Citrus Sinensis ID: 004324


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-
MLTISTQTLPSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLNEGSEYRKLDTQNINFDCGSDSDEKASDYSDDD
cccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccccEEHHHHHcHHHHHccccHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHcHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
ccEEEcccccccEEccccccccccccccEccccccccccccccccEEHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEHHEEccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEHEEEEEccHcccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccEEEEEEcccHHHHHHHHHHHHcccccEEccccEEEEEEEccccHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
mltistqtlpsITLSLQrhvsffphvttvrtprsyhflsaplssatsqSTFVEQLagekdssqeekwdmfknsdaesgsvdfdvgtagsemrhlgepvvevieleeLPEQWRRAKLAWLCkelpshkggTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDiinqgrvpsemTFHILIVAYLSAPVQGCLDEACSIYNRMIqlggyqprpslhNSLFRALvskpgglskYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLesdngiptpaFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETgmkplmpsYINLTNMYLNLGMHDRLHLAFSECLekcrpnrtIYGIYLESLKNAGNIEKAEEIFNHmhsdqtigvNTRSCNIILSAYLssgdfvkaeKIYDLMCLKKYEIESAWMEKLDYVLSLNrkevkkpvslnlSSEQRENLIGLLLgglciesdeKRKRHMIRFQFNENSRMHSVLRRYLYDQYhewlhpsfkfwpkgrlvipklihrwlTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLNegseyrkldtqninfdcgsdsdekasdysddd
mltistqtlpSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAgekdssqeeKWDMFKnsdaesgsVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKElpshkggtLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRllesdngiptpAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKpvslnlsseqreNLIGLLLGGLCIESDEKRKRHMIRfqfnensrmhSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFktlkarsldcrvKKKGRVFWigflgsnstlFWKLIEPYVLDELKEDLLNEGseyrkldtqninfdcgsdsdekasdysddd
MLTISTQTLPSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDFDVGTAGSEMRHLGepvvevieleelpeQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENliglllgglCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLNEGSEYRKLDTQNINFDCGSDSDEKASDYSDDD
**********SITLSLQRHVSFFPHVTTVRTPRSYHFL******************************************************HLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVK**V********RENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLNEG**YR**************************
**T******************FFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELK*************************************
MLTISTQTLPSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTF****************DMFKNSDAESGSVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLNEGSEYRKLDTQNINFDCGSD************
MLTISTQTLPSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELKEDLLN********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTISTQTLPSITLSLQRHVSFFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVDFDVGTAGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVxxxxxxxxxxxxxxxxxxxxxNINFDCGSDSDEKASDYSDDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query761 2.2.26 [Sep-21-2011]
Q9XIL5849 Pentatricopeptide repeat- yes no 0.940 0.843 0.582 0.0
Q5G1S8 1440 Pentatricopeptide repeat- no no 0.455 0.240 0.227 2e-14
O04491607 Putative pentatricopeptid no no 0.344 0.431 0.254 2e-13
Q0WPZ6 874 Pentatricopeptide repeat- no no 0.424 0.369 0.225 3e-13
Q76C99791 Protein Rf1, mitochondria N/A no 0.516 0.496 0.228 1e-11
P0C043463 Putative pentatricopeptid no no 0.521 0.857 0.221 3e-11
Q0WMY5952 Pentatricopeptide repeat- no no 0.446 0.357 0.220 3e-11
Q9SAD9517 Pentatricopeptide repeat- no no 0.434 0.640 0.245 2e-10
O49436660 Pentatricopeptide repeat- no no 0.415 0.478 0.225 2e-10
Q8GYP6860 Pentatricopeptide repeat- no no 0.353 0.312 0.216 2e-10
>sp|Q9XIL5|PP154_ARATH Pentatricopeptide repeat-containing protein At2g15820 OS=Arabidopsis thaliana GN=At2g15820 PE=2 SV=3 Back     alignment and function desciption
 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/773 (58%), Positives = 580/773 (75%), Gaps = 57/773 (7%)

Query: 22  FFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVD 81
           FF H +T RTP     L    S+A    TFVE L G  +S +           +E+    
Sbjct: 91  FFSHSST-RTPP----LFTANSTAQRSGTFVEHLTGITESEE---------GISEANGFG 136

Query: 82  FDVGTAGSEMRHLG----EPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNA 137
            DV +A +++R++     E   EV ELEELPE+WRR+KLAWLCKE+P+HK  TLVR+LNA
Sbjct: 137 -DVESARNDIRNVATRRIETEFEVRELEELPEEWRRSKLAWLCKEVPTHKAVTLVRLLNA 195

Query: 138 QKKWLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFA 197
           QKKW+RQED TY++VHCMRIRENETGFRVY WM QQ+WYRFDF L TKLA+Y+GKERKF 
Sbjct: 196 QKKWVRQEDATYISVHCMRIRENETGFRVYRWMTQQNWYRFDFGLTTKLAEYLGKERKFT 255

Query: 198 KCRDIFDDIINQGRVPSEMTFHILIVAYLSA-PVQGCLDEACSIYNRMIQLGGYQPRPSL 256
           KCR++FDD++NQGRVPSE TFHIL+VAYLS+  V+GCL+EACS+YNRMIQLGGY+PR SL
Sbjct: 256 KCREVFDDVLNQGRVPSESTFHILVVAYLSSLSVEGCLEEACSVYNRMIQLGGYKPRLSL 315

Query: 257 HNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERI 316
           HNSLFRALVSK GG+    L+QAEFIFHN++T+GLE+QKDIYSGLIWLHS QD +D  RI
Sbjct: 316 HNSLFRALVSKQGGILNDQLKQAEFIFHNVVTTGLEVQKDIYSGLIWLHSCQDEVDIGRI 375

Query: 317 SLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEA 376
           + L++EM++AGF+E KEV++S+LR  AKEG VE+ E+TWL LL+ D GIP+ AFVYK+EA
Sbjct: 376 NSLREEMKKAGFQESKEVVVSLLRAYAKEGGVEEVERTWLELLDLDCGIPSQAFVYKIEA 435

Query: 377 YAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPL 436
           Y+K+G+F K++EIFREM++ +G A++  YHKIIE+LCK ++ EL E+LMKEF E+G KPL
Sbjct: 436 YSKVGDFAKAMEIFREMEKHIGGATMSGYHKIIEVLCKVQQVELVETLMKEFEESGKKPL 495

Query: 437 MPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNH 496
           +PS+I +  MY +LG+H++L +AF +CLEKC+P++ IY IYL+SL   GN+EKA ++FN 
Sbjct: 496 LPSFIEIAKMYFDLGLHEKLEMAFVQCLEKCQPSQPIYNIYLDSLTKIGNLEKAGDVFNE 555

Query: 497 MHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNR 556
           M ++ TI V+ RSCN +L  YL  G  V+AE+IYDLM +KKYEIE   MEKLDY+LSL +
Sbjct: 556 MKNNGTINVSARSCNSLLKGYLDCGKQVQAERIYDLMRMKKYEIEPPLMEKLDYILSLKK 615

Query: 557 KEVKK-PVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLY 615
           KEVKK P S+ LS +QRE L+GLLLGGL IESD+++K HMI+F+F ENS+ H VL++ ++
Sbjct: 616 KEVKKRPFSMKLSKDQREVLVGLLLGGLQIESDKEKKSHMIKFEFRENSQAHLVLKQNIH 675

Query: 616 DQYHEWLHP---------SFKF---------------WPKGRLVIPKLIHRWLTPRALAY 651
           DQ+ EWLHP          F+F               WPKG+  IPKLIHRWL+P +LAY
Sbjct: 676 DQFREWLHPLSNFQEDIIPFEFYSVPHSYFGFYAEHYWPKGQPEIPKLIHRWLSPHSLAY 735

Query: 652 WFMYGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLF 711
           W+MY G +TS GDI+L+LK S EG+  V K L+A+S++CRVKKKG+VFWIG  G+NS LF
Sbjct: 736 WYMYSGVKTSSGDIILRLKGSLEGVEKVVKALQAKSMECRVKKKGKVFWIGLQGTNSALF 795

Query: 712 WKLIEPYVLDELKEDLLNEGSE----YRKLDTQNINFDCGSDSDEKASDYSDD 760
           WKLIEP+VL+ LKE  L   SE     ++ + Q+INF          SD+SDD
Sbjct: 796 WKLIEPHVLENLKEH-LKPASESLDNVKEAEEQSINFKSN-------SDHSDD 840





Arabidopsis thaliana (taxid: 3702)
>sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 Back     alignment and function description
>sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 Back     alignment and function description
>sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|P0C043|PP318_ARATH Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 Back     alignment and function description
>sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 Back     alignment and function description
>sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 Back     alignment and function description
>sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
255561657835 pentatricopeptide repeat-containing prot 0.960 0.875 0.659 0.0
225428729823 PREDICTED: pentatricopeptide repeat-cont 0.971 0.897 0.664 0.0
297741318790 unnamed protein product [Vitis vinifera] 0.971 0.935 0.664 0.0
356519449763 PREDICTED: pentatricopeptide repeat-cont 0.871 0.868 0.640 0.0
356577031737 PREDICTED: pentatricopeptide repeat-cont 0.854 0.881 0.650 0.0
449468730797 PREDICTED: pentatricopeptide repeat-cont 0.948 0.905 0.596 0.0
449528187747 PREDICTED: pentatricopeptide repeat-cont 0.917 0.934 0.615 0.0
297836204841 hypothetical protein ARALYDRAFT_343169 [ 0.939 0.850 0.587 0.0
240254458849 pentatricopeptide repeat-containing prot 0.940 0.843 0.582 0.0
357436027775 Pentatricopeptide repeat-containing prot 0.881 0.865 0.581 0.0
>gi|255561657|ref|XP_002521838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538876|gb|EEF40474.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1043 bits (2698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/766 (65%), Positives = 615/766 (80%), Gaps = 35/766 (4%)

Query: 24  PHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEK--DSSQEEKWDMFKNSDAESGSVD 81
           P + T+    + H  ++   + +S +T  EQLA E    S  EEKWD+   +D E     
Sbjct: 73  PFLRTLHISPNKHKKTSSFCTLSSFNTSAEQLACESLSPSKNEEKWDISSYNDNEHEIFK 132

Query: 82  FDVGT-AGSEMRHLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKK 140
           FD  + AG +++HL  P +EV EL+ELPEQWRRA+LAWLCK+LP+HK GTLV+ILNAQKK
Sbjct: 133 FDGDSGAGVDLKHLDTPALEVKELQELPEQWRRARLAWLCKQLPAHKAGTLVKILNAQKK 192

Query: 141 WLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCR 200
           W+RQED TY+AVHCMRIRENE GFRVY+WMMQQHWYRFDF LATKLADYMGKERKFAKCR
Sbjct: 193 WMRQEDATYIAVHCMRIRENEAGFRVYKWMMQQHWYRFDFGLATKLADYMGKERKFAKCR 252

Query: 201 DIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPSLHNSL 260
           +IFDDIINQGRVPSE TFHILI+AYLSAPVQGCL+EAC+IYNRMIQLGGYQPR SLHNSL
Sbjct: 253 EIFDDIINQGRVPSESTFHILIIAYLSAPVQGCLEEACTIYNRMIQLGGYQPRLSLHNSL 312

Query: 261 FRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLLK 320
           FRALVSKPGG +K+YL+QAEFI+HNL+TSGLEIQ DIY GLIWLHSYQDNIDK RI+ ++
Sbjct: 313 FRALVSKPGGFAKHYLKQAEFIYHNLVTSGLEIQNDIYGGLIWLHSYQDNIDKVRIASIR 372

Query: 321 KEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKI 380
           +EM+QAG  EG+E+LLS++R C+KEGDVE+AE+TWL+LL+ D G+PT AFVY+ME +AK+
Sbjct: 373 EEMKQAGIMEGREILLSIMRACSKEGDVEEAERTWLKLLQVDGGLPTQAFVYRMEVFAKL 432

Query: 381 GEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSY 440
           GE MKSLE FREMQE LGS+S+ AYHKIIE++ +A+E EL ESLM+EF+++G+KPLMPS+
Sbjct: 433 GEHMKSLETFREMQELLGSSSIAAYHKIIEVVSQAQEVELAESLMQEFIKSGLKPLMPSF 492

Query: 441 INLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSD 500
            +L NMYLNL +H++L   F  CLE CRPNR IY +YL+SL   GN++KAEE FN+M S+
Sbjct: 493 TDLMNMYLNLNLHEKLESTFFACLENCRPNRNIYNVYLDSLVKVGNLDKAEEAFNNMCSN 552

Query: 501 QTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEVK 560
           + +GVN RSCN IL  YLSSGD+VKAEKIYDLMC KKY+IE + MEKLDYVLSL+RK VK
Sbjct: 553 EAVGVNIRSCNTILRGYLSSGDYVKAEKIYDLMCQKKYDIEPSLMEKLDYVLSLSRKVVK 612

Query: 561 KPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQYHE 620
           KP+SL LS +QRE L+GLLLGGL +ESD+ RK+HMIRF+FNENS  H++LRR+LYD+YHE
Sbjct: 613 KPLSLKLSKDQREILVGLLLGGLRVESDDNRKKHMIRFEFNENSSTHAILRRHLYDKYHE 672

Query: 621 WLHPSFK--------------------------FWPKGRLVIPKLIHRWLTPRALAYWFM 654
           WLHPS K                          FWPKG+ +IPKLIHRWL+P+ LA+W+M
Sbjct: 673 WLHPSCKLSDGSDGASYRFSTISHSYFSFYAEQFWPKGQPMIPKLIHRWLSPQVLAFWYM 732

Query: 655 YGGHRTSVGDILLKLKVSSEGIALVFKTLKARSLDCRVKKKGRVFWIGFLGSNSTLFWKL 714
           Y GHRTS GDILLKLK S EG+  VFKTLK++SL+C+VK+KGRVFWIGFLG++S  FWKL
Sbjct: 733 YAGHRTSSGDILLKLKGSREGVEKVFKTLKSKSLNCKVKRKGRVFWIGFLGNDSVWFWKL 792

Query: 715 IEPYVLDELKEDLLNEGSEYRKLDTQNINFDCGSDSDEKASDYSDD 760
           +EPY+LD+LK   L  G +  +   +NINFD GSD     S+YSDD
Sbjct: 793 VEPYILDDLKL-FLKAGDQTLEYSAENINFDSGSD-----SEYSDD 832




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225428729|ref|XP_002281969.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741318|emb|CBI32449.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519449|ref|XP_003528385.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Glycine max] Back     alignment and taxonomy information
>gi|356577031|ref|XP_003556633.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Glycine max] Back     alignment and taxonomy information
>gi|449468730|ref|XP_004152074.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528187|ref|XP_004171087.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|297836204|ref|XP_002885984.1| hypothetical protein ARALYDRAFT_343169 [Arabidopsis lyrata subsp. lyrata] gi|297331824|gb|EFH62243.1| hypothetical protein ARALYDRAFT_343169 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|240254458|ref|NP_565382.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546786|sp|Q9XIL5.3|PP154_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15820 gi|25411674|pir||G84533 hypothetical protein At2g15820 [imported] - Arabidopsis thaliana gi|330251345|gb|AEC06439.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357436027|ref|XP_003588289.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357469333|ref|XP_003604951.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357520985|ref|XP_003630781.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477337|gb|AES58540.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355506006|gb|AES87148.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524803|gb|AET05257.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
TAIR|locus:2044541849 OTP51 "ORGANELLE TRANSCRIPT PR 0.781 0.700 0.585 7.5e-192
TAIR|locus:2827701 874 AT2G17140 [Arabidopsis thalian 0.419 0.364 0.228 9.5e-14
TAIR|locus:2157732723 EMB1006 "embryo defective 1006 0.457 0.481 0.214 4e-13
TAIR|locus:2031825517 AT1G13040 [Arabidopsis thalian 0.434 0.640 0.245 1.6e-12
TAIR|locus:2024367607 AT1G09680 "AT1G09680" [Arabido 0.357 0.448 0.265 3.7e-12
TAIR|locus:1005716687544 AT1G66345 "AT1G66345" [Arabido 0.486 0.680 0.222 4.9e-12
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.431 0.449 0.231 1.7e-11
TAIR|locus:2175443952 AT5G04810 [Arabidopsis thalian 0.445 0.356 0.233 2e-11
TAIR|locus:2119747660 EMB1025 "embryo defective 1025 0.411 0.474 0.239 6.6e-11
TAIR|locus:2140220532 AT4G02820 "AT4G02820" [Arabido 0.340 0.486 0.231 1.6e-10
TAIR|locus:2044541 OTP51 "ORGANELLE TRANSCRIPT PROCESSING 51" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1859 (659.5 bits), Expect = 7.5e-192, P = 7.5e-192
 Identities = 357/610 (58%), Positives = 458/610 (75%)

Query:    22 FFPHVTTVRTPRSYHFLSAPLSSATSQSTFVEQLAGEKDSSQEEKWDMFKNSDAESGSVD 81
             FF H +T RTP     L    S+A    TFVE L G  +S +E   +     D ES   D
Sbjct:    91 FFSHSST-RTPP----LFTANSTAQRSGTFVEHLTGITES-EEGISEANGFGDVESARND 144

Query:    82 F-DVGTAGSEMRHLGXXXXXXXXXXXXXXQWRRAKLAWLCKELPSHKGGTLVRILNAQKK 140
               +V T   E                   +WRR+KLAWLCKE+P+HK  TLVR+LNAQKK
Sbjct:   145 IRNVATRRIETEF------EVRELEELPEEWRRSKLAWLCKEVPTHKAVTLVRLLNAQKK 198

Query:   141 WLRQEDGTYLAVHCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCR 200
             W+RQED TY++VHCMRIRENETGFRVY WM QQ+WYRFDF L TKLA+Y+GKERKF KCR
Sbjct:   199 WVRQEDATYISVHCMRIRENETGFRVYRWMTQQNWYRFDFGLTTKLAEYLGKERKFTKCR 258

Query:   201 DIFDDIINQGRVPSEMTFHILIVAYLSA-PVQGCLDEACSIYNRMIQLGGYQPRPSLHNS 259
             ++FDD++NQGRVPSE TFHIL+VAYLS+  V+GCL+EACS+YNRMIQLGGY+PR SLHNS
Sbjct:   259 EVFDDVLNQGRVPSESTFHILVVAYLSSLSVEGCLEEACSVYNRMIQLGGYKPRLSLHNS 318

Query:   260 LFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDKERISLL 319
             LFRALVSK GG+    L+QAEFIFHN++T+GLE+QKDIYSGLIWLHS QD +D  RI+ L
Sbjct:   319 LFRALVSKQGGILNDQLKQAEFIFHNVVTTGLEVQKDIYSGLIWLHSCQDEVDIGRINSL 378

Query:   320 KKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAK 379
             ++EM++AGF+E KEV++S+LR  AKEG VE+ E+TWL LL+ D GIP+ AFVYK+EAY+K
Sbjct:   379 REEMKKAGFQESKEVVVSLLRAYAKEGGVEEVERTWLELLDLDCGIPSQAFVYKIEAYSK 438

Query:   380 IGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPS 439
             +G+F K++EIFREM++ +G A++  YHKIIE+LCK ++ EL E+LMKEF E+G KPL+PS
Sbjct:   439 VGDFAKAMEIFREMEKHIGGATMSGYHKIIEVLCKVQQVELVETLMKEFEESGKKPLLPS 498

Query:   440 YINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHS 499
             +I +  MY +LG+H++L +AF +CLEKC+P++ IY IYL+SL   GN+EKA ++FN M +
Sbjct:   499 FIEIAKMYFDLGLHEKLEMAFVQCLEKCQPSQPIYNIYLDSLTKIGNLEKAGDVFNEMKN 558

Query:   500 DQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLSLNRKEV 559
             + TI V+ RSCN +L  YL  G  V+AE+IYDLM +KKYEIE   MEKLDY+LSL +KEV
Sbjct:   559 NGTINVSARSCNSLLKGYLDCGKQVQAERIYDLMRMKKYEIEPPLMEKLDYILSLKKKEV 618

Query:   560 KK-PVSLNLSSEQRENXXXXXXXXXCIESDEKRKRHMIRFQFNENSRMHSVLRRYLYDQY 618
             KK P S+ LS +QRE           IESD+++K HMI+F+F ENS+ H VL++ ++DQ+
Sbjct:   619 KKRPFSMKLSKDQREVLVGLLLGGLQIESDKEKKSHMIKFEFRENSQAHLVLKQNIHDQF 678

Query:   619 HEWLHPSFKF 628
              EWLHP   F
Sbjct:   679 REWLHPLSNF 688


GO:0004519 "endonuclease activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0000373 "Group II intron splicing" evidence=IMP
GO:0009507 "chloroplast" evidence=RCA
GO:0045292 "mRNA cis splicing, via spliceosome" evidence=IMP
GO:0048564 "photosystem I assembly" evidence=IMP
TAIR|locus:2827701 AT2G17140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157732 EMB1006 "embryo defective 1006" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031825 AT1G13040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024367 AT1G09680 "AT1G09680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716687 AT1G66345 "AT1G66345" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175443 AT5G04810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119747 EMB1025 "embryo defective 1025" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140220 AT4G02820 "AT4G02820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XIL5PP154_ARATHNo assigned EC number0.58210.94080.8433yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
pfam03161177 pfam03161, LAGLIDADG_2, LAGLIDADG DNA endonuclease 2e-21
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-06
>gnl|CDD|217395 pfam03161, LAGLIDADG_2, LAGLIDADG DNA endonuclease family Back     alignment and domain information
 Score = 91.6 bits (228), Expect = 2e-21
 Identities = 51/177 (28%), Positives = 76/177 (42%), Gaps = 35/177 (19%)

Query: 571 QRENLIGLLLGGLCIESDEKRKRHMIRFQF-NENSRMHSVL------------RRYLYD- 616
           Q+E ++GLLLG   IES +K  R   RF+F N    +H               R+     
Sbjct: 1   QKEIIVGLLLGDGHIESRKKGTRISFRFEFKNYEYILHVYEKLLGYCTSNPPPRKPTRGN 60

Query: 617 ---------QYHEWLHPSFK-----FWPKG-RLVIPKLIHRWLTPRALAYWFMYGG---H 658
                    +++    PSF      F+  G + ++P LI  +LTP ALAYW M  G   +
Sbjct: 61  KSGKSYISWEFNTRSLPSFNKLYELFYINGKKKIVPNLIEEYLTPLALAYWIMDDGGNKN 120

Query: 659 RTSVGDILLKLKVSSEGIALVFKTLKARS-LDCRVKKKGR--VFWIGFLGSNSTLFW 712
            TS G  +     + E +  + K LK +  L+C +KK G    + I     +  LF 
Sbjct: 121 STSKGIKICTQSFTLEEVQFLIKLLKIKFNLECTIKKNGSSNKYRIYIPAKSMALFR 177


This is a family of site-specific DNA endonucleases encoded by DNA mobile elements. Similar to pfam00961, the members of this family are also LAGLIDADG endonucleases. Length = 177

>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 761
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.78
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.77
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.72
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.7
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.69
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.65
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.64
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.64
PRK14574 822 hmsH outer membrane protein; Provisional 99.64
PRK14574822 hmsH outer membrane protein; Provisional 99.6
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.49
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.46
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.44
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.41
KOG2003840 consensus TPR repeat-containing protein [General f 99.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.35
KOG2076 895 consensus RNA polymerase III transcription factor 99.34
PF1304150 PPR_2: PPR repeat family 99.33
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.33
KOG2076 895 consensus RNA polymerase III transcription factor 99.33
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.33
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.33
PF1304150 PPR_2: PPR repeat family 99.32
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.32
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.27
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.26
KOG1126638 consensus DNA-binding cell division cycle control 99.26
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.25
KOG2003840 consensus TPR repeat-containing protein [General f 99.25
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.23
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.19
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.19
KOG1126638 consensus DNA-binding cell division cycle control 99.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.16
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.12
KOG1915677 consensus Cell cycle control protein (crooked neck 99.11
PRK12370553 invasion protein regulator; Provisional 99.11
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.07
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.04
KOG0547606 consensus Translocase of outer mitochondrial membr 99.03
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.03
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.01
KOG1129478 consensus TPR repeat-containing protein [General f 98.99
KOG1915677 consensus Cell cycle control protein (crooked neck 98.97
PRK12370553 invasion protein regulator; Provisional 98.95
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.92
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.9
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.86
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.86
KOG0547606 consensus Translocase of outer mitochondrial membr 98.84
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.78
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.77
KOG1129478 consensus TPR repeat-containing protein [General f 98.76
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.76
PRK11189296 lipoprotein NlpI; Provisional 98.75
PRK11189296 lipoprotein NlpI; Provisional 98.75
PF1285434 PPR_1: PPR repeat 98.71
PF1285434 PPR_1: PPR repeat 98.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.67
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.65
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.55
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.55
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.53
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.51
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.5
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.49
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.48
PRK04841903 transcriptional regulator MalT; Provisional 98.47
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.46
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.42
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.36
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.36
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.33
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.32
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.32
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.31
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.29
PRK04841903 transcriptional regulator MalT; Provisional 98.29
KOG2376652 consensus Signal recognition particle, subunit Srp 98.29
PF03161178 LAGLIDADG_2: LAGLIDADG DNA endonuclease family; In 98.28
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.27
KOG2376652 consensus Signal recognition particle, subunit Srp 98.25
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.21
PLN02789320 farnesyltranstransferase 98.2
KOG1125579 consensus TPR repeat-containing protein [General f 98.18
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.16
PLN02789320 farnesyltranstransferase 98.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.13
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.11
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.1
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.1
PRK10370198 formate-dependent nitrite reductase complex subuni 98.07
KOG1125579 consensus TPR repeat-containing protein [General f 98.06
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.04
KOG1128777 consensus Uncharacterized conserved protein, conta 98.03
PRK10370198 formate-dependent nitrite reductase complex subuni 98.03
PRK15359144 type III secretion system chaperone protein SscB; 97.97
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.94
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.93
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.92
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.92
PRK15359144 type III secretion system chaperone protein SscB; 97.91
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.9
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.86
KOG1128777 consensus Uncharacterized conserved protein, conta 97.86
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.8
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.78
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.76
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.74
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.72
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.71
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.69
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.69
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.68
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.65
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.63
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.6
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.57
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.55
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.51
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.5
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.47
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.44
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.41
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.41
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.37
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.35
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.32
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.3
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.22
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.92
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.88
KOG0553304 consensus TPR repeat-containing protein [General f 96.88
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.84
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.69
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.62
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.62
PF12688120 TPR_5: Tetratrico peptide repeat 96.62
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.59
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.56
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.52
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.51
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.5
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.41
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.32
PF12688120 TPR_5: Tetratrico peptide repeat 96.25
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.22
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.21
KOG0553304 consensus TPR repeat-containing protein [General f 96.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.74
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.72
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.66
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.58
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.55
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.54
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.49
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.47
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.45
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.42
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.4
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.36
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.1
PRK10803263 tol-pal system protein YbgF; Provisional 95.03
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.0
KOG20411189 consensus WD40 repeat protein [General function pr 94.99
COG4700251 Uncharacterized protein conserved in bacteria cont 94.96
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.96
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.94
COG4700251 Uncharacterized protein conserved in bacteria cont 94.9
PRK10803263 tol-pal system protein YbgF; Provisional 94.89
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.88
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.81
PF1337173 TPR_9: Tetratricopeptide repeat 94.77
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.51
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.48
smart00299140 CLH Clathrin heavy chain repeat homology. 94.45
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.44
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.37
KOG3941406 consensus Intermediate in Toll signal transduction 94.37
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.26
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.24
KOG3941406 consensus Intermediate in Toll signal transduction 94.21
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.64
KOG1585308 consensus Protein required for fusion of vesicles 93.63
PF1337173 TPR_9: Tetratricopeptide repeat 93.61
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.51
smart00299140 CLH Clathrin heavy chain repeat homology. 93.36
KOG15381081 consensus Uncharacterized conserved protein WDR10, 93.33
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.28
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.19
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 93.13
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.11
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.05
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.79
PF1343134 TPR_17: Tetratricopeptide repeat 92.35
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.25
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.24
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.19
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.18
PRK15331165 chaperone protein SicA; Provisional 91.98
PRK15331165 chaperone protein SicA; Provisional 91.91
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.62
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.51
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.75
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.69
COG3629280 DnrI DNA-binding transcriptional activator of the 90.68
KOG4555175 consensus TPR repeat-containing protein [Function 90.57
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.26
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.06
KOG4555175 consensus TPR repeat-containing protein [Function 89.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 89.54
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.38
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.28
COG1729262 Uncharacterized protein conserved in bacteria [Fun 88.98
KOG2297412 consensus Predicted translation factor, contains W 88.85
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 88.59
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.58
COG3629280 DnrI DNA-binding transcriptional activator of the 88.57
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.27
KOG2610491 consensus Uncharacterized conserved protein [Funct 87.8
PF13512142 TPR_18: Tetratricopeptide repeat 87.14
PF1342844 TPR_14: Tetratricopeptide repeat 87.06
PRK11906458 transcriptional regulator; Provisional 86.75
KOG2610491 consensus Uncharacterized conserved protein [Funct 86.0
PRK11906458 transcriptional regulator; Provisional 85.95
COG1729262 Uncharacterized protein conserved in bacteria [Fun 85.92
PF1342844 TPR_14: Tetratricopeptide repeat 85.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 85.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 85.45
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.1
COG4105254 ComL DNA uptake lipoprotein [General function pred 84.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.1
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.37
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 81.9
KOG1941518 consensus Acetylcholine receptor-associated protei 81.72
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 81.59
PF1343134 TPR_17: Tetratricopeptide repeat 80.88
COG1747 711 Uncharacterized N-terminal domain of the transcrip 80.76
KOG1941518 consensus Acetylcholine receptor-associated protei 80.48
PF13512142 TPR_18: Tetratricopeptide repeat 80.44
PF1452877 LAGLIDADG_3: LAGLIDADG-like domain; PDB: 2CW7_A 2C 80.18
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3e-71  Score=654.39  Aligned_cols=538  Identities=17%  Similarity=0.157  Sum_probs=421.4

Q ss_pred             hHHHhhcCCCchhhhhhccchh----HHHHHHHHHHhhcCCccchhhHHHHHHhhhcccCCcchhhhhH--HHhccCChh
Q 004324           88 GSEMRHLGEPVVEVIELEELPE----QWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAV--HCMRIRENE  161 (761)
Q Consensus        88 ~~~~~~l~~~~~~~~~~~~~~~----~~~~~~i~~~~~~~~~~~~~~~~~~l~~~~~~~~p~~~t~~~~--~~~~~~~~~  161 (761)
                      .+.+.+.+..+.+.++|++|+.    .|+ .++..+++.+..+++..++..|...  |+.||.+||+.+  +|++.+++.
T Consensus       128 i~~~~~~g~~~~A~~~f~~m~~~d~~~~n-~li~~~~~~g~~~~A~~~f~~M~~~--g~~Pd~~t~~~ll~~~~~~~~~~  204 (857)
T PLN03077        128 LSMFVRFGELVHAWYVFGKMPERDLFSWN-VLVGGYAKAGYFDEALCLYHRMLWA--GVRPDVYTFPCVLRTCGGIPDLA  204 (857)
T ss_pred             HHHHHhCCChHHHHHHHhcCCCCCeeEHH-HHHHHHHhCCCHHHHHHHHHHHHHc--CCCCChhHHHHHHHHhCCccchh
Confidence            4556677888999999999985    343 4677788999999999999887644  799999999998  899999999


Q ss_pred             HHHHHHHHHHHcCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCCCCCCHHHHHHHH
Q 004324          162 TGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGCLDEACSIY  241 (761)
Q Consensus       162 ~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~f~~m~~~g~~pd~~~~~~li~~~~~~~~~g~~~~A~~l~  241 (761)
                      .+.++|..|.+.| +.||+.++|+||++|+++|++++|.++|++|+.    ||.++||+||.+|+   +.|++++|+++|
T Consensus       205 ~~~~~~~~~~~~g-~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~----~d~~s~n~li~~~~---~~g~~~eAl~lf  276 (857)
T PLN03077        205 RGREVHAHVVRFG-FELDVDVVNALITMYVKCGDVVSARLVFDRMPR----RDCISWNAMISGYF---ENGECLEGLELF  276 (857)
T ss_pred             hHHHHHHHHHHcC-CCcccchHhHHHHHHhcCCCHHHHHHHHhcCCC----CCcchhHHHHHHHH---hCCCHHHHHHHH
Confidence            9999999999999 999999999999999999999999999999975    69999999999999   899999999999


Q ss_pred             HHHHhcCCCCCCHHHHHHHHHHHHcCCCCCchhhHHHHHHHHHHHHHcCCCcCHHHHHHHHH------------------
Q 004324          242 NRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIW------------------  303 (761)
Q Consensus       242 ~~m~~~~g~~p~~~t~~~ll~~~~~~~g~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~------------------  303 (761)
                      .+|.+. |+.||.+||+++|.+|++.      |+++.|.+++..|.+.|+.||..+|+.++.                  
T Consensus       277 ~~M~~~-g~~Pd~~ty~~ll~a~~~~------g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m  349 (857)
T PLN03077        277 FTMREL-SVDPDLMTITSVISACELL------GDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRM  349 (857)
T ss_pred             HHHHHc-CCCCChhHHHHHHHHHHhc------CChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhC
Confidence            999998 8999999999999999986      588888888888888888888888777663                  


Q ss_pred             -----------HHhhccCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHH
Q 004324          304 -----------LHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVY  372 (761)
Q Consensus       304 -----------~~~~~~~g~~~~a~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~  372 (761)
                                 +.+|++.|++++|+++|++|.+.|+.||..||+++|.+|++.|++++|.++++.|.+.|+.|+..+||+
T Consensus       350 ~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~  429 (857)
T PLN03077        350 ETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANA  429 (857)
T ss_pred             CCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHH
Confidence                       356677778888888999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCC
Q 004324          373 KMEAYAKIGEFMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGM  452 (761)
Q Consensus       373 li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~li~~~~~~g~  452 (761)
                      ||++|+++|++++|.++|++|.+    +|+++||++|.+|+++|+.++|..+|++|.. ++.||..||+++|.+|++.|.
T Consensus       430 Li~~y~k~g~~~~A~~vf~~m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~  504 (857)
T PLN03077        430 LIEMYSKCKCIDKALEVFHNIPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGA  504 (857)
T ss_pred             HHHHHHHcCCHHHHHHHHHhCCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhch
Confidence            99999999999999999998865    3677777777777777777777777777764 467777766665554444444


Q ss_pred             HHHHHHHHHHHHh-CC------------------------------CCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhCC
Q 004324          453 HDRLHLAFSECLE-KC------------------------------RPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSDQ  501 (761)
Q Consensus       453 ~~~a~~~~~~m~~-~~------------------------------~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g  501 (761)
                      ++.+.+++..+.+ |+                              .||..+||+||.+|++.|+.++|.++|++|.+.|
T Consensus       505 l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g  584 (857)
T PLN03077        505 LMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESG  584 (857)
T ss_pred             HHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhcCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcC
Confidence            4444444444433 33                              5677777777777777777777777777777777


Q ss_pred             CCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHH-HcCCccChHHHHHHHHHHhhhhhhhc-ccccCCCchhhHHhHHHHH
Q 004324          502 TIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMC-LKKYEIESAWMEKLDYVLSLNRKEVK-KPVSLNLSSEQRENLIGLL  579 (761)
Q Consensus       502 ~~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~-~~g~~~~~~~~~~~~~~~~l~~~~~~-~~~~~~~~~~~~~~~~~~l  579 (761)
                       +.||.+||+++|.+|++.|++++|.++|++|. +.|+.|+..+|..+..++......-+ ..+...++..||..+|++|
T Consensus       585 -~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aL  663 (857)
T PLN03077        585 -VNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGAL  663 (857)
T ss_pred             -CCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHH
Confidence             77777777777777777777777777777777 45666666655555444433322111 1111112234557777778


Q ss_pred             hhhhhhhhhhhHHHHHHH--hhccccchhhHHHHHHHHHhhhhccCCCCccccCCcccchhhhhhccCccceeeeeeeCC
Q 004324          580 LGGLCIESDEKRKRHMIR--FQFNENSRMHSVLRRYLYDQYHEWLHPSFKFWPKGRLVIPKLIHRWLTPRALAYWFMYGG  657 (761)
Q Consensus       580 l~~~~~~g~~~~a~~~~~--~~l~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~~a~~~~~~m~~~g~~Pd~~ty~~li~g  657 (761)
                      |++|+.+|+.+.|+.+.+  ++++|++..+|++++++|+..|+|++|.+        +...|.++|+.++.-..|+-+++
T Consensus       664 l~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~--------vr~~M~~~g~~k~~g~s~ie~~~  735 (857)
T PLN03077        664 LNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVAR--------VRKTMRENGLTVDPGCSWVEVKG  735 (857)
T ss_pred             HHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHH--------HHHHHHHcCCCCCCCccEEEECC
Confidence            877777777777777766  77777777777777777777666665554        24555556666665555555554



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03161 LAGLIDADG_2: LAGLIDADG DNA endonuclease family; InterPro: IPR004860 This is a family of site-specific DNA endonucleases encoded by DNA mobile elements Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14528 LAGLIDADG_3: LAGLIDADG-like domain; PDB: 2CW7_A 2CW8_A 2VS8_F 2VS7_G 1B24_A 1DQ3_A 2DCH_X Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
3c0w_A235 Intron-encoded endonuclease I-SCEI; endonuclease, 2e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-06
>3c0w_A Intron-encoded endonuclease I-SCEI; endonuclease, homing, ladlidadg, catalytic mechanism, metal binding; HET: DNA; 2.20A {Saccharomyces cerevisiae} PDB: 1r7m_A* 3c0x_A* 3ool_A 3oor_A Length = 235 Back     alignment and structure
 Score =  113 bits (284), Expect = 2e-28
 Identities = 48/210 (22%), Positives = 88/210 (41%), Gaps = 37/210 (17%)

Query: 552 LSLNRKEVK--KPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIRFQFNENS---RM 606
           L  N K +K  K   + L+ EQ E  IGL+LG   I S ++ K + ++F++   +    +
Sbjct: 12  LGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHV 71

Query: 607 HSVLRRYLYDQYHE------------------WLHPSFK-----FWPKGRLVIPK-LIHR 642
             +  +++    H+                  + H +F      F    +  IP  L+  
Sbjct: 72  CLLYDQWVLSPPHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKKTIPNNLVEN 131

Query: 643 WLTPRALAYWFMYGGHRTSVGDILLKLKV-------SSEGIALVFKTLKAR-SLDCRVKK 694
           +LTP +LAYWFM  G +           +       + E +  + K L+ +  L+C VK 
Sbjct: 132 YLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKI 191

Query: 695 KGRVFWIGFLGSNSTLFWKLIEPYVLDELK 724
                 I     +  +F+ LI+PY++ ++ 
Sbjct: 192 NKNKPIIYIDSMSYLIFYNLIKPYLIPQMM 221


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.98
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.88
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.8
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.79
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.76
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.69
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.67
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.66
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.65
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.63
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.6
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.59
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.54
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.44
3c0w_A235 Intron-encoded endonuclease I-SCEI; endonuclease, 99.43
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.41
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.41
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.33
3u4t_A272 TPR repeat-containing protein; structural genomics 99.33
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.3
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.18
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.14
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.11
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.07
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.98
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.97
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.93
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.86
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.75
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.74
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.67
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.66
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.63
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.61
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.61
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.61
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.6
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.56
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.53
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.51
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.48
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.48
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.47
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.46
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.45
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.45
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.45
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.41
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.39
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.37
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.34
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.31
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.29
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.29
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.26
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.23
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.19
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.18
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.15
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.15
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.11
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.09
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.0
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.97
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.97
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.94
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.93
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.91
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.91
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.9
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.9
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.9
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.87
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.84
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.83
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.8
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.79
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.79
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.69
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.68
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.67
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.66
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.56
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.5
3k9i_A117 BH0479 protein; putative protein binding protein, 97.49
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.47
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.42
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.29
3k9i_A117 BH0479 protein; putative protein binding protein, 97.28
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.27
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.26
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.21
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.16
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.08
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.01
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.9
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.89
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.82
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.72
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.65
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.41
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.23
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.45
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.41
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.36
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.26
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.23
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.08
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.94
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.88
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.86
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.65
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.01
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.33
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.05
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.16
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 88.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.94
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.68
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.35
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.89
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 86.33
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 85.86
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.96
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.68
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 82.04
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 80.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.1
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.5e-35  Score=335.70  Aligned_cols=450  Identities=10%  Similarity=-0.045  Sum_probs=331.8

Q ss_pred             HHHHHHHhhcCCccchhhHHHHHHhhhcccCCcchhhhhH--HHhccCChhHHHHHHHHHHHcCCCCCCHHHHHHHHHHH
Q 004324          113 RAKLAWLCKELPSHKGGTLVRILNAQKKWLRQEDGTYLAV--HCMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYM  190 (761)
Q Consensus       113 ~~~i~~~~~~~~~~~~~~~~~~l~~~~~~~~p~~~t~~~~--~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~~li~~~  190 (761)
                      ..++..+.+.+....+..+++.+..    ..|+..++..+  .|.+.|++++|..+|+.+..   .+++..+++.++.+|
T Consensus        88 ~~~~~~~~~~g~~~~A~~~~~~~~~----~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~~~l~~~~  160 (597)
T 2xpi_A           88 RLWRHDALMQQQYKCAAFVGEKVLD----ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDL---YNRSSACRYLAAFCL  160 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHH----HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCG---GGTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCchHHHHHHHHHHh----hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhc---cccchhHHHHHHHHH
Confidence            3556677788888888888776653    45777777666  88899999999999998864   366899999999999


Q ss_pred             HhcCChhHHHHHHHH-HHHC--------------CCCCCHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhcCCCCCCHH
Q 004324          191 GKERKFAKCRDIFDD-IINQ--------------GRVPSEMTFHILIVAYLSAPVQGCLDEACSIYNRMIQLGGYQPRPS  255 (761)
Q Consensus       191 ~~~g~~~~A~~~f~~-m~~~--------------g~~pd~~~~~~li~~~~~~~~~g~~~~A~~l~~~m~~~~g~~p~~~  255 (761)
                      .++|++++|.++|++ ++..              |..++..+|+.++.+|.   +.|++++|+++|++|.+.   .|+..
T Consensus       161 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~---~~g~~~~A~~~~~~~~~~---~p~~~  234 (597)
T 2xpi_A          161 VKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYT---NLSNFDRAKECYKEALMV---DAKCY  234 (597)
T ss_dssp             HHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHH---HTTCHHHHHHHHHHHHHH---CTTCH
T ss_pred             HHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHH---HcCCHHHHHHHHHHHHHh---Cchhh
Confidence            999999999999995 3332              23446899999999999   799999999999999985   35433


Q ss_pred             H-HHHHHHHHHc--------------------------------CCCCCchhhHHHHHHHHHHHHHcCCCcCHHHHHHHH
Q 004324          256 L-HNSLFRALVS--------------------------------KPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLI  302 (761)
Q Consensus       256 t-~~~ll~~~~~--------------------------------~~g~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li  302 (761)
                      + +..+...+..                                .......|++++|.++|+++.+.  .++..++..++
T Consensus       235 ~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~  312 (597)
T 2xpi_A          235 EAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKA  312 (597)
T ss_dssp             HHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHH
T ss_pred             HHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHH
Confidence            3 2222211100                                11122346777888888777655  35555555554


Q ss_pred             HHHhhccCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCC
Q 004324          303 WLHSYQDNIDKERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGE  382 (761)
Q Consensus       303 ~~~~~~~~g~~~~a~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~  382 (761)
                        ..+.+.|++++|..+|++|.+.+. .+..+++.++.+|.+.|++++|.++++++.+... .+..+|+.++.+|.+.|+
T Consensus       313 --~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~  388 (597)
T 2xpi_A          313 --DTLFVRSRFIDVLAITTKILEIDP-YNLDVYPLHLASLHESGEKNKLYLISNDLVDRHP-EKAVTWLAVGIYYLCVNK  388 (597)
T ss_dssp             --HHHHHTTCHHHHHHHHHHHHHHCT-TCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCT-TSHHHHHHHHHHHHHTTC
T ss_pred             --HHHHHhcCHHHHHHHHHHHHHcCc-ccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCc-ccHHHHHHHHHHHHHhcc
Confidence              677777778888888887776543 2566777778888888888888888887776543 357777778888888888


Q ss_pred             hHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 004324          383 FMKSLEIFREMQERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSE  462 (761)
Q Consensus       383 ~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~a~~~~~~  462 (761)
                      +++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+|+.++.+|.+.|++++|.++|++
T Consensus       389 ~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  466 (597)
T 2xpi_A          389 ISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQS  466 (597)
T ss_dssp             HHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            888888888777642 2356778888888888888888888888877654 34667777788888888888888888888


Q ss_pred             HHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhC----CCCCCC--HHHHHHHHHHHHhCCCHHHHHHHHHHHHHc
Q 004324          463 CLEKCRPNRTIYGIYLESLKNAGNIEKAEEIFNHMHSD----QTIGVN--TRSCNIILSAYLSSGDFVKAEKIYDLMCLK  536 (761)
Q Consensus       463 m~~~~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~----g~~~p~--~~t~~~li~~~~~~g~~~~A~~~~~~m~~~  536 (761)
                      +.+..+.+..+|+.++.+|.+.|++++|.++|++|.+.    + ..|+  ..+|..++.+|.+.|++++|.++|+++.+.
T Consensus       467 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~-~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  545 (597)
T 2xpi_A          467 SYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQ-SNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLL  545 (597)
T ss_dssp             HHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSC-CCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccc-cchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHh
Confidence            77655567777888888888888888888888877664    3 4566  677888888888888888888888877753


Q ss_pred             CCccChHHHHHHHHHHhhhhhhhcccccCCCchhhHHhHHHHHhhhhhhhhhhhHHHHHHH--hhccccchhhHHHHHHH
Q 004324          537 KYEIESAWMEKLDYVLSLNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIR--FQFNENSRMHSVLRRYL  614 (761)
Q Consensus       537 g~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~--~~l~p~~~~~~~~l~~~  614 (761)
                      +    |+                            +..+|..+...|...|++++|.+.++  ++++|++...+..++++
T Consensus       546 ~----p~----------------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~  593 (597)
T 2xpi_A          546 S----TN----------------------------DANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRA  593 (597)
T ss_dssp             S----SC----------------------------CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHT
T ss_pred             C----CC----------------------------ChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHH
Confidence            2    21                            25667778888888888888888887  77888888888887776


Q ss_pred             HH
Q 004324          615 YD  616 (761)
Q Consensus       615 ~~  616 (761)
                      |.
T Consensus       594 ~~  595 (597)
T 2xpi_A          594 LE  595 (597)
T ss_dssp             TC
T ss_pred             Hh
Confidence            64



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3c0w_A Intron-encoded endonuclease I-SCEI; endonuclease, homing, ladlidadg, catalytic mechanism, metal binding; HET: DNA; 2.20A {Saccharomyces cerevisiae} PDB: 1r7m_A* 3c0x_A* 3ool_A 3oor_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 761
d1r7ma2105 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Bake 3e-17
d1r7ma1118 d.95.2.1 (A:3-120) DNA endonuclease I-SceI {Baker' 4e-09
>d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Homing endonuclease-like
superfamily: Homing endonucleases
family: Group I mobile intron endonuclease
domain: DNA endonuclease I-SceI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 75.6 bits (186), Expect = 3e-17
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 635 VIPK-LIHRWLTPRALAYWFMYGGHR------TSVGDILLKLK-VSSEGIALVFKTLKAR 686
            IP  L+  +LTP +LAYWFM  G +      ++   I+L  +  + E +  + K L+ +
Sbjct: 3   TIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNK 62

Query: 687 -SLDCRVKKKGRVFWIGFLGSNSTLFWKLIEPYVLDELK 724
             L+C VK       I     +  +F+ LI+PY++ ++ 
Sbjct: 63  FQLNCYVKINKNKPIIYIDSMSYLIFYNLIKPYLIPQMM 101


>d1r7ma1 d.95.2.1 (A:3-120) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.86
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1r7ma2105 DNA endonuclease I-SceI {Baker's yeast (Saccharomy 99.54
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.41
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.05
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.86
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.69
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.68
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.14
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.07
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.05
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.97
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.85
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.82
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.81
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.58
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.58
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.43
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.35
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.35
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.27
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.22
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.1
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.97
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.94
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.87
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.85
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.75
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.5
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.25
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.18
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.13
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.18
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.01
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.37
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.71
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.85
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=5.3e-18  Score=178.39  Aligned_cols=378  Identities=15%  Similarity=0.087  Sum_probs=216.9

Q ss_pred             HhccCChhHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhcCCCCCC
Q 004324          154 CMRIRENETGFRVYEWMMQQHWYRFDFALATKLADYMGKERKFAKCRDIFDDIINQGRVPSEMTFHILIVAYLSAPVQGC  233 (761)
Q Consensus       154 ~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~f~~m~~~g~~pd~~~~~~li~~~~~~~~~g~  233 (761)
                      .-+.|+++.|.+.++.+.+..  +.+..++..+..+|.+.|++++|...|++..+.... +..+|..+...|.   +.|+
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~---~~g~   82 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYK---ERGQ   82 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHH---HHTC
T ss_pred             HHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhh---hhcc
Confidence            346677777777777777664  456667777777777777777777777777665322 4566777777777   5777


Q ss_pred             HHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHcCCCCCchhhHHHHHHHHHHHHHcCCCcCHHHHHHHHHHHhhccCCCH
Q 004324          234 LDEACSIYNRMIQLGGYQPRPSLHNSLFRALVSKPGGLSKYYLQQAEFIFHNLLTSGLEIQKDIYSGLIWLHSYQDNIDK  313 (761)
Q Consensus       234 ~~~A~~l~~~m~~~~g~~p~~~t~~~ll~~~~~~~g~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~~~g~~  313 (761)
                      +++|+..+....+..  ..+...............      ....+.............                     
T Consensus        83 ~~~A~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~---------------------  133 (388)
T d1w3ba_          83 LQEAIEHYRHALRLK--PDFIDGYINLAAALVAAG------DMEGAVQAYVSALQYNPD---------------------  133 (388)
T ss_dssp             HHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHHS------CSSHHHHHHHHHHHHCTT---------------------
T ss_pred             ccccccccccccccc--cccccccccccccccccc------cccccccccccccccccc---------------------
Confidence            777777777776642  122222111111111110      122222222222222211                     


Q ss_pred             HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHH
Q 004324          314 ERISLLKKEMQQAGFEEGKEVLLSVLRVCAKEGDVEDAEKTWLRLLESDNGIPTPAFVYKMEAYAKIGEFMKSLEIFREM  393 (761)
Q Consensus       314 ~~a~~l~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m  393 (761)
                                       ...............+....+...+.......+. +...+..+...+...|+.++|...+.+.
T Consensus       134 -----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~a  195 (388)
T d1w3ba_         134 -----------------LYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKA  195 (388)
T ss_dssp             -----------------CTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred             -----------------cccccccccccccccchhhhhHHHHHHhhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHH
Confidence                             2222333333344444444554444444443322 3444455555555555555555555555


Q ss_pred             HHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCHHH
Q 004324          394 QERLGSASVPAYHKIIELLCKAEETELTESLMKEFVETGMKPLMPSYINLTNMYLNLGMHDRLHLAFSECLEKCRPNRTI  473 (761)
Q Consensus       394 ~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~a~~~~~~m~~~~~p~~~~  473 (761)
                      .+.. +-+..+|..+...+...|++++|...++...... ..+...+..+...|.+.|++++|...|++..+..+.+..+
T Consensus       196 l~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~  273 (388)
T d1w3ba_         196 VTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDA  273 (388)
T ss_dssp             HHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHH
T ss_pred             HHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHH
Confidence            4431 1234455555555566666666666665555543 2344555556666666666666666666665544555666


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHhhhCCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCccChHHHHHHHHHHh
Q 004324          474 YGIYLESLKNAGNIEKAEEIFNHMHSDQTIGVNTRSCNIILSAYLSSGDFVKAEKIYDLMCLKKYEIESAWMEKLDYVLS  553 (761)
Q Consensus       474 ~~~li~~~~~~g~~~~A~~l~~~m~~~g~~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~~~~~~~  553 (761)
                      |..+...|...|++++|.+.|+......  +.+...+..+...+.+.|++++|++.|++.++    .+|+.         
T Consensus       274 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~----~~p~~---------  338 (388)
T d1w3ba_         274 YCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALE----VFPEF---------  338 (388)
T ss_dssp             HHHHHHHHHHHSCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTT----SCTTC---------
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHhhhccC--CccchhhhHHHHHHHHCCCHHHHHHHHHHHHH----hCCCC---------
Confidence            7777777777777777777777666652  45666677777777777777777777777653    23321         


Q ss_pred             hhhhhhcccccCCCchhhHHhHHHHHhhhhhhhhhhhHHHHHHH--hhccccchhhHHHHHHHHHhhhh
Q 004324          554 LNRKEVKKPVSLNLSSEQRENLIGLLLGGLCIESDEKRKRHMIR--FQFNENSRMHSVLRRYLYDQYHE  620 (761)
Q Consensus       554 l~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~--~~l~p~~~~~~~~l~~~~~~~g~  620 (761)
                                         ..+|..+...+...|++++|...++  ++++|+++..+..++.+|.+.|+
T Consensus       339 -------------------~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         339 -------------------AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             -------------------HHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             -------------------HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence                               4455556666667777777777776  67777777777777777776553



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure