARLKQKVAELHH  694 (761)
Q Consensus       618 ~~~~~r~~Le-~~V~~Lq~~L~~e~~~~~~Le~~--l~~~~~~~~~~~~~p~~~~~ll~eia~~E~~v~~Le~~~~~l~~  694 (761)
                      +.+++|.+|| +|+.+||.++|.|+..|.+...+  +....|+. ...-.|.++++-|.+++..|.+ ++|.+++.+...
T Consensus       830 s~~~~rts~E~~ekgr~rs~~qapr~~rka~~k~~~lt~~~~~~-d~~~~~sktskkl~k~k~a~hD-a~lktk~~n~pa  907 (1100)
T KOG4271|consen  830 SDSERRTSLEFLEKGRLRSIVQAPRLYRKACLKGGLLTNSAGGS-DLSAGPSKTSKKLEKNKLAKHD-AKLKTKTKNTPA  907 (1100)
T ss_pred             ccccccccccHhhhhhhhhccccchhHHHHHHhccCcccccccc-ccccCcccchHHHhhhcccccc-ccccccccCCcc
Confidence            9999999999 99999999999999999999987  55554433 3466899999999999999999 999999999999


Q ss_pred             HHH--HHHhhhcCCcccccccccccccccccccccccccC
Q 004320          695 QLN--QQRQHHYGSLSDACDRYQNVQNHNSQQSFSSNIFN  732 (761)
Q Consensus       695 ~l~--~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~  732 (761)
                      +.+  .+++.+.....++.....+++.|..+-+..++|+.
T Consensus       908 ~~stt~~s~~~~~~l~~~~t~~k~ip~~~ekc~sfiedtg  947 (1100)
T KOG4271|consen  908 RRSTTWESNYFLTPLQDAVTSEKPIPIFLEKCKSFIEDTG  947 (1100)
T ss_pred             cccchhhhhccCCcccccccCCcccchHHHHHHHHHHhcc
Confidence            999  99999999999999999999999988999988888

>cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins Back     alignment and domain information
>cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins Back     alignment and domain information
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain Back     alignment and domain information
>cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins Back     alignment and domain information
>cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB Back     alignment and domain information
>cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins Back     alignment and domain information
>cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin Back     alignment and domain information
>cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA Back     alignment and domain information
>cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins Back     alignment and domain information
>cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs Back     alignment and domain information
>cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains Back     alignment and domain information
>cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins Back     alignment and domain information
>cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) Back     alignment and domain information
>cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) Back     alignment and domain information
>cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA Back     alignment and domain information
>cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins Back     alignment and domain information
>cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins Back     alignment and domain information
>cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins Back     alignment and domain information
>cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins Back     alignment and domain information
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins Back     alignment and domain information
>cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins Back     alignment and domain information
>cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins Back     alignment and domain information
>cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins Back     alignment and domain information
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins Back     alignment and domain information
>cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins Back     alignment and domain information
>cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins Back     alignment and domain information
>KOG4407 consensus Predicted Rho GTPase-activating protein [General function prediction only] Back     alignment and domain information
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs Back     alignment and domain information
>cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins Back     alignment and domain information
>cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins Back     alignment and domain information
>cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins Back     alignment and domain information
>cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain Back     alignment and domain information
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1450 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases Back     alignment and domain information
>KOG4270 consensus GTPase-activator protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2200 consensus Tumour suppressor protein p122-RhoGAP/DLC1 [Signal transduction mechanisms] Back     alignment and domain information
>cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins Back     alignment and domain information
>cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases Back     alignment and domain information
>KOG4269 consensus Rac GTPase-activating protein BCR/ABR [Signal transduction mechanisms] Back     alignment and domain information
>PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation Back     alignment and domain information
>KOG4406 consensus CDC42 Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2710 consensus Rho GTPase-activating protein [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14389 Lzipper-MIP1: Leucine-zipper of ternary complex factor MIP1 Back     alignment and domain information
>KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3564 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>KOG4271 consensus Rho-GTPase activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04405 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of BRCC3-like proteins Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd04401 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal MSB1-like proteins Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG4370 consensus Ral-GTPase effector RLIP76 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3565 consensus Cdc42-interacting protein CIP4 [Cytoskeleton] Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4724 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>PF08101 DUF1708: Domain of unknown function (DUF1708); InterPro: IPR012965 This is a fungal domain of unknown function, though the yeast protein MSB1(P21339 from SWISSPROT) which contains this domain is thought to play a role in bud formation [] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>KOG1453 consensus Chimaerin and related Rho GTPase activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1449 consensus Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00089 HR1 Protein kinase C-related kinase homology region 1 domain; also known as the ACC (antiparallel coiled-coil) finger domain or Rho-binding domain Back     alignment and domain information
>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
3fk2_A246 Crystal Structure Of The Rhogap Domain Of Human Glu 7e-14
3byi_A214 Crystal Structure Of Human Rho Gtpase Activating Pr 2e-11
3msx_B201 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 2e-11
3kuq_A228 Crystal Structure Of The Dlc1 Rhogap Domain Length 2e-11
2ee5_A219 Solution Structure Of The N-Teruminus Extended Rhog 4e-10
2ee4_A209 Solution Structure Of The Rhogap Domain From Human 6e-10
1am4_A199 Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S 5e-09
1grn_B203 Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX 6e-09
1ow3_A242 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 7e-09
1tx4_A198 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 1e-08
1f7c_A231 Crystal Structure Of The Bh Domain From Graf, The G 3e-08
2ngr_B234 Transition State Complex For Gtp Hydrolysis By Cdc4 5e-08
3iug_A229 Crystal Structure Of The Rhogap Domain Of Rics Leng 2e-05
3eap_A271 Crystal Structure Of The Rhogap Domain Of Arhgap11a 2e-04
>pdb|3FK2|A Chain A, Crystal Structure Of The Rhogap Domain Of Human Glucocorticoid Receptor Dna-Binding Factor 1 Length = 246 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 84/161 (52%), Gaps = 3/161 (1%)
Query: 167 GRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKTEFS 226
           G P+   +      P F+E+ + ++E  G   EGI R + +  E++   ++++Q      
Sbjct: 55  GVPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDL 114
Query: 227 ADEDAHV--IGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPE 284
           A++D  V  +   +K    ELP   VP +    L+EA+KI+ +E ++ A++  +L+ FP+
Sbjct: 115 AEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKE-VLKKFPK 173
Query: 285 PNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRP 325
            N  + + ++  ++ +S +   N MT   ++ C  P L+RP
Sbjct: 174 ENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRP 214
>pdb|3BYI|A Chain A, Crystal Structure Of Human Rho Gtpase Activating Protein 15 (arhgap15) Length = 214 Back     alignment and structure
>pdb|3MSX|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 201 Back     alignment and structure
>pdb|3KUQ|A Chain A, Crystal Structure Of The Dlc1 Rhogap Domain Length = 228 Back     alignment and structure
>pdb|2EE5|A Chain A, Solution Structure Of The N-Teruminus Extended Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 219 Back     alignment and structure
>pdb|2EE4|A Chain A, Solution Structure Of The Rhogap Domain From Human Rho Gtpase Activating Protein 5 Variant Length = 209 Back     alignment and structure
>pdb|1AM4|A Chain A, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 199 Back     alignment and structure
>pdb|1GRN|B Chain B, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX Length = 203 Back     alignment and structure
>pdb|1OW3|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 242 Back     alignment and structure
>pdb|1TX4|A Chain A, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 198 Back     alignment and structure
>pdb|1F7C|A Chain A, Crystal Structure Of The Bh Domain From Graf, The Gtpase Regulator Associated With Focal Adhesion Kinase Length = 231 Back     alignment and structure
>pdb|2NGR|B Chain B, Transition State Complex For Gtp Hydrolysis By Cdc42: Comparisons Of The High Resolution Structures For Cdc42 Bound To The Active And Catalytically Compromised Forms Of The Cdc42-gap Length = 234 Back     alignment and structure
>pdb|3IUG|A Chain A, Crystal Structure Of The Rhogap Domain Of Rics Length = 229 Back     alignment and structure
>pdb|3EAP|A Chain A, Crystal Structure Of The Rhogap Domain Of Arhgap11a Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
3msx_B201 RHO GTPase-activating protein 20; protein-proten c 1e-33
1tx4_A198 P50-rhogap; complex (GTPase activation/proto-oncog 3e-33
1ow3_A242 RHO-GTPase-activating protein 1; complex, GTPase, 3e-33
3kuq_A228 RHO GTPase-activating protein 7; structural genomi 6e-31
3byi_A214 RHO GTPase activating protein 15; BM046, arhgap15, 7e-31
3fk2_A246 Glucocorticoid receptor DNA-binding factor 1; stru 1e-30
2ee4_A209 RHO GTPase activating protein 5 variant; all alpha 2e-30
1f7c_A231 Rhogap protein; GTPase activating protein, RHO GTP 6e-29
3eap_A271 RHO GTPase-activating protein 11A; GAP, structural 9e-29
3iug_A229 RHO/CDC42/RAC GTPase-activating protein RICS; stru 2e-27
2osa_A202 N-chimaerin; RHO-GAP, GTPase activation, structura 3e-26
1pbw_A216 Rhogap domain, phosphatidylinositol 3-kinase; phos 2e-25
2ovj_A201 Mgcracgap, RAC GTPase-activating protein 1; signal 2e-25
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 1e-24
3qis_A366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 3e-23
2xs6_A214 Phosphatidylinositol 3-kinase regulatory subunit; 1e-20
3aj4_A112 Pleckstrin homology domain-containing family B ME; 7e-20
2d9v_A130 Pleckstrin homology domain-containing protein fami 4e-19
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 4e-17
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 4e-15
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 5e-15
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 1e-14
1v5p_A126 Pleckstrin homology domain-containing, family A; T 1e-14
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-14
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 2e-14
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 2e-14
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-14
3cxb_B112 Pleckstrin homology domain-containing family M mem 4e-14
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 6e-14
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 2e-13
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 2e-13
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 2e-13
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 3e-13
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 4e-13
2dkp_A128 Pleckstrin homology domain-containing family A mem 4e-13
2d9y_A117 Pleckstrin homology domain-containing protein fami 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 1e-12
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 1e-12
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 1e-12
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 2e-12
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 3e-12
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-12
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 4e-12
2yry_A122 Pleckstrin homology domain-containing family A mem 5e-12
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 6e-12
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 9e-12
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 1e-11
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-11
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 1e-11
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 1e-11
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 1e-11
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 3e-11
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 9e-11
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 1e-10
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 1e-10
1v88_A130 Oxysterol binding protein-related protein 8; vesic 1e-10
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 6e-10
1wi1_A126 Calcium-dependent activator protein for secretion, 1e-09
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-09
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 3e-09
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 5e-09
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 1e-08
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 2e-08
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 4e-08
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 6e-08
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 6e-08
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 7e-08
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-07
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 1e-07
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 3e-07
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 5e-06
2d9w_A127 Docking protein 2; PH domain, structural genomics, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 2e-05
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 2e-05
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-04
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-04
>3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Length = 201 Back     alignment and structure
 Score =  126 bits (320), Expect = 1e-33
 Identities = 49/213 (23%), Positives = 83/213 (38%), Gaps = 18/213 (8%)

Query: 160 PVKSLVVGRPILLALEDIDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYE 219
           P+   + G  +    E+ D  P  +   L FL + G   +GI RQ+A+V+      ++  
Sbjct: 7   PMPGQLFGISLPNICEN-DNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLN 65

Query: 220 QGKTEFSADEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAIL 279
            G       E   VI   +K  LR +P S   +      +        E +I+ ++  +L
Sbjct: 66  SGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQR-LL 124

Query: 280 ETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDM 339
           +  P  N  LL+ +  ++H I  H+  N+MT   +A C+AP +L P              
Sbjct: 125 DQLPRANVVLLRYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWP-------------- 170

Query: 340 NGDNSAQLLAAANAANNAQAIIATLLEEYENIF 372
               S+              +I  L+E    IF
Sbjct: 171 --PASSSPELENEFTKKVSLLIQFLIENCLRIF 201
>1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Length = 198 Back     alignment and structure
>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Length = 242 Back     alignment and structure
>3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Length = 228 Back     alignment and structure
>3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Length = 214 Back     alignment and structure
>3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Length = 246 Back     alignment and structure
>2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Length = 209 Back     alignment and structure
>1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Length = 231 Back     alignment and structure
>3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Length = 271 Back     alignment and structure
>3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Length = 229 Back     alignment and structure
>2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Length = 202 Back     alignment and structure
>1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Length = 216 Back     alignment and structure
>2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Length = 201 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Length = 366 Back     alignment and structure
>2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Length = 214 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
3byi_A214 RHO GTPase activating protein 15; BM046, arhgap15, 100.0
3msx_B201 RHO GTPase-activating protein 20; protein-proten c 100.0
2ee4_A209 RHO GTPase activating protein 5 variant; all alpha 100.0
3iug_A229 RHO/CDC42/RAC GTPase-activating protein RICS; stru 100.0
2osa_A202 N-chimaerin; RHO-GAP, GTPase activation, structura 100.0
1tx4_A198 P50-rhogap; complex (GTPase activation/proto-oncog 100.0
3fk2_A246 Glucocorticoid receptor DNA-binding factor 1; stru 100.0
1f7c_A231 Rhogap protein; GTPase activating protein, RHO GTP 100.0
1ow3_A242 RHO-GTPase-activating protein 1; complex, GTPase, 100.0
1pbw_A216 Rhogap domain, phosphatidylinositol 3-kinase; phos 100.0
3kuq_A228 RHO GTPase-activating protein 7; structural genomi 100.0
2ovj_A201 Mgcracgap, RAC GTPase-activating protein 1; signal 100.0
3eap_A271 RHO GTPase-activating protein 11A; GAP, structural 100.0
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 100.0
2xs6_A214 Phosphatidylinositol 3-kinase regulatory subunit; 100.0
3qis_A366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 99.97
1wi1_A126 Calcium-dependent activator protein for secretion, 99.72
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.7
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.69
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.65
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.65
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.65
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.65
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.65
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.64
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.64
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.63
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.63
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.63
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.63
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.63
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.63
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.62
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.62
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.62
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.61
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.61
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.61
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.61
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.61
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.6
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.6
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.6
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.6
2yry_A122 Pleckstrin homology domain-containing family A mem 99.6
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.59
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.58
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.58
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.58
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.58
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.57
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.57
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.57
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.57
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.57
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.57
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.56
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.56
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.55
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.55
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.55
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.54
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.53
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.52
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.51
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.49
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.47
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.47
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.43
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.42
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.42
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.37
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.37
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.29
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.27
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.24
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.18
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.16
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.15
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.07
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.06
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 98.99
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.98
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 98.91
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 98.9
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.6
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.52
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.57
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.56
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.32
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.2
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.07
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 96.8
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 96.78
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.72
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.39
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 96.38
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 96.28
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 96.2
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 96.14
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 96.12
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 96.0
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 95.94
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 95.79
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 95.71
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 95.66
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.65
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 95.57
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 95.46
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 94.55
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.53
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 94.31
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.08
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 93.84
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 93.15
3ksy_A1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 92.57
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 92.4
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 92.36
1foe_A377 T-lymphoma invasion and metastasis inducing protei 91.59
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 91.38
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 90.36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.82
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 82.93
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 82.75
>3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=6.7e-41  Score=342.36  Aligned_cols=203  Identities=26%  Similarity=0.399  Sum_probs=177.2

Q ss_pred             cccCCCCCCCcccccchHHHhhh-cCCCcHHHHHHHHHHHhcCCCcCCccccCCCHHHHHHHHHHHhcCC-ccCCC--CC
Q 004320          154 QWRDKRPVKSLVVGRPILLALED-IDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGK-TEFSA--DE  229 (761)
Q Consensus       154 ~~k~k~~~~~~vFGvpL~~ll~~-~~~VP~il~~~i~~L~~~Gl~~EGIFR~sg~~~~v~~L~~~ld~g~-~~~~~--~~  229 (761)
                      .++.++..+..+||+||..++.+ +..||.+|.+|+.||+++|+.+|||||++|+...|++|++.||+|. .++..  ..
T Consensus         8 ~l~~~~~~~~~vFG~~L~~~~~~~~~~vP~~v~~~i~~l~~~gl~~eGIfR~~G~~~~i~~L~~~~~~~~~~~~~~~~~~   87 (214)
T 3byi_A            8 TLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWE   87 (214)
T ss_dssp             HHHHHTSCCCCSTTSCHHHHHHHHTCSSCHHHHHHHHHHHHHTTTSTTTTTSCCCHHHHHHHHHHHHTTCCCCTTSGGGC
T ss_pred             hHHhcCCCcCCccCCcHHHHHHHcCCCCChHHHHHHHHHHHhCCCCCCccccCCCHHHHHHHHHHHhcCCCCCCCccccc
Confidence            34556677788999999999975 5689999999999999999999999999999999999999999985 33322  25


Q ss_pred             CccchHHhHHHhhhcCCCCCCChhhHHHHHHHHhcCCHHHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHhccccCCC
Q 004320          230 DAHVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRM  309 (761)
Q Consensus       230 D~h~vAslLK~fLReLPePLlp~~ly~~ll~~~~~~~~e~ri~~lk~lIl~~LP~~N~~lL~~Ll~fL~~Va~~s~~NkM  309 (761)
                      |+|+||++||.|||+||+||||.++|+.|+.+....+.++++..++.+| .+||++|+.+|+||+.||++|+.|++.|||
T Consensus        88 dvh~va~lLK~flreLPePLl~~~l~~~~~~~~~~~~~~~~~~~l~~ll-~~LP~~n~~~L~~L~~~L~~v~~~s~~NkM  166 (214)
T 3byi_A           88 DIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLV-QKLPPPNRDTMKVLFGHLTKIVAKASKNLM  166 (214)
T ss_dssp             SHHHHHHHHHHHHHHSSSCSSCHHHHHHHHHHHTSSSHHHHHHHHHHHH-HHSCHHHHHHHHHHHHHHHHHHHTHHHHCC
T ss_pred             chHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHhcCCHHHHHHHHHHHH-HhCCHHHHHHHHHHHHHHHHHHHcccCCCC
Confidence            9999999999999999999999999999999999989999999999966 599999999999999999999999999999


Q ss_pred             CccchhhhccccccCCCCCCCCccccccCCCCCchHHHHHHHHHhhHHHHHHHHHHHhcccccCCc
Q 004320          310 TPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIFDDE  375 (761)
Q Consensus       310 ta~NLAivfaP~Llr~~~~~~~~le~~~~~~g~~~aql~~a~~~~~~~~~iVe~LIen~~~IF~~~  375 (761)
                      |+.|||+||||+|+|++....            +.      +.....++.+|++||+||+.||+++
T Consensus       167 ~~~NLa~vf~P~Ll~~~~~~~------------~~------~~~~~~~~~vve~LI~~~~~iF~~d  214 (214)
T 3byi_A          167 STQSLGIVFGPTLLRAENETG------------NM------AIHMVYQNQIAELMLSEYSKIFGSE  214 (214)
T ss_dssp             CHHHHHHHHHHHHHCCTTSSS------------CH------HHHHHHHHHHHHHHHHTHHHHHC--
T ss_pred             CHHHhHHHhccccCCCCCccH------------HH------HHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            999999999999999873210            00      1123457889999999999999874
>3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Back     alignment and structure
>2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Back     alignment and structure
>3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Back     alignment and structure
>2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Back     alignment and structure
>1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Back     alignment and structure
>3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Back     alignment and structure
>1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Back     alignment and structure
>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Back     alignment and structure
>1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Back     alignment and structure
>3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
>2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Back     alignment and structure
>3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 761
d1f7ca_191 a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxI 3e-30
d1tx4a_196 a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapi 2e-29
d1xa6a1196 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal d 5e-29
d1pbwa_184 a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Hu 2e-26
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 5e-15
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 8e-14
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 1e-13
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 7e-13
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 1e-12
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 2e-12
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 2e-12
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 2e-12
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 2e-12
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 3e-12
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 4e-12
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 5e-12
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-11
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 3e-11
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 4e-11
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 2e-10
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-10
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 3e-10
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 5e-10
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 6e-10
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 1e-09
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 1e-09
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 3e-09
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 3e-09
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 4e-09
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 5e-09
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 5e-08
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 1e-07
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 3e-07
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-06
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 2e-06
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 4e-06
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 5e-06
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 3e-04
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 0.001
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 0.002
>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Length = 191 Back     information, alignment and structure

class: All alpha proteins
fold: GTPase activation domain, GAP
superfamily: GTPase activation domain, GAP
family: BCR-homology GTPase activation domain (BH-domain)
domain: Graf
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score =  116 bits (290), Expect = 3e-30
 Identities = 45/203 (22%), Positives = 85/203 (41%), Gaps = 25/203 (12%)

Query: 178 DGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKT------EFSADEDA 231
             G S ++K +  +E  G   +G+ R       V + +      KT      E  A+ + 
Sbjct: 5   SIGFSIIKKCIHAVETRGINEQGLYRIVGVNSRVQKLLSILMDPKTATETETEICAEWEI 64

Query: 232 HVIGDCVKHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQ 291
             I   +K  LR LP   +      + ++A K++ +E+R+S + S ++   PE NR++L 
Sbjct: 65  KTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHS-LVHRLPEKNRQMLH 123

Query: 292 RILRMMHTISSHAHENRMTPSAVAACMAPLLLRPLLAGECELEDDFDMNGDNSAQLLAAA 351
            ++  +  ++ +  +N MT + +     P LLRP                    + +AA 
Sbjct: 124 LLMNHLAKVADNHKQNLMTVANLGVVFGPTLLRP------------------QEETVAAI 165

Query: 352 NAANNAQAIIATLLEEYENIFDD 374
                   +I  L+E +E IF+ 
Sbjct: 166 MDIKFQNIVIEILIENHEKIFNT 188
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
d1xa6a1196 Beta-chimaerin, C-terminal domain {Human (Homo sap 100.0
d1tx4a_196 p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 100.0
d1f7ca_191 Graf {Chicken (Gallus gallus) [TaxId: 9031]} 100.0
d1pbwa_184 p85 alpha subunit RhoGAP domain {Human (Homo sapie 100.0
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.66
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.65
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.62
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.62
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.61
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.61
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.6
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.59
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.58
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.58
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.58
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.57
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.57
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.57
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.57
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.55
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.54
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.53
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.53
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.52
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.5
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.49
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.47
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.44
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.44
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.42
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.42
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.67
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.32
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.82
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 97.8
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.76
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 97.67
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.48
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.35
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.22
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.52
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 94.36
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 93.37
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: GTPase activation domain, GAP
superfamily: GTPase activation domain, GAP
family: BCR-homology GTPase activation domain (BH-domain)
domain: Beta-chimaerin, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.3e-39  Score=321.45  Aligned_cols=191  Identities=17%  Similarity=0.307  Sum_probs=168.7

Q ss_pred             cccccchHHHhhh-cCCCcHHHHHHHHHHHhcCCCcCCccccCCCHHHHHHHHHHHhcCCc----cCCCCCCccchHHhH
Q 004320          164 LVVGRPILLALED-IDGGPSFLEKALRFLEKFGTKVEGILRQAADVEEVDRRVQEYEQGKT----EFSADEDAHVIGDCV  238 (761)
Q Consensus       164 ~vFGvpL~~ll~~-~~~VP~il~~~i~~L~~~Gl~~EGIFR~sg~~~~v~~L~~~ld~g~~----~~~~~~D~h~vAslL  238 (761)
                      +|||+||+.++++ +..||.+|.+|++||+++|+++|||||++|+..+++++++.||++..    ......|+|+||++|
T Consensus         1 kiFg~~L~~~~~~~~~~iP~iv~~~i~~l~~~gl~~eGiFR~~g~~~~v~~l~~~~~~~~~~~~~~~~~~~d~~~va~~l   80 (196)
T d1xa6a1           1 KVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGAL   80 (196)
T ss_dssp             CCTTSCHHHHHHHHTCSSCHHHHHHHHHHHHSCSSSTTTTTSCCCHHHHHHHHHHHSSTTTTSCCCSSSSCCTHHHHHHH
T ss_pred             CccCCCHHHHHHhcCCCCChHHHHHHHHHHHhCCCCCCeeeeCCCHHHHHHHHHHHhcCCCccccccccccchhHHHHHH
Confidence            4899999999976 45799999999999999999999999999999999999999998632    223346999999999


Q ss_pred             HHhhhcCCCCCCChhhHHHHHHHHhcCCHHHHHHHHHHHHHhhCChhHHHHHHHHHHHHHHHHhccccCCCCccchhhhc
Q 004320          239 KHVLRELPSSPVPASCCTALLEAYKIDRKEARISAMRSAILETFPEPNRRLLQRILRMMHTISSHAHENRMTPSAVAACM  318 (761)
Q Consensus       239 K~fLReLPePLlp~~ly~~ll~~~~~~~~e~ri~~lk~lIl~~LP~~N~~lL~~Ll~fL~~Va~~s~~NkMta~NLAivf  318 (761)
                      |.|||+||+||+|.++|+.|+.+....+.+.++..++.++ .+||+.|+.+|.+|+.||++|+.|++.|+||+.|||+||
T Consensus        81 K~fLr~Lp~pli~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~~LP~~n~~~L~~L~~~l~~i~~~s~~NkM~~~nLA~~f  159 (196)
T d1xa6a1          81 KLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVL-MLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVF  159 (196)
T ss_dssp             HHHHHHCSSCTTCSTTHHHHHTTTTCCCHHHHHHHHHHHH-TTSCHHHHHHHHHTTTTTHHHHTTTTTSCCCHHHHHHHH
T ss_pred             HHHHHhCCCccCCHHHHHHHHHHHhccchhHHHHHHHHHH-HHCCHHHHHHHHHHHHHHHHHHHhhhhhccchhhhhHHh
Confidence            9999999999999999999999999999999999999866 699999999999999999999999999999999999999


Q ss_pred             cccccCCCCCCCCccccccCCCCCchHHHHHHHHHhhHHHHHHHHHHHhccccc
Q 004320          319 APLLLRPLLAGECELEDDFDMNGDNSAQLLAAANAANNAQAIIATLLEEYENIF  372 (761)
Q Consensus       319 aP~Llr~~~~~~~~le~~~~~~g~~~aql~~a~~~~~~~~~iVe~LIen~~~IF  372 (761)
                      ||+|||++..+....                 .........+|++||+||+.||
T Consensus       160 ~P~l~~~~~~~~~~~-----------------~~~~~~~~~iv~~LI~~~~~iF  196 (196)
T d1xa6a1         160 GPTLMRPPEDSTLTT-----------------LHDMRYQKLIVQILIENEDVLF  196 (196)
T ss_dssp             TTTSCCCCCSCTTGG-----------------GGTHHHHHHHHHHHHHTHHHHC
T ss_pred             ccccccCCCccHHHH-----------------HHHHHHHHHHHHHHHHhhHhhC
Confidence            999999874322111                 1123456789999999999998
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure