Citrus Sinensis ID: 004351

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------76
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHDTKPRTDVKLSQVASGVDSSSSVQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDTEIEMKRIKKLKEKFKLIHEQFISHHVMSSLSLAPSA
cccHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
cHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHccccccccccccccccEEEEEEEccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEccccHccHHHHHHHHHccccccEEEEEEEEcccccHHHcccccHHHHHccccEEccccccccccEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccHHHHHccccccccccccccccccccccccEEEcHHHHHHHHHHcEEEEEccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHcccccccHHHccccccccccccHccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MHSLYEAYNELHGLAqeletpfdapavlvvghqtdGKSALVEALMGFqfnhvgggtktrrpitlhmkynplcelplchlassdvdptlAQEKSLQEIQSFIEAENMRleresnsnqfsaKEIIIKVEfkycpnltiidtpgliapapgrknraLQDQARAVESLVRAKMQHREFIILCLEdcsdwsnatTRRVVMQIDPELKRTIIVSTKldtkipqfarasdvevflsppactldgfilggspfftsvpsgrvgtghdsvyssneEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRymdsvpmiIPLLEKEYCSTTRKLNEINKELstldevklkekgrvFHDLFLTKLSLLLkgtvvappdkfgetlqneringgafvgtdglqfphklipnagmrlygGAQYHRAMAEFRFMvggikcppitrEEIVNAcgvedihdgtnysrTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSfgsteqsavlsnslsmplcqessfvsvanekhdtkprtdvklsqvasgvdssssvqtTETRLADLLDntlwnrrlapssERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLEsafegdldnvfditnlrhslsqqksDTEIEMKRIKKLKEKFKLIHEQFISHHvmsslslapsa
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRrvvmqidpelkRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEklgrslskqersrigvskLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEInkelstldevklkekGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANekhdtkprtdvklsqvasgvdssssvqttetrLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNlrhslsqqksdteiEMKRIKKLKEKFKLIHEQFishhvmsslslapsa
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDlfltklslllKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHDTKPRTDVKLsqvasgvdssssvQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDTeiemkrikklkekfkliHEQFISHHVMSSLSLAPSA
*****EAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLAS*************************************AKEIIIKVEFKYCPNLTIIDTPGLIAP**************AVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTS************************FI**************************VSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSF************************************************************LADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLR******************KLKEKFKLIHEQFISHH***********
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERE**SNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGR*N*ALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVG***********EFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKL*****************KGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLH**********************************************************************************************IVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITN***************MKRIKKLKEKFKLIHEQF***************
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEK************IGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVA*****************************TETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDTEIEMKRIKKLKEKFKLIHEQFISHHVMS********
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSF*******************************************************TTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDTEIEMKRIKKLKEKFKLIHEQFISHHVM*S*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCSDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHDTKPRTDVKLSQVASGVDSSSSVQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDTEIEMKRIKKLKEKFKLIHEQFISHHVMSSLSLAPSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query759 2.2.26 [Sep-21-2011]
Q84N64777 Dynamin-like protein ARC5 yes no 0.985 0.962 0.792 0.0
Q55AX0904 Dynamin-like protein C OS yes no 0.872 0.732 0.265 7e-63
F4HPR5817 Dynamin-related protein 5 no no 0.708 0.658 0.280 4e-55
Q55F94880 Dynamin-like protein A OS no no 0.828 0.714 0.232 9e-50
Q54MH8808 Dynamin-like protein B OS no no 0.611 0.574 0.246 4e-30
Q94464853 Dynamin-A OS=Dictyosteliu no no 0.268 0.239 0.307 9e-15
Q39821610 Dynamin-related protein 1 no no 0.241 0.3 0.301 1e-11
P42697610 Dynamin-related protein 1 no no 0.241 0.3 0.292 2e-11
Q39828610 Dynamin-related protein 5 no no 0.241 0.3 0.297 3e-11
Q9N0Y2711 Interferon-induced GTP-bi no no 0.238 0.254 0.285 5e-11
>sp|Q84N64|ARC5_ARATH Dynamin-like protein ARC5 OS=Arabidopsis thaliana GN=ARC5 PE=1 SV=2 Back     alignment and function desciption
 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/756 (79%), Positives = 670/756 (88%), Gaps = 8/756 (1%)

Query: 3   SLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPI 62
           SLYEAYNELH LAQELETPF+APAVLVVG QTDGKSALVEALMGFQFNHVGGGTKTRRPI
Sbjct: 27  SLYEAYNELHALAQELETPFEAPAVLVVGQQTDGKSALVEALMGFQFNHVGGGTKTRRPI 86

Query: 63  TLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEI 122
           TLHMKY+P C+ PLCHL S D DP+++  KSL +IQ++IEAENMRLE+E  S  FSAKEI
Sbjct: 87  TLHMKYDPQCQFPLCHLGSDD-DPSVSLPKSLSQIQAYIEAENMRLEQEPCS-PFSAKEI 144

Query: 123 IIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDC 182
           I+KV++KYCPNLTIIDTPGLIAPAPG KNRALQ QARAVE+LVRAKMQH+EFIILCLED 
Sbjct: 145 IVKVQYKYCPNLTIIDTPGLIAPAPGLKNRALQVQARAVEALVRAKMQHKEFIILCLEDS 204

Query: 183 SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGG 242
           SDWS ATTRR+VMQ+DPEL RTI+VSTKLDTKIPQF+ +SDVEVFLSPPA  LD  +LG 
Sbjct: 205 SDWSIATTRRIVMQVDPELSRTIVVSTKLDTKIPQFSCSSDVEVFLSPPASALDSSLLGD 264

Query: 243 SPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVS 302
           SPFFTSVPSGRVG G DSVY SN+EFKQA+ +REMEDI SLE+KLGR L+KQE+SRIG+S
Sbjct: 265 SPFFTSVPSGRVGYGQDSVYKSNDEFKQAVSLREMEDIASLEKKLGRLLTKQEKSRIGIS 324

Query: 303 KLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHD 362
           KLR FLEELL KRY +SVP+IIPLL KEY ST RKL+ ++KELS+LDE KLKE+GR FHD
Sbjct: 325 KLRLFLEELLWKRYKESVPLIIPLLGKEYRSTVRKLDTVSKELSSLDEAKLKERGRTFHD 384

Query: 363 LFLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQ 422
           LFLTKLSLLLKGTVVAPPDKFGETLQ+ER  GGAFVGTDGLQF HKLIPNAGMRLYGGAQ
Sbjct: 385 LFLTKLSLLLKGTVVAPPDKFGETLQDERTQGGAFVGTDGLQFSHKLIPNAGMRLYGGAQ 444

Query: 423 YHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFL 482
           YHRAMAEFRF+VG IKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKAR+TFEPFL
Sbjct: 445 YHRAMAEFRFLVGAIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARETFEPFL 504

Query: 483 HQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCME 542
           HQLG RLLHILKRLLPIS+YLLQKEGEYLSGHEVFL+RVASAFN+F ESTE++CR+KCME
Sbjct: 505 HQLGARLLHILKRLLPISVYLLQKEGEYLSGHEVFLKRVASAFNSFVESTEKSCRDKCME 564

Query: 543 DLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHD 602
           DL STTRYVTWSLHNKNRAGLRQFLDSFG TE +    N++   L Q++          D
Sbjct: 565 DLASTTRYVTWSLHNKNRAGLRQFLDSFGGTEHNTTSGNAIGFSLPQDA-----LGGTTD 619

Query: 603 TKPRTDVKLSQVASGVDSSSSVQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHG 662
           TK R+DVKLS +AS +DS SS+QTTE RLADLLD+TLWNR+LAPSSERIVYALVQQIF G
Sbjct: 620 TKSRSDVKLSHLASNIDSGSSIQTTEMRLADLLDSTLWNRKLAPSSERIVYALVQQIFQG 679

Query: 663 IREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSD 722
           IREYFLASAELKFNCFLLMP+VDKLPALLRE+LE+AFE DLD++FDITNLR SL Q+K  
Sbjct: 680 IREYFLASAELKFNCFLLMPIVDKLPALLREELENAFEDDLDSIFDITNLRQSLDQKKRS 739

Query: 723 TEIEMKRIKKLKEKFKLIHEQFISHHVMSSLSLAPS 758
           TEIE++RIK++KEKF++++E+  SH    +L  APS
Sbjct: 740 TEIELRRIKRIKEKFRVMNEKLNSHEFAQNLK-APS 774
Probable GTPase component of both plastid and peroxisme division machinery. Required for the last steps of plastid division specifically in mesophyll-cell, when the narrow isthmus breaks, facilitating the separation of the daughter plastids. Necessary for peroxisome activities. Seems to influence stromule (stroma-filled tubular extensions of the plastid envelope membrane) length and frequency.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: 5
>sp|Q55AX0|DLPC_DICDI Dynamin-like protein C OS=Dictyostelium discoideum GN=dlpC PE=2 SV=2 Back     alignment and function description
>sp|F4HPR5|DRP5A_ARATH Dynamin-related protein 5A OS=Arabidopsis thaliana GN=DRP5A PE=2 SV=1 Back     alignment and function description
>sp|Q55F94|DLPA_DICDI Dynamin-like protein A OS=Dictyostelium discoideum GN=dlpA PE=2 SV=1 Back     alignment and function description
>sp|Q54MH8|DLPB_DICDI Dynamin-like protein B OS=Dictyostelium discoideum GN=dlpB PE=2 SV=1 Back     alignment and function description
>sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 Back     alignment and function description
>sp|Q39821|SDLCA_SOYBN Dynamin-related protein 12A OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|P42697|DRP1A_ARATH Dynamin-related protein 1A OS=Arabidopsis thaliana GN=DRP1A PE=1 SV=3 Back     alignment and function description
>sp|Q39828|SDL5A_SOYBN Dynamin-related protein 5A OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q9N0Y2|MX2_CANFA Interferon-induced GTP-binding protein Mx2 OS=Canis familiaris GN=MX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query759
225447799773 PREDICTED: dynamin-like protein ARC5 [Vi 0.984 0.966 0.878 0.0
347596005762 ARC5 protein [Manihot esculenta] 0.978 0.975 0.864 0.0
255575398765 GTP binding protein, putative [Ricinus c 0.974 0.967 0.858 0.0
356524868751 PREDICTED: dynamin-like protein ARC5-lik 0.973 0.984 0.827 0.0
449438153771 PREDICTED: dynamin-like protein ARC5-lik 0.973 0.958 0.840 0.0
42565028777 protein ARC5 [Arabidopsis thaliana] gi|3 0.985 0.962 0.792 0.0
297834888774 hypothetical protein ARALYDRAFT_479490 [ 0.984 0.965 0.789 0.0
30349146777 dynamin-like protein [Arabidopsis thalia 0.985 0.962 0.788 0.0
296081485672 unnamed protein product [Vitis vinifera] 0.876 0.989 0.837 0.0
42570477741 protein ARC5 [Arabidopsis thaliana] gi|3 0.938 0.960 0.775 0.0
>gi|225447799|ref|XP_002266729.1| PREDICTED: dynamin-like protein ARC5 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1348 bits (3489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/750 (87%), Positives = 697/750 (92%), Gaps = 3/750 (0%)

Query: 4   LYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPIT 63
           LYEAYNELHGLAQE ETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPIT
Sbjct: 20  LYEAYNELHGLAQEFETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPIT 79

Query: 64  LHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEII 123
           LHMKY+P CE PLCHL S D DPT+ QE SLQEIQ++IEAENMRLERE    QFSAKEII
Sbjct: 80  LHMKYDPDCEAPLCHLLS-DSDPTVPQEMSLQEIQAYIEAENMRLEREPC--QFSAKEII 136

Query: 124 IKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCS 183
           I+VE+KYCPNLTIIDTPGL+APAPGRKNRALQ QARAVESLVRAKMQH+EFIILCLEDCS
Sbjct: 137 IRVEYKYCPNLTIIDTPGLVAPAPGRKNRALQSQARAVESLVRAKMQHKEFIILCLEDCS 196

Query: 184 DWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGS 243
           DWSNATTRRVVMQIDPEL RT+IVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILG S
Sbjct: 197 DWSNATTRRVVMQIDPELSRTVIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGDS 256

Query: 244 PFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVSK 303
           PFFTSVPSGRVG+G +S+Y SN+EFKQAI +REMEDI SLEEKLGR LS+QERSRIGVSK
Sbjct: 257 PFFTSVPSGRVGSGPESIYRSNDEFKQAILLREMEDIASLEEKLGRLLSEQERSRIGVSK 316

Query: 304 LRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHDL 363
           LR FLEELLQKRYMDSVP+IIPLLEKEY  TTRKLN++N+ELSTLDE KLKEKGR FHDL
Sbjct: 317 LRLFLEELLQKRYMDSVPLIIPLLEKEYRGTTRKLNDLNRELSTLDEAKLKEKGRTFHDL 376

Query: 364 FLTKLSLLLKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQY 423
           FLTKLSLLLKGTVVAPP+KFGETLQ+ER+NGGAFVGTDGLQFP KLIPNAGMRLYGGAQY
Sbjct: 377 FLTKLSLLLKGTVVAPPEKFGETLQDERVNGGAFVGTDGLQFPQKLIPNAGMRLYGGAQY 436

Query: 424 HRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLH 483
           HRAMAEFRF+VGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLH
Sbjct: 437 HRAMAEFRFVVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFLH 496

Query: 484 QLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMED 543
           QLGCRLLHILKRLLPIS++LLQK+GEYLSGHEVFLRRVASAFNNFAESTER C EKCMED
Sbjct: 497 QLGCRLLHILKRLLPISVFLLQKDGEYLSGHEVFLRRVASAFNNFAESTERECHEKCMED 556

Query: 544 LVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHDT 603
           LVSTTRYVTWSLHNKNRAGLRQFLDSFG TEQSA   NS+S  L QESSF SV N+K D 
Sbjct: 557 LVSTTRYVTWSLHNKNRAGLRQFLDSFGGTEQSAASGNSISAGLAQESSFGSVTNDKQDI 616

Query: 604 KPRTDVKLSQVASGVDSSSSVQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGI 663
           KP+ DVKLS +ASG+DS++  QTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGI
Sbjct: 617 KPKADVKLSHLASGIDSATCAQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGI 676

Query: 664 REYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSDT 723
           REYFLASAELKFNCFLLMPVVDKLPALLREDLESAFE DLDNVFDITNLRHSL  +K DT
Sbjct: 677 REYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEDDLDNVFDITNLRHSLGVRKRDT 736

Query: 724 EIEMKRIKKLKEKFKLIHEQFISHHVMSSL 753
           EIE+KRI++LKEKF+ IHEQ   H VMS L
Sbjct: 737 EIELKRIQRLKEKFRQIHEQLCLHQVMSKL 766

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|347596005|gb|AEP13980.1| ARC5 protein [Manihot esculenta] Back     alignment and taxonomy information
>gi|255575398|ref|XP_002528601.1| GTP binding protein, putative [Ricinus communis] gi|223531946|gb|EEF33759.1| GTP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356524868|ref|XP_003531050.1| PREDICTED: dynamin-like protein ARC5-like [Glycine max] Back     alignment and taxonomy information
>gi|449438153|ref|XP_004136854.1| PREDICTED: dynamin-like protein ARC5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|42565028|ref|NP_188606.2| protein ARC5 [Arabidopsis thaliana] gi|327507753|sp|Q84N64.2|ARC5_ARATH RecName: Full=Dynamin-like protein ARC5; AltName: Full=Dynamin-related protein 5B; AltName: Full=Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 5 gi|332642758|gb|AEE76279.1| protein ARC5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834888|ref|XP_002885326.1| hypothetical protein ARALYDRAFT_479490 [Arabidopsis lyrata subsp. lyrata] gi|297331166|gb|EFH61585.1| hypothetical protein ARALYDRAFT_479490 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30349146|gb|AAO89221.1| dynamin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296081485|emb|CBI20008.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42570477|ref|NP_850615.2| protein ARC5 [Arabidopsis thaliana] gi|332642759|gb|AEE76280.1| protein ARC5 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query759
TAIR|locus:2091226777 ARC5 "ACCUMULATION AND REPLICA 0.985 0.962 0.756 3.2e-303
TAIR|locus:2037026817 DRP5A "Dynamin related protein 0.766 0.712 0.280 3.9e-55
DICTYBASE|DDB_G0268592893 dlpA "dynamin like protein" [D 0.749 0.637 0.263 2.5e-45
DICTYBASE|DDB_G0271628904 dlpC "dynamin like protein" [D 0.401 0.337 0.302 1.1e-40
DICTYBASE|DDB_G0285931808 dlpB "dynamin like protein" [D 0.620 0.582 0.238 3.7e-29
DICTYBASE|DDB_G0277849853 dymA "dynamin like protein" [D 0.271 0.241 0.296 1.8e-13
FB|FBgn0026479735 Drp1 "Dynamin related protein 0.271 0.280 0.269 2.2e-11
WB|WBGene00001134964 eat-3 [Caenorhabditis elegans 0.320 0.252 0.270 6.1e-11
TAIR|locus:2076780610 DL1B "DYNAMIN-like 1B" [Arabid 0.263 0.327 0.298 1.2e-10
TAIR|locus:2165805610 DL1 "dynamin-like protein" [Ar 0.247 0.308 0.304 2e-10
TAIR|locus:2091226 ARC5 "ACCUMULATION AND REPLICATION OF CHLOROPLAST 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2910 (1029.4 bits), Expect = 3.2e-303, P = 3.2e-303
 Identities = 572/756 (75%), Positives = 633/756 (83%)

Query:     3 SLYEAYNELHGLAQELETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPI 62
             SLYEAYNELH LAQELETPF+APAVLVVG QTDGKSALVEALMGFQFNHVGGGTKTRRPI
Sbjct:    27 SLYEAYNELHALAQELETPFEAPAVLVVGQQTDGKSALVEALMGFQFNHVGGGTKTRRPI 86

Query:    63 TLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEI 122
             TLHMKY+P C+ PLCHL S D DP+++  KSL +IQ++IEAENMRLE+E  S  FSAKEI
Sbjct:    87 TLHMKYDPQCQFPLCHLGSDD-DPSVSLPKSLSQIQAYIEAENMRLEQEPCS-PFSAKEI 144

Query:   123 IIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDC 182
             I+KV++KYCPNLTIIDTPGLIAPAPG KNRALQ QARAVE+LVRAKMQH+EFIILCLED 
Sbjct:   145 IVKVQYKYCPNLTIIDTPGLIAPAPGLKNRALQVQARAVEALVRAKMQHKEFIILCLEDS 204

Query:   183 SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGG 242
             SDWS ATTRR+VMQ+DPEL RTI+VSTKLDTKIPQF+ +SDVEVFLSPPA  LD  +LG 
Sbjct:   205 SDWSIATTRRIVMQVDPELSRTIVVSTKLDTKIPQFSCSSDVEVFLSPPASALDSSLLGD 264

Query:   243 SPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRIGVS 302
             SPFFTSVPSGRVG G DSVY SN+EFKQA+ +REMEDI SLE+KLGR L+KQE+SRIG+S
Sbjct:   265 SPFFTSVPSGRVGYGQDSVYKSNDEFKQAVSLREMEDIASLEKKLGRLLTKQEKSRIGIS 324

Query:   303 KLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKEKGRVFHD 362
             KLR FLEELL KRY +SVP+IIPLL KEY ST RKL+ ++KELS+LDE KLKE+GR FHD
Sbjct:   325 KLRLFLEELLWKRYKESVPLIIPLLGKEYRSTVRKLDTVSKELSSLDEAKLKERGRTFHD 384

Query:   363 XXXXXXXXXXKGTVVAPPDKFGETLQNERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQ 422
                       KGTVVAPPDKFGETLQ+ER  GGAFVGTDGLQF HKLIPNAGMRLYGGAQ
Sbjct:   385 LFLTKLSLLLKGTVVAPPDKFGETLQDERTQGGAFVGTDGLQFSHKLIPNAGMRLYGGAQ 444

Query:   423 YHRAMAEFRFMVGGIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARDTFEPFL 482
             YHRAMAEFRF+VG IKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKAR+TFEPFL
Sbjct:   445 YHRAMAEFRFLVGAIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARETFEPFL 504

Query:   483 HQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCME 542
             HQLG RLLHILKRLLPIS+YLLQKEGEYLSGHEVFL+RVASAFN+F ESTE++CR+KCME
Sbjct:   505 HQLGARLLHILKRLLPISVYLLQKEGEYLSGHEVFLKRVASAFNSFVESTEKSCRDKCME 564

Query:   543 DLVSTTRYVTWSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHD 602
             DL STTRYVTWSLHNKNRAGLRQFLDSFG TE +    N++   L Q++          D
Sbjct:   565 DLASTTRYVTWSLHNKNRAGLRQFLDSFGGTEHNTTSGNAIGFSLPQDA-----LGGTTD 619

Query:   603 TKPRTDVKLXXXXXXXXXXXXXQTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHG 662
             TK R+DVKL             QTTE RLADLLD+TLWNR+LAPSSERIVYALVQQIF G
Sbjct:   620 TKSRSDVKLSHLASNIDSGSSIQTTEMRLADLLDSTLWNRKLAPSSERIVYALVQQIFQG 679

Query:   663 IREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLDNVFDITNLRHSLSQQKSD 722
             IREYFLASAELKFNCFLLMP+VDKLPALLRE+LE+AFE DLD++FDITNLR SL Q+K  
Sbjct:   680 IREYFLASAELKFNCFLLMPIVDKLPALLREELENAFEDDLDSIFDITNLRQSLDQKKRS 739

Query:   723 TXXXXXXXXXXXXXXXXXHEQFISHHVMSSLSLAPS 758
             T                 +E+  SH    +L  APS
Sbjct:   740 TEIELRRIKRIKEKFRVMNEKLNSHEFAQNLK-APS 774
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005739 "mitochondrion" evidence=ISM
GO:0010020 "chloroplast fission" evidence=IMP
GO:0009707 "chloroplast outer membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005777 "peroxisome" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0016559 "peroxisome fission" evidence=IMP
GO:0042802 "identical protein binding" evidence=IDA
GO:0007623 "circadian rhythm" evidence=IEP
TAIR|locus:2037026 DRP5A "Dynamin related protein 5A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268592 dlpA "dynamin like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271628 dlpC "dynamin like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285931 dlpB "dynamin like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277849 dymA "dynamin like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0026479 Drp1 "Dynamin related protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001134 eat-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2076780 DL1B "DYNAMIN-like 1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165805 DL1 "dynamin-like protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84N64ARC5_ARATH3, ., 6, ., 5, ., 50.79230.98550.9626yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 9e-63
pfam00350168 pfam00350, Dynamin_N, Dynamin family 3e-35
smart00053240 smart00053, DYNc, Dynamin, GTPase 5e-16
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information 
 Score =  211 bits (539), Expect = 9e-63
 Identities = 77/305 (25%), Positives = 135/305 (44%), Gaps = 32/305 (10%)

Query: 22  FDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLAS 81
            D P ++VVG Q+ GKS+++EAL+G  F   G G  TRRP+ L ++ +P           
Sbjct: 1   IDLPQIVVVGDQSSGKSSVLEALVGRDFLPRGSGICTRRPLELQLRRSPSESDEDEKEEW 60

Query: 82  SDVDPTLAQEKSL-QEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTP 140
            +     ++E +  +E++  IE E  R+     +   S + I +++E    PNLT++D P
Sbjct: 61  GEFLHLKSKEFTDFEELREEIEKETDRVAG--ENKGISPEPIRLEIESPDVPNLTLVDLP 118

Query: 141 GLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLEDCS-DWSNATTRRVVMQIDP 199
           GLI    G +   +++Q   + S+V++ + +   IIL +   + D +N+   ++  ++DP
Sbjct: 119 GLIKVPVGDQPEDIEEQ---IRSMVKSYISNPRSIILAVVPANVDLANSEALKLAREVDP 175

Query: 200 ELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHD 259
           E +RTI V TKLD   P       + +            ++     +  V +        
Sbjct: 176 EGERTIGVLTKLDLMDPGTDAEDILLLLQGK--------VIPLKLGYVGVVNRSQKDIDS 227

Query: 260 SVYSSNEEFKQAIFIREMEDITSLEEKL---GRSLSKQERSRIGVSKLRSFLEELLQKRY 316
                            +E+    EE+             SR+G   LR  L +LLQK  
Sbjct: 228 GK--------------SIEEALEAEEEFFETHPWYKLLPASRVGTPALRKRLSKLLQKHI 273

Query: 317 MDSVP 321
            +S+P
Sbjct: 274 RESLP 278

The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner. Length = 278
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 759
KOG0446657 consensus Vacuolar sorting protein VPS1, dynamin, 100.0
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 100.0
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 99.97
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.87
PF01031295 Dynamin_M: Dynamin central region; InterPro: IPR00 99.84
PRK09866741 hypothetical protein; Provisional 99.43
COG0218200 Predicted GTPase [General function prediction only 99.37
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.93
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.89
COG3596296 Predicted GTPase [General function prediction only 98.86
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.85
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.85
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.84
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.82
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.81
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.77
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.77
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.76
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.75
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.73
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.73
PRK00089292 era GTPase Era; Reviewed 98.71
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.68
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.66
COG1160444 Predicted GTPases [General function prediction onl 98.64
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.64
PRK11058426 GTPase HflX; Provisional 98.64
PRK04213201 GTP-binding protein; Provisional 98.63
cd00881189 GTP_translation_factor GTP translation factor fami 98.61
COG1084346 Predicted GTPase [General function prediction only 98.59
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.58
PRK03003472 GTP-binding protein Der; Reviewed 98.58
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.54
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.53
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.53
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.51
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.51
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.51
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.5
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.5
COG1159298 Era GTPase [General function prediction only] 98.49
PRK00093435 GTP-binding protein Der; Reviewed 98.48
PRK00093435 GTP-binding protein Der; Reviewed 98.48
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.48
PRK12298390 obgE GTPase CgtA; Reviewed 98.45
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.43
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.41
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.38
COG0486454 ThdF Predicted GTPase [General function prediction 98.38
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.37
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.36
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.36
PRK12297424 obgE GTPase CgtA; Reviewed 98.35
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.35
PRK15494339 era GTPase Era; Provisional 98.35
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.35
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.33
PRK12299335 obgE GTPase CgtA; Reviewed 98.33
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.33
COG1160444 Predicted GTPases [General function prediction onl 98.32
PRK03003472 GTP-binding protein Der; Reviewed 98.32
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.32
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.32
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.32
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.31
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.3
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.29
PRK12296500 obgE GTPase CgtA; Reviewed 98.28
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.28
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.28
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.27
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.27
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.26
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.26
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.26
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.25
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.25
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.24
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.23
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.23
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.23
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.21
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.21
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.2
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.2
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.2
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.2
CHL00189742 infB translation initiation factor 2; Provisional 98.19
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.18
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.18
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.17
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.17
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.17
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.16
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 98.16
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.14
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.14
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.12
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.11
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.11
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.1
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.1
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.1
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.09
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.08
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.07
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.07
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.06
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.06
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.06
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.05
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.05
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.05
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.05
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.05
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.04
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.03
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.03
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.03
PRK05306787 infB translation initiation factor IF-2; Validated 98.03
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.02
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.02
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.02
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.01
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.01
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.01
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.01
PRK04004586 translation initiation factor IF-2; Validated 98.0
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.0
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.0
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.0
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.99
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.99
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.98
PLN03127447 Elongation factor Tu; Provisional 97.98
PLN03108210 Rab family protein; Provisional 97.98
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.98
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.97
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.97
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.96
TIGR00475581 selB selenocysteine-specific elongation factor Sel 97.95
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.95
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.94
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.92
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.92
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 97.91
KOG2486320 consensus Predicted GTPase [General function predi 97.9
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.9
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.89
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 97.88
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.87
PLN03118211 Rab family protein; Provisional 97.87
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.86
cd01896233 DRG The developmentally regulated GTP-binding prot 97.86
CHL00071409 tufA elongation factor Tu 97.86
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.85
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 97.85
PLN03110216 Rab GTPase; Provisional 97.85
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.83
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.83
COG1100219 GTPase SAR1 and related small G proteins [General 97.82
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.82
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.82
PLN00223181 ADP-ribosylation factor; Provisional 97.82
COG2262411 HflX GTPases [General function prediction only] 97.82
cd04105203 SR_beta Signal recognition particle receptor, beta 97.82
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.81
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 97.8
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 97.79
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.79
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.79
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 97.78
PRK00049396 elongation factor Tu; Reviewed 97.78
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.78
PTZ00369189 Ras-like protein; Provisional 97.77
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.74
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.73
PTZ00133182 ADP-ribosylation factor; Provisional 97.72
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.72
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.71
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.71
PRK10218607 GTP-binding protein; Provisional 97.7
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 97.7
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 97.68
TIGR00485394 EF-Tu translation elongation factor TU. This align 97.68
PRK12739691 elongation factor G; Reviewed 97.68
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.67
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.67
TIGR00484689 EF-G translation elongation factor EF-G. After pep 97.66
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.66
PRK12736394 elongation factor Tu; Reviewed 97.65
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.65
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 97.64
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.64
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.63
PRK12735396 elongation factor Tu; Reviewed 97.62
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.62
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.6
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.59
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.58
PLN03126478 Elongation factor Tu; Provisional 97.58
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.56
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 97.55
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 97.54
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 97.54
PRK00741526 prfC peptide chain release factor 3; Provisional 97.54
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.53
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 97.53
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.52
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.52
PRK12317425 elongation factor 1-alpha; Reviewed 97.52
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.52
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 97.51
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.5
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.49
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.49
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 97.48
PRK00007693 elongation factor G; Reviewed 97.48
PRK05433600 GTP-binding protein LepA; Provisional 97.47
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.46
COG2229187 Predicted GTPase [General function prediction only 97.46
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.42
PTZ00258390 GTP-binding protein; Provisional 97.42
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 97.36
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.36
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.35
PRK09602396 translation-associated GTPase; Reviewed 97.35
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.35
PRK13351687 elongation factor G; Reviewed 97.31
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 97.31
TIGR00503527 prfC peptide chain release factor 3. This translat 97.31
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.3
PRK04000411 translation initiation factor IF-2 subunit gamma; 97.28
PRK09601364 GTP-binding protein YchF; Reviewed 97.28
COG5019373 CDC3 Septin family protein [Cell division and chro 97.25
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.2
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 97.17
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.16
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.1
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 97.09
PRK07560731 elongation factor EF-2; Reviewed 97.08
PTZ00141446 elongation factor 1- alpha; Provisional 97.07
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.01
PRK13768253 GTPase; Provisional 97.0
PTZ00416 836 elongation factor 2; Provisional 96.96
PLN00043447 elongation factor 1-alpha; Provisional 96.87
KOG1489366 consensus Predicted GTP-binding protein (ODN super 96.81
PF00025175 Arf: ADP-ribosylation factor family The prints ent 96.79
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 96.75
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 96.67
PLN00023334 GTP-binding protein; Provisional 96.65
PRK09435332 membrane ATPase/protein kinase; Provisional 96.64
PRK12740668 elongation factor G; Reviewed 96.55
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 96.54
PF09439181 SRPRB: Signal recognition particle receptor beta s 96.52
PRK10416318 signal recognition particle-docking protein FtsY; 96.46
COG1163365 DRG Predicted GTPase [General function prediction 96.36
PRK14974336 cell division protein FtsY; Provisional 96.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.26
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 96.26
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.21
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.21
TIGR00064272 ftsY signal recognition particle-docking protein F 96.19
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 96.19
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 96.11
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 96.11
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 96.09
PRK00771437 signal recognition particle protein Srp54; Provisi 96.09
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 96.04
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.01
PRK13796365 GTPase YqeH; Provisional 95.99
COG1161322 Predicted GTPases [General function prediction onl 95.99
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.95
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.93
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 95.9
PRK10867433 signal recognition particle protein; Provisional 95.81
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 95.74
cd03114148 ArgK-like The function of this protein family is u 95.7
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.65
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.58
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.56
KOG0446657 consensus Vacuolar sorting protein VPS1, dynamin, 95.5
COG4917148 EutP Ethanolamine utilization protein [Amino acid 95.47
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 95.45
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.32
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 95.28
TIGR00959428 ffh signal recognition particle protein. This mode 95.28
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.2
cd03115173 SRP The signal recognition particle (SRP) mediates 95.1
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.06
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.81
KOG0078207 consensus GTP-binding protein SEC4, small G protei 94.77
KOG0395196 consensus Ras-related GTPase [General function pre 94.76
COG0536369 Obg Predicted GTPase [General function prediction 94.63
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 94.57
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 94.55
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 94.54
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 94.47
PRK148451049 translation initiation factor IF-2; Provisional 94.44
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.4
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 94.39
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 94.29
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 94.15
KOG1145683 consensus Mitochondrial translation initiation fac 93.87
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 93.73
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.69
PRK09563287 rbgA GTPase YlqF; Reviewed 93.62
PF1355562 AAA_29: P-loop containing region of AAA domain 93.57
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.44
PRK12289352 GTPase RsgA; Reviewed 93.16
KOG2203772 consensus GTP-binding protein [General function pr 93.04
COG1101263 PhnK ABC-type uncharacterized transport system, AT 92.64
KOG0458603 consensus Elongation factor 1 alpha [Translation, 92.55
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.54
PRK12288347 GTPase RsgA; Reviewed 92.53
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 92.48
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 92.48
KOG0091213 consensus GTPase Rab39, small G protein superfamil 92.46
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 92.46
COG0480697 FusA Translation elongation factors (GTPases) [Tra 92.31
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 92.27
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 92.25
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 92.15
KOG0093193 consensus GTPase Rab3, small G protein superfamily 92.09
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 92.02
KOG0090238 consensus Signal recognition particle receptor, be 91.97
PRK00098298 GTPase RsgA; Reviewed 91.93
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 91.92
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 91.88
COG1136226 SalX ABC-type antimicrobial peptide transport syst 91.84
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 91.62
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 91.4
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 91.31
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 91.24
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 91.21
KOG0410410 consensus Predicted GTP binding protein [General f 91.18
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 91.17
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.13
COG3910233 Predicted ATPase [General function prediction only 91.12
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 91.11
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 91.07
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 91.04
cd03215182 ABC_Carb_Monos_II This family represents domain II 91.03
COG3276447 SelB Selenocysteine-specific translation elongatio 91.03
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 91.01
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 90.99
COG4559259 ABC-type hemin transport system, ATPase component 90.95
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 90.92
PRK00300205 gmk guanylate kinase; Provisional 90.89
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 90.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 90.88
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 90.81
KOG3883198 consensus Ras family small GTPase [Signal transduc 90.81
cd03269210 ABC_putative_ATPase This subfamily is involved in 90.81
KOG0095213 consensus GTPase Rab30, small G protein superfamil 90.73
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 90.72
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 90.7
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 90.7
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 90.69
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 90.69
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 90.68
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 90.6
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 90.59
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 90.58
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 90.55
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 90.54
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 90.51
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.48
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 90.45
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 90.41
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 90.39
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 90.35
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 90.33
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 90.31
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 90.29
PRK14738206 gmk guanylate kinase; Provisional 90.28
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 90.27
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 90.26
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 90.24
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 90.22
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 90.2
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.13
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 90.09
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.06
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 90.06
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 90.04
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 89.97
cd03246173 ABCC_Protease_Secretion This family represents the 89.96
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 89.94
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 89.93
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 89.92
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 89.83
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 89.74
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 89.73
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 89.71
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 89.68
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 89.66
COG4525259 TauB ABC-type taurine transport system, ATPase com 89.65
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 89.61
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 89.6
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 89.6
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 89.59
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 89.55
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 89.54
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 89.53
KOG0098216 consensus GTPase Rab2, small G protein superfamily 89.53
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 89.52
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 89.52
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 89.52
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 89.47
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 89.45
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 89.45
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 89.42
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 89.39
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 89.33
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 89.32
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 89.32
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 89.3
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 89.3
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 89.25
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 89.25
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 89.25
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 89.22
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 89.2
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 89.16
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 89.09
COG1162301 Predicted GTPases [General function prediction onl 89.0
KOG0780483 consensus Signal recognition particle, subunit Srp 88.99
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 88.97
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 88.97
PRK10619257 histidine/lysine/arginine/ornithine transporter su 88.97
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 88.96
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 88.95
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 88.94
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 88.93
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 88.91
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 88.9
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 88.88
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 88.85
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 88.78
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 88.73
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 88.73
PRK10908222 cell division protein FtsE; Provisional 88.71
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 88.67
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 88.65
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 88.63
PRK14240250 phosphate transporter ATP-binding protein; Provisi 88.59
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 88.57
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 88.5
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 88.49
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 88.42
COG1341398 Predicted GTPase or GTP-binding protein [General f 88.39
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 88.39
PRK13851344 type IV secretion system protein VirB11; Provision 88.39
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 88.35
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 88.3
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 88.3
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 88.25
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 88.24
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 88.2
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 88.19
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 88.19
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 88.17
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 88.14
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 88.11
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 88.1
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 88.07
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 88.06
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 88.03
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 88.02
PRK03695248 vitamin B12-transporter ATPase; Provisional 88.02
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 88.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 87.98
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 87.97
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 87.97
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 87.96
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 87.95
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 87.85
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 87.82
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 87.82
KOG0079198 consensus GTP-binding protein H-ray, small G prote 87.82
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 87.75
PRK09580248 sufC cysteine desulfurase ATPase component; Review 87.74
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 87.7
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 87.7
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 87.66
PRK14242253 phosphate transporter ATP-binding protein; Provisi 87.61
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 87.6
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 87.58
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 87.55
PRK14241258 phosphate transporter ATP-binding protein; Provisi 87.51
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 87.5
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 87.48
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 87.47
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 87.38
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 87.37
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 87.36
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 87.36
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 87.36
PRK09984262 phosphonate/organophosphate ester transporter subu 87.34
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2e-59  Score=544.06  Aligned_cols=628  Identities=19%  Similarity=0.185  Sum_probs=480.3

Q ss_pred             CccHHHHHHHHHHhhhhcC--CCCCCCEEEEEeccCCchHHHHHHHhCCccceecCccccccceEEEEeeCCCCCCCceE
Q 004351            1 MHSLYEAYNELHGLAQELE--TPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCH   78 (759)
Q Consensus         1 m~~L~~~~n~L~~l~~~~~--~~i~lPqIVVVG~QSsGKSSLLEAL~G~~fp~~g~g~cTR~P~~l~l~~~~~~~~~~~~   78 (759)
                      |+.+++.+|+||+....++  ..+++|+|||||+||+|||||||+|+|+.|.|||.|+|||||++++|.+......|.+.
T Consensus         4 ~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~~~   83 (657)
T KOG0446|consen    4 MRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEEAS   83 (657)
T ss_pred             hhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCcccchh
Confidence            7889999999999988775  56999999999999999999999999999999999999999999999998765445555


Q ss_pred             EecCCCCCCcccccChHHHHHHHHHHHhhhhhccCCCccccceEEEEEEecCCCCcEEEeCCCCcCCCCCCCchhhHHHH
Q 004351           79 LASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQA  158 (759)
Q Consensus        79 i~~~d~~~~~~~~~~~~~l~~~Ie~~~~~l~~~~~~~~fS~d~I~leI~~p~~p~LtLVDLPGl~~~~~~~q~~~~e~~~  158 (759)
                      +...+   ......|++++++.|+.+++++.|.+  +++|+.+|.|+|.+|++++||+|||||++.+++++||++++   
T Consensus        84 f~~h~---~~~~~~D~~~vrkeI~~et~~~~g~~--kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~---  155 (657)
T KOG0446|consen   84 FLTHD---KKKRFTDFEEVRKEIRSETDRITGSN--KGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIE---  155 (657)
T ss_pred             ccccc---cccccCCHHHHHHHHHhhHHHhcCCC--CCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHH---
Confidence            54322   45677899999999999999999876  89999999999999999999999999999999999998774   


Q ss_pred             HHHHHHHHHHhcCccceeEeeccc-CCcCcHHHHHHHHHhCcCCCeEEEEecCCCcccccccChhhHHHhhCCCCCCCCc
Q 004351          159 RAVESLVRAKMQHREFIILCLEDC-SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDG  237 (759)
Q Consensus       159 ~~v~~lv~~Yi~~~~~IIL~V~~~-~D~~~~~~l~lar~~Dp~g~RTIgVlTK~D~~~~~~~~~~~~~~~L~~~~~~l~~  237 (759)
                      .++++|++.|++++++|||+|.++ .|++|++++++|+++||.|.|||||+||+|++    ++|+++...|.|+.   .+
T Consensus       156 ~qI~~mi~~yi~~~~~iILav~~an~d~ats~alkiarevDp~g~RTigvitK~Dlm----dkGt~~~~~L~g~~---~~  228 (657)
T KOG0446|consen  156 EEIKSMIEEYIEKPNRIILAVTPANSDIATSPALVVAREVDPGGSRTLEVITKFDFM----DKGTNAVTRLVGRP---IT  228 (657)
T ss_pred             HHHHHHHHHhccccchhhhhccchhhhhhcCHHHHHHHhhCCCccchhHHhhhHHhh----hcCCcceeeecCCc---cc
Confidence            678899999999999999999866 79999999999999999999999999999995    66778888888866   34


Q ss_pred             ccccCCCeeeecCCCCccCCCCCCCCCHHHHHHhhhhHHHhHHHHHHHHh--cCCccccccCCcchHHHHHHHHHHHHHH
Q 004351          238 FILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKL--GRSLSKQERSRIGVSKLRSFLEELLQKR  315 (759)
Q Consensus       238 ~~LG~~~ffvs~P~~rvg~~~d~v~rs~~~~~~~~~~~e~~d~~~lE~~f--~~~w~~~~~~r~Gi~~Lr~~Ls~lL~~~  315 (759)
                      +++|   |+..            ++|++.++..+.+..++.   ..|..|  ..+-++....++|+++|.+.|+..|..|
T Consensus       229 l~~g---~v~v------------vnR~q~di~~~k~~~~al---~~e~~~f~~~p~y~~~~~~~g~p~La~~L~~~l~~h  290 (657)
T KOG0446|consen  229 LKVG---YVGV------------VNRSQSIIDFKKSILEAL---NDEVPSFESVPSYPILLTISGVPYLALLLPGYLQSH  290 (657)
T ss_pred             cccc---eeee------------eccchhhhhhhhhHHHHH---HhhhhhhhccccccccccccCcchHHHHHHHHHHHH
Confidence            5554   4432            356677766555443332   234443  6677777777799999999999999999


Q ss_pred             HHhhhhhhHHHHHHHhhhHHHHHHHHHHHHhhcCc--cch--hhhhHHHHHHHHHHHHHhhcccccCCCcccchhhhhhh
Q 004351          316 YMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDE--VKL--KEKGRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQNER  391 (759)
Q Consensus       316 i~~~LP~i~~~L~~e~~~i~~~L~~~~~eL~~Lg~--~~~--~~~~~~~~~~F~~~is~~l~G~~~a~~~~~g~tl~de~  391 (759)
                      |++++|.|...|+       .++.+.+++|.++|.  +..  .......+..|+..+...+.|...              
T Consensus       291 i~~~lP~l~~~i~-------~~~~~~~~el~~~g~~~~~~~~~~~ll~~i~~~~~~~~~~v~g~~~--------------  349 (657)
T KOG0446|consen  291 IRDQLPELKTKIN-------KLLEKYQDELNRIGAVDVDLANSAALLAIIREDPRGLRTGVIGKLD--------------  349 (657)
T ss_pred             HHhcCcHHHHHHH-------HHHHHHHHHHHHhcccCCccchhhHHHHHHHHHHHHHHHhhccccc--------------
Confidence            9999999999885       588999999999995  221  122345578899888888887632              


Q ss_pred             hcCCcccCCCCCCCCcccCCCCcceeechhHHHHHHHHh-h-hhcCcccCCCCCHHHHHHHhCccccCCCCcc--hhhHH
Q 004351          392 INGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEF-R-FMVGGIKCPPITREEIVNACGVEDIHDGTNY--SRTAC  467 (759)
Q Consensus       392 ~~~g~~~~~~G~~~~~~~~p~~~~rL~gGaq~~R~l~Ef-~-~~~~~~~~p~~s~eeia~a~g~~~~~~~~~~--~~aa~  467 (759)
                                +       +|  +-.|.|||...+.++++ . ......++-.++..+|..++-....+.-..|  +.++.
T Consensus       350 ----------~-------~~--~~elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~~lf~p~~afe  410 (657)
T KOG0446|consen  350 ----------L-------VP--TKALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRPSLFVPESSFE  410 (657)
T ss_pred             ----------c-------cc--hhcccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCccccCChHHHH
Confidence                      1       23  44688999999999994 3 3333334445677777776633232222223  88888


Q ss_pred             HHHHHHhhhhhhhhHHHHHHHHHHHHHHHHhHHHHHHHhhccccccchHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhh
Q 004351          468 VIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDLVST  547 (759)
Q Consensus       468 ~ia~~~~~~~~~Pl~~~l~~r~~~il~rl~~i~~~~~~~~~~~~~~~~~f~~~~~~~~~~fv~~~~~~c~~~~~~~l~s~  547 (759)
                      .|+....+..-+|.+.++-    .|.+.+..++...+.+-  .+.+||.+...+.++...|+++.....++++++-.+-.
T Consensus       411 ~lvk~~i~~l~~p~l~~v~----~v~~el~~~~~~~~~~~--~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~i~~e  484 (657)
T KOG0446|consen  411 SLVKGQIQSLRDPSLKCVE----EVHRELVRIVADSIRAT--ELKRFPVLYSELVEIASSLIAEGLDETKKAVKNLIDLE  484 (657)
T ss_pred             HHHHHHHHHHhhhHHHHHH----HHHHHHHHHHHHHhhhH--HHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHH
Confidence            8888888888888886654    46777777777777642  68899999999999999999999999999999777666


Q ss_pred             hhhh-h--hccccccchhhhhhhcccCCccccccccccCCCCcccccccccccCccCCCCCcccccccccccCCCCCCcc
Q 004351          548 TRYV-T--WSLHNKNRAGLRQFLDSFGSTEQSAVLSNSLSMPLCQESSFVSVANEKHDTKPRTDVKLSQVASGVDSSSSV  624 (759)
Q Consensus       548 t~~v-~--w~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  624 (759)
                      ..|+ |  |+..+.    .++.++.....   ++   .+.....   +              .    .        -+..
T Consensus       485 ~~yinT~h~df~~~----~~~al~~~~~~---~~---~~~~~~~---~--------------~----~--------~~~~  525 (657)
T KOG0446|consen  485 QSYLNTDHPDFRSL----TDSALSSVTSP---SI---AAMKLIS---A--------------Q----L--------LKEE  525 (657)
T ss_pred             HHHhcCcChhhhhh----HHHHHHHhhcc---cc---ccccccc---c--------------c----c--------cccc
Confidence            6666 3  444322    21222121100   00   0000000   0              0    0        0111


Q ss_pred             chhhhHHHHhhhhhhhcccCCCccHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcchhhhhhhhhHHHHHHHHhhcccchh
Q 004351          625 QTTETRLADLLDNTLWNRRLAPSSERIVYALVQQIFHGIREYFLASAELKFNCFLLMPVVDKLPALLREDLESAFEGDLD  704 (759)
Q Consensus       625 ~~~~~~~~~~~~~~l~~r~~~~~s~~~V~~l~~~~f~~iR~~~~~~~~~k~n~ffL~P~~~~l~~~l~~~l~~~~~~~~~  704 (759)
                      ..+.....+.+.+..|+..+.+.......+...+.+..+...+.++....|+|+=+++++|..|.+|.-.|...+.++|.
T Consensus       526 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~sY~~iv~~~i~d~vpk~i~~~lv~~~k~~l~  605 (657)
T KOG0446|consen  526 LGECNSALKAIKNAVGSIRLDPSDIVLSRALVLKKRECKETEEISSCPESYLNIVSDKLVDTVPKALNHELLNEFKDDLP  605 (657)
T ss_pred             cccccchhhhhcchhhhhhhcccchhhhhhhhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            22233566777777888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             hhhchhhHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 004351          705 NVFDITNLRHSLSQQKSDTEIEMKRIKKLKEKFKLIHEQFISHH  748 (759)
Q Consensus       705 ~~f~~~~~~~~l~~~~~~l~~~~~~~~~~~~kf~~~~~~l~~~~  748 (759)
                      ..|+..-.+ . .++.++|..|...+++-+++++.--+.|+.+.
T Consensus       606 ~~l~~~L~~-~-~~~~~~ll~E~~~i~~~R~~~~~~l~~L~~a~  647 (657)
T KOG0446|consen  606 NELDQRLYA-G-DEQLESLLKEDPRIKRRRELQQKRLLALQKAL  647 (657)
T ss_pred             HHHHHHHHh-c-hhHHHHHHccCHHHHHHHHHHHHHHHHHHHHH
Confidence            888877666 4 77777777777777777777777666665554

>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
1jwy_B315 Crystal Structure Of The Dynamin A Gtpase Domain Co 2e-15
3t34_A360 Arabidopsis Thaliana Dynamin-Related Protein 1a (At 2e-12
2aka_B299 Structure Of The Nucleotide-Free Myosin Ii Motor Do 1e-11
3zyc_A353 Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gm 1e-11
3zvr_A772 Crystal Structure Of Dynamin Length = 772 2e-11
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 2e-11
2x2e_A353 Dynamin Gtpase Dimer, Long Axis Form Length = 353 3e-11
3szr_A608 Crystal Structure Of Modified Nucleotide-Free Human 5e-11
3zys_B662 Human Dynamin 1 Deltaprd Polymer Stabilized With Gm 5e-11
3l43_A319 Crystal Structure Of The Dynamin 3 Gtpase Domain Bo 7e-11
>pdb|1JWY|B Chain B, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 26/221 (11%)
Query: 4   LYEAYNELHGLAQELET-PFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPI 62
           L    N+L  +   L + P D P ++VVG Q+ GKS+++E ++G  F   G G  TRRP+
Sbjct: 3   LIPVINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPL 62
Query: 63  TLHMKYNPLCELPLCHLASSDVDPTLAQE------KSLQEIQSF--IEAENMR-LERESN 113
            L + + P+ +           D +  QE      K       F  I  E +R  +R + 
Sbjct: 63  ILQLTHLPIAD-----------DGSQTQEWGEFLHKPNDMFYDFSEIREEIIRDTDRMTG 111
Query: 114 SNQ-FSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHR 172
            N+  SA+ I +K+   +  NLT++D PG+     G +   ++ Q R    +V A ++ +
Sbjct: 112 KNKGISAQPINLKIYSPHVVNLTLVDLPGITKVPVGDQPTDIEQQIR---RMVMAYIKKQ 168
Query: 173 EFIILCLEDC-SDWSNATTRRVVMQIDPELKRTIIVSTKLD 212
             II+ +    +D +N+   ++  ++DPE KRTI V TKLD
Sbjct: 169 NAIIVAVTPANTDLANSDALQLAKEVDPEGKRTIGVITKLD 209
>pdb|3T34|A Chain A, Arabidopsis Thaliana Dynamin-Related Protein 1a (Atdrp1a) In Prefission State Length = 360 Back     alignment and structure
>pdb|2AKA|B Chain B, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 299 Back     alignment and structure
>pdb|3ZYC|A Chain A, Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gmppcp Length = 353 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|2X2E|A Chain A, Dynamin Gtpase Dimer, Long Axis Form Length = 353 Back     alignment and structure
>pdb|3SZR|A Chain A, Crystal Structure Of Modified Nucleotide-Free Human Mxa Length = 608 Back     alignment and structure
>pdb|3ZYS|B Chain B, Human Dynamin 1 Deltaprd Polymer Stabilized With Gmppcp Length = 662 Back     alignment and structure
>pdb|3L43|A Chain A, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound With Gdp Length = 319 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query759
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 3e-25
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 3e-24
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 1e-23
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 8e-23
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 3e-22
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 2e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 3e-05
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 9e-05
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
 Score =  107 bits (268), Expect = 3e-25
 Identities = 74/390 (18%), Positives = 145/390 (37%), Gaps = 53/390 (13%)

Query: 1   MHSLYEAYNELHGLAQEL----------ETPFDAPAVLVVGHQTDGKSALVEALMGFQFN 50
           M +L    N++      L                PA+ VVG Q+ GKS+++E+++G  F 
Sbjct: 1   MENLISLVNKIQRACTALGDHGDSSALPTLWDSLPAIAVVGGQSSGKSSVLESIVGKDFL 60

Query: 51  HVGGGTKTRRPITLHMKYNPLCELPLCHLASSDVDPTLAQEKSLQEIQSFIEAENMRLER 110
             G G  TRRP+ L ++     +    +     +     +      ++  I+ E  R   
Sbjct: 61  PRGSGIVTRRPLVLQLQKID--DGTREYAEFLHLPRK--KFTDFAAVRKEIQDETDRE-- 114

Query: 111 ESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQ 170
              S   S+  I + +      NLT+ID PGL   A   ++ ++      +E++VR+ ++
Sbjct: 115 TGRSKAISSVPIHLSIYSPNVVNLTLIDLPGLTKVAVDGQSDSIVKD---IENMVRSYIE 171

Query: 171 HREFIILCLEDCS-DWSNATTRRVVMQIDPELKRTIIVSTKLD-----TKIPQFARASDV 224
               IIL +   + D + +   ++  ++DP   RT  V TK+D     T   +       
Sbjct: 172 KPNCIILAISPANQDLATSDAIKISREVDPSGDRTFGVLTKIDLMDKGTDAVEILEGRSF 231

Query: 225 EVFLSPPACTLDGFILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLE 284
           ++           ++            G V      + + N +   A   R+ E      
Sbjct: 232 KLKY--------PWV------------GVVNRSQADI-NKNVDMIAA---RKREREYFSN 267

Query: 285 EKLGRSLSKQERSRIGVSKLRSFLEELLQKRYMDSVPMIIPLLEKEYCSTTRKLNEINKE 344
               R L+    +++G   L   L + L++     +P I  L+ K       +L+ + K 
Sbjct: 268 TTEYRHLA----NKMGSEHLAKMLSKHLERVIKSRIPGIQSLINKTVLELETELSRLGKP 323

Query: 345 LSTLDEVKLKEKGRVFHDLFLTKLSLLLKG 374
           ++   + ++             +L L    
Sbjct: 324 IAHGTDSRVDPAIMERRSAISKRLELYRAA 353
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query759
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 100.0
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 100.0
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 100.0
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 100.0
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.97
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.97
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.56
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.01
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.0
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.93
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.91
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.86
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.83
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.8
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.73
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.72
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.68
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.67
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.67
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.67
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.66
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.64
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.61
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.58
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.57
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.57
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.55
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.53
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.53
2ged_A193 SR-beta, signal recognition particle receptor beta 98.5
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.5
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.49
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.49
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.48
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.48
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.47
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.47
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.46
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.46
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.44
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.44
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.44
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.44
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.44
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.44
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.43
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.43
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.43
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.43
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.42
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.42
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.42
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.41
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.41
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.41
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.41
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.41
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.4
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.4
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.4
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.4
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.4
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.4
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.4
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.38
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.38
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.38
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.37
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.37
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.37
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.37
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.35
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.34
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.34
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.34
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.33
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.33
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.33
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.32
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.32
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.31
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.31
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.31
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.31
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.31
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.31
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.31
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.31
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.3
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.3
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.3
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.29
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.29
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.28
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.28
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.27
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.27
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.26
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.26
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.26
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.25
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.25
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.25
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.25
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.24
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.22
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.21
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.21
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.21
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.21
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.2
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.2
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.19
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.18
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.16
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.16
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.15
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.15
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.15
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.14
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.14
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.13
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.12
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.11
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.11
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.11
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.09
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.08
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.06
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.05
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.04
3izy_P537 Translation initiation factor IF-2, mitochondrial; 98.04
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.04
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.0
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.98
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.98
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.98
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 97.97
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.97
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 97.96
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.96
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.94
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.94
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.89
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.89
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.11
2elf_A370 Protein translation elongation factor 1A; tRNA, py 97.87
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.87
1wb1_A482 Translation elongation factor SELB; selenocysteine 97.87
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.86
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 97.86
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.85
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.85
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.85
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.84
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.83
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 97.81
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.8
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.79
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 97.78
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.78
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 97.76
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 97.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.75
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 97.75
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.74
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.74
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.72
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.71
2xex_A693 Elongation factor G; GTPase, translation, biosynth 97.69
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.66
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.65
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.65
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.62
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.58
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.56
1f60_A458 Elongation factor EEF1A; protein-protein complex, 97.56
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.55
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.53
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.51
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.5
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.5
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 97.5
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.43
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.41
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 97.41
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 97.39
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 97.39
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.28
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.27
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 97.25
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.21
2dy1_A665 Elongation factor G; translocation, GTP complex, s 97.11
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.08
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.06
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.02
1jal_A363 YCHF protein; nucleotide-binding fold, structural 96.98
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.97
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.91
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.53
2xxa_A433 Signal recognition particle protein; protein trans 96.39
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 96.35
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.22
3vqt_A548 RF-3, peptide chain release factor 3; translation, 96.19
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.07
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.01
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.84
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.73
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 95.4
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 95.01
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 95.0
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.9
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.85
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.77
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 94.44
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 94.06
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.98
2og2_A359 Putative signal recognition particle receptor; nuc 93.47
3cnl_A262 YLQF, putative uncharacterized protein; circular p 93.46
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 93.33
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.16
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 92.85
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.02
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.83
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 91.76
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.59
3kta_A182 Chromosome segregation protein SMC; structural mai 91.44
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.4
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 91.39
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 91.34
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 91.25
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.22
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.17
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.13
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.12
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.11
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 91.07
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.01
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.96
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 90.85
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.79
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 90.72
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.69
1g6h_A257 High-affinity branched-chain amino acid transport 90.68
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.66
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.58
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.52
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.37
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.32
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 90.26
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.2
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.15
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 90.14
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.13
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 90.1
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.05
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.02
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 89.88
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 89.82
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 89.72
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.63
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.54
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 89.53
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.37
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.37
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 89.35
2ghi_A260 Transport protein; multidrug resistance protein, M 89.32
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 89.25
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.12
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 89.09
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 88.91
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.64
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.48
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 88.34
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 88.29
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 88.17
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 88.15
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 88.07
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 87.97
2eyu_A261 Twitching motility protein PILT; pilus retraction 87.74
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 87.59
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 87.54
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.52
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 87.42
1kag_A173 SKI, shikimate kinase I; transferase, structural g 87.41
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 87.21
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.12
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 87.08
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 86.98
4a74_A231 DNA repair and recombination protein RADA; hydrola 86.91
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 86.86
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.85
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 86.59
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.53
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 86.49
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 86.48
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 86.41
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 86.38
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 86.28
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 86.25
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 86.22
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 86.0
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 85.8
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 85.8
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 85.52
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 85.41
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 85.14
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 85.04
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 84.81
1xjc_A169 MOBB protein homolog; structural genomics, midwest 84.77
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 84.35
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 84.35
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 84.33
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 84.27
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 84.09
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 84.07
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.05
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 83.92
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 83.42
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 83.36
1p9r_A418 General secretion pathway protein E; bacterial typ 83.32
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 83.24
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 83.01
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 82.98
2ewv_A372 Twitching motility protein PILT; pilus retraction 82.8
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 82.61
2kjq_A149 DNAA-related protein; solution structure, NESG, st 82.31
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 82.3
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 82.27
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 82.1
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 81.67
4aby_A415 DNA repair protein RECN; hydrolase, double strand 81.37
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 81.36
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 81.33
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 81.05
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 80.94
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 80.84
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 80.84
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 80.75
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 80.74
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 80.68
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 80.58
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 80.48
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 80.39
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 80.29
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 80.26
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 80.25
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 80.23
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 80.2
1e69_A322 Chromosome segregation SMC protein; structural mai 80.11
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 80.04
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 80.01
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 80.01
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
Probab=100.00  E-value=2e-46  Score=442.20  Aligned_cols=469  Identities=20%  Similarity=0.245  Sum_probs=356.1

Q ss_pred             CccHHHHHHHHHHhhhhcC--CCCCCCEEEEEeccCCchHHHHHHHhCCccceecCccccccceEEEEeeCCCCCCCceE
Q 004351            1 MHSLYEAYNELHGLAQELE--TPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCH   78 (759)
Q Consensus         1 m~~L~~~~n~L~~l~~~~~--~~i~lPqIVVVG~QSsGKSSLLEAL~G~~fp~~g~g~cTR~P~~l~l~~~~~~~~~~~~   78 (759)
                      |++|++.||+|++..+.++  ..+++|+|||||+||+|||||||+|+|.+|.|+|.|+|||||+++++.+++.  .|.+.
T Consensus        26 ~~~li~~inkl~d~l~~lg~~~~i~lp~I~vvG~~saGKSSllnaL~g~~~LP~g~g~~Tr~Pl~l~l~~~~~--~~~~~  103 (772)
T 3zvr_A           26 MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTT--EYAEF  103 (772)
T ss_dssp             GGGHHHHHHHHHHHHHTTTCCGGGCCSEEEEEECTTTCHHHHHHHHHSSCCSCCSSSCSCSSCEEEEEEECSS--CEEEC
T ss_pred             HHHHHHHHHHHHHHHHhcCccccCCCCEEEEECCCCCcHHHHHHHHhCCCccCcCCccccccceEEEeecCCc--chhhe
Confidence            7899999999999776665  4699999999999999999999999999997799999999999999999875  23332


Q ss_pred             EecCCCCCCcccccChHHHHHHHHHHHhhhhhccCCCccccceEEEEEEecCCCCcEEEeCCCCcCCCCCCCchhhHHHH
Q 004351           79 LASSDVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQA  158 (759)
Q Consensus        79 i~~~d~~~~~~~~~~~~~l~~~Ie~~~~~l~~~~~~~~fS~d~I~leI~~p~~p~LtLVDLPGl~~~~~~~q~~~~e~~~  158 (759)
                      +..     .+....+++++.+.|+.++..+.+.+  .+|+.++|.++|.+|++++|+||||||++..+.++++.++   .
T Consensus       104 l~~-----~~~~~~~~~~v~~~I~~~~~~~~g~~--~~is~~~i~l~I~~P~~~qL~LVDTPGi~~~~~~~qp~di---~  173 (772)
T 3zvr_A          104 LHC-----KGKKFTDFEEVRLEIEAETDRVTGTN--KGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDI---E  173 (772)
T ss_dssp             STT-----TTCCBCCHHHHHHHHHHHHHHHHCST--TCCCSCCEEEEEEETTCCSEEEEECCCCCCCCSSCCCCHH---H
T ss_pred             ecc-----CCcccCCHHHHHHHHHHHHhhhcCCC--CcccccceEEEEecCCCCceEEEECCCcccCCCCCCcHHH---H
Confidence            211     23566789999999999988887754  6899999999999999999999999999998877777543   4


Q ss_pred             HHHHHHHHHHhcCccceeEeeccc-CCcCcHHHHHHHHHhCcCCCeEEEEecCCCcccccccChhhHHHhhCCCCCCCCc
Q 004351          159 RAVESLVRAKMQHREFIILCLEDC-SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDG  237 (759)
Q Consensus       159 ~~v~~lv~~Yi~~~~~IIL~V~~~-~D~~~~~~l~lar~~Dp~g~RTIgVlTK~D~~~~~~~~~~~~~~~L~~~~~~l~~  237 (759)
                      ..+.+++..|+..+..+||+|+++ .++..++.+.+++.+++.|.++|+|+||+|++.++    .....++.+..   .+
T Consensus       174 ~~i~~lv~~yi~~~aDlIL~VVDAs~~~~~~d~l~ll~~L~~~g~pvIlVlNKiDlv~~~----~~~~~il~~~~---~~  246 (772)
T 3zvr_A          174 FQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEG----TDARDVLENKL---LP  246 (772)
T ss_dssp             HHHHHHHHHHHTSTTEEEEEEEETTSCSSSCHHHHHHHHHCTTCSSEEEEEECTTSSCTT----CCSHHHHTTCS---SC
T ss_pred             HHHHHHHHHHHhcCCcEEEEEEcCCCCcchhHHHHHHHHHHhcCCCEEEEEeCcccCCcc----hhhHHHHHHHh---hh
Confidence            577899999999988999999877 57888888899999999999999999999997543    22344554322   12


Q ss_pred             ccccCCCeeeecCCC-CccCCCCCCCCCHHHHHHhhhhHHHhHHHHHH-HHh-cCCccccccCCcchHHHHHHHHHHHHH
Q 004351          238 FILGGSPFFTSVPSG-RVGTGHDSVYSSNEEFKQAIFIREMEDITSLE-EKL-GRSLSKQERSRIGVSKLRSFLEELLQK  314 (759)
Q Consensus       238 ~~LG~~~ffvs~P~~-rvg~~~d~v~rs~~~~~~~~~~~e~~d~~~lE-~~f-~~~w~~~~~~r~Gi~~Lr~~Ls~lL~~  314 (759)
                      ..+   +|+..+|.. ..|.+       -+++.+.+         ..| ..| .+||+....++.|+..|.+.|.+.|..
T Consensus       247 l~l---g~~~VV~iSA~~G~G-------vdeL~eaI---------~~e~~ffpe~P~yd~ltDr~g~~~LaEiLrEkL~~  307 (772)
T 3zvr_A          247 LRR---GYIGVVNRSQKDIDG-------KKDITAAL---------AAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTN  307 (772)
T ss_dssp             CSS---CEEECCCCCCEESSS-------SEEHHHHH---------HHHHHHHHHCTTTGGGGGGCSHHHHHHHHHHHHHH
T ss_pred             hhc---cCCceEEeccccccc-------chhHHHHH---------HHHHHhccCCcchhhhhhcccHHHHHHHHHHHHHH
Confidence            223   355444321 11211       12333322         112 234 566667788999999999999999999


Q ss_pred             HHHhhhhhhHHHHHHHhhhHHHHHHHHHHHHhhcCccchhh-h-----hHHHHHHHHHHHHHhhcccccCCCcccchhhh
Q 004351          315 RYMDSVPMIIPLLEKEYCSTTRKLNEINKELSTLDEVKLKE-K-----GRVFHDLFLTKLSLLLKGTVVAPPDKFGETLQ  388 (759)
Q Consensus       315 ~i~~~LP~i~~~L~~e~~~i~~~L~~~~~eL~~Lg~~~~~~-~-----~~~~~~~F~~~is~~l~G~~~a~~~~~g~tl~  388 (759)
                      ||+++||.|...|+       .+|..+..+|+++++.+... .     ...++..|++.+.++++|.+..          
T Consensus       308 hi~~ELP~l~~~I~-------~~l~s~~vele~~~~~~~~~~~~~~~~ll~~~~~f~~~~~~~i~G~~~~----------  370 (772)
T 3zvr_A          308 HIRDTLPGLRNKLQ-------SQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ----------  370 (772)
T ss_dssp             HHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHCCCSSSCSHHHHHHHHHHHHHHHHHHHTC--------------
T ss_pred             HHHhhCccHHHHHH-------HHHHHHHHHHHHhCCCCCCChHHHHHHHHHHHHHHHHHHHHHhCCCCCC----------
Confidence            99999999998875       58889999999987665422 1     1235789999999999997520          


Q ss_pred             hhhhcCCcccCCCCCCCCcccCCCCcceeechhHHHHHHHH-hhhhcCcccCCC-CCHHHHHHHhCccccCCCCcc--hh
Q 004351          389 NERINGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAE-FRFMVGGIKCPP-ITREEIVNACGVEDIHDGTNY--SR  464 (759)
Q Consensus       389 de~~~~g~~~~~~G~~~~~~~~p~~~~rL~gGaq~~R~l~E-f~~~~~~~~~p~-~s~eeia~a~g~~~~~~~~~~--~~  464 (759)
                                             -.+..|.|||.++|+++| |......+...+ +++++|..|+-...+.....|  +.
T Consensus       371 -----------------------~~~~el~ggari~~if~~~f~~~~~~~~~~~~~~~~~I~~~i~n~~G~~~~lf~p~~  427 (772)
T 3zvr_A          371 -----------------------IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHDIRTGLFTPDL  427 (772)
T ss_dssp             ----------------------------CCHHHHHHHHHHTHHHHHHHTTSCCHHHHHHHHHHHHHHCC------CHHHH
T ss_pred             -----------------------cCcccCCCCeeeehhHHHHhHHHHhcCCCchhhhHHHHHHHHHhCCCCCCCCCChHH
Confidence                                   013479999999999999 555555544333 578899988855443333334  77


Q ss_pred             hHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHhHHHHHHHhhccccccchHHHHHHHHHHHHHHHHHHHHHHHHhHHhh
Q 004351          465 TACVIAVAKARDTFEPFLHQLGCRLLHILKRLLPISIYLLQKEGEYLSGHEVFLRRVASAFNNFAESTERACREKCMEDL  544 (759)
Q Consensus       465 aa~~ia~~~~~~~~~Pl~~~l~~r~~~il~rl~~i~~~~~~~~~~~~~~~~~f~~~~~~~~~~fv~~~~~~c~~~~~~~l  544 (759)
                      ++..|++.++++|-+|.+.|+-.    |...|..++..+.    ..+.+||.+..++.++...++++.+..|++.+..=.
T Consensus       428 ~fe~LVk~QI~rl~ePsl~CVdl----V~~eL~~iv~~~~----~~l~RfP~Lr~ei~~iv~~~Lre~~~~t~~~V~~LI  499 (772)
T 3zvr_A          428 AFEATVKKQVQKLKEPSIKCVDM----VVSELTSTIRKCS----EKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLI  499 (772)
T ss_dssp             HHHHHHHHHHHTTHHHHHHHHHH----HHHHHHHHHHHHG----GGGTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH----HHhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            78889999999999998876542    3555555555543    468999999999999999999999999999999877


Q ss_pred             hhhhhhhhhcc
Q 004351          545 VSTTRYVTWSL  555 (759)
Q Consensus       545 ~s~t~~v~w~l  555 (759)
                      +.-..||+-+-
T Consensus       500 d~E~ayintnH  510 (772)
T 3zvr_A          500 DIELAYMNTNH  510 (772)
T ss_dssp             HHHHTCCCTTC
T ss_pred             HHhcCCCCCCC
Confidence            77788888776
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 759
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 4e-43
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 2e-40
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

 Score =  156 bits (395), Expect = 4e-43
 Identities = 74/330 (22%), Positives = 143/330 (43%), Gaps = 31/330 (9%)

Query: 3   SLYEAYNELHGLAQELET-PFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRP 61
            L    N+L  +   L + P D P ++VVG Q+ GKS+++E ++G  F   G G  TRRP
Sbjct: 2   QLIPVINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRP 61

Query: 62  ITLHMKYNPLCELPLCHLASSDV-DPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAK 120
           + L + + P+ +         +             EI+  I  +  R+  +  +   SA+
Sbjct: 62  LILQLTHLPIADDGSQTQEWGEFLHKPNDMFYDFSEIREEIIRDTDRMTGK--NKGISAQ 119

Query: 121 EIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQARAVESLVRAKMQHREFIILCLE 180
            I +K+   +  NLT++D PG+     G +   ++ Q   +  +V A ++ +  II+ + 
Sbjct: 120 PINLKIYSPHVVNLTLVDLPGITKVPVGDQPTDIEQQ---IRRMVMAYIKKQNAIIVAVT 176

Query: 181 DC-SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGFI 239
              +D +N+   ++  ++DPE KRTI V TKLD  + +   A +               +
Sbjct: 177 PANTDLANSDALQLAKEVDPEGKRTIGVITKLD-LMDKGTDAME---------------V 220

Query: 240 LGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEKLGRSLSKQERSRI 299
           L G     ++    V         + +  +++    + E +      + +S+     +R 
Sbjct: 221 LTGRVIPLTLGFIGVINRSQEDIIAKKSIRES---LKSEILYFKNHPIYKSI----ANRS 273

Query: 300 GVSKLRSFLEELLQKRYMDSVPMIIPLLEK 329
           G + L   L +LL     D++P +   + K
Sbjct: 274 GTAYLSKTLNKLLMFHIRDTLPDLKVKVSK 303
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query759
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 100.0
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 100.0
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.96
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.91
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.82
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.75
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.62
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.57
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.57
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.55
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.54
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.45
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.41
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.37
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.23
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.19
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.18
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.17
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.08
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.07
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.94
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.91
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.91
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.84
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.81
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.79
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.78
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.77
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.75
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.74
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.73
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.73
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.69
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.69
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.64
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.64
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.6
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.58
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.57
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.57
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.56
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.54
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.48
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.45
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.41
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.31
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.28
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.25
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.12
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.08
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.01
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 96.84
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.84
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.43
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.4
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.23
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.16
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.8
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.33
d2qy9a2211 GTPase domain of the signal recognition particle r 95.27
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.21
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.15
d1okkd2207 GTPase domain of the signal recognition particle r 95.12
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.42
d1vmaa2213 GTPase domain of the signal recognition particle r 94.38
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.09
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.28
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.58
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.56
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.33
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.31
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 91.93
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.87
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.63
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.57
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.45
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 90.92
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.86
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.67
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.64
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.17
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 90.15
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.12
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.1
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.1
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.08
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.25
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.18
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.18
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 88.94
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.89
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.87
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.87
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.82
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.79
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 88.57
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.39
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.05
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 87.56
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 87.51
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.38
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 87.26
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 87.01
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.99
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.99
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 86.83
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.72
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 86.68
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.13
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 85.84
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 85.78
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 85.73
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 84.54
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 84.14
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 83.91
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 83.9
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 83.74
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 82.18
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 82.12
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 80.89
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 80.77
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 80.6
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 80.24
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 80.2
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 80.04
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 80.04
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=9.3e-44  Score=377.49  Aligned_cols=298  Identities=26%  Similarity=0.340  Sum_probs=213.3

Q ss_pred             ccHHHHHHHHHHhhhhc-CCCCCCCEEEEEeccCCchHHHHHHHhCCccceecCccccccceEEEEeeCCCCCCCceEEe
Q 004351            2 HSLYEAYNELHGLAQEL-ETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYNPLCELPLCHLA   80 (759)
Q Consensus         2 ~~L~~~~n~L~~l~~~~-~~~i~lPqIVVVG~QSsGKSSLLEAL~G~~fp~~g~g~cTR~P~~l~l~~~~~~~~~~~~i~   80 (759)
                      ++||+++|+|+++++++ ++.+++|+|||||+||||||||||||+|.+|+|++.+.|||+||+|++.+.+....+.+.-.
T Consensus         1 ~~l~~~~n~l~d~~~~~~~~~~~lP~ivVvG~~ssGKSSliNaLlG~~~lP~~~~~~T~~~~~i~~~~~~~~~~~~~~~~   80 (306)
T d1jwyb_           1 DQLIPVINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQLTHLPIADDGSQTQE   80 (306)
T ss_dssp             CCHHHHHHHHHHHTTTSSSCTTCCCEEEEEECSSSSHHHHHHHHHTSCCCCC--------CEEEEEEECCCCTTSCCCCC
T ss_pred             CchHHHHHHHHHHHHHhCcCCCCCCeEEEEeCCCCCHHHHHHHHhCCCCCCCCCCccccCCEEEEEecCCcccCccchhh
Confidence            58999999999999887 47899999999999999999999999999998899999999999999998876543322110


Q ss_pred             cC-CCCCCcccccChHHHHHHHHHHHhhhhhccCCCccccceEEEEEEecCCCCcEEEeCCCCcCCCCCCCchhhHHHHH
Q 004351           81 SS-DVDPTLAQEKSLQEIQSFIEAENMRLERESNSNQFSAKEIIIKVEFKYCPNLTIIDTPGLIAPAPGRKNRALQDQAR  159 (759)
Q Consensus        81 ~~-d~~~~~~~~~~~~~l~~~Ie~~~~~l~~~~~~~~fS~d~I~leI~~p~~p~LtLVDLPGl~~~~~~~q~~~~e~~~~  159 (759)
                      .. ....+.....+++++...|......+.+..  ..++.+++.+++.+|.+++|+||||||++....+++..+   ...
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~l~iiDtPG~~~~~~~~~~~~---~~~  155 (306)
T d1jwyb_          81 WGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKN--KGISAQPINLKIYSPHVVNLTLVDLPGITKVPVGDQPTD---IEQ  155 (306)
T ss_dssp             EEEESSSTTCCBCCTHHHHHHHHHHCC----------CCCCCEEEEEEETTSCSEEEEECCCCC---------C---SHH
T ss_pred             hhHHhhcCCceecCHHHHHHHHHHHHHHhcCCC--CcccccceEEEecCCCCCCceEecCCCccccccCCcchh---HHH
Confidence            00 001134566788999998887666555543  579999999999999999999999999998776554432   356


Q ss_pred             HHHHHHHHHhcCccceeEeeccc-CCcCcHHHHHHHHHhCcCCCeEEEEecCCCcccccccChhhHHHhhCCCCCCCCcc
Q 004351          160 AVESLVRAKMQHREFIILCLEDC-SDWSNATTRRVVMQIDPELKRTIIVSTKLDTKIPQFARASDVEVFLSPPACTLDGF  238 (759)
Q Consensus       160 ~v~~lv~~Yi~~~~~IIL~V~~~-~D~~~~~~l~lar~~Dp~g~RTIgVlTK~D~~~~~~~~~~~~~~~L~~~~~~l~~~  238 (759)
                      .+.+++..||++++++||+|.++ .|+.++.++.+++++||.+.||++|+||+|.+.+    +.++..+|.+...   + 
T Consensus       156 ~~~~~~~~yi~~~~~~il~v~~~~~~~~~~~~~~~~~~~~~~~~r~i~Vitk~D~~~~----~~~~~~~l~~~~~---~-  227 (306)
T d1jwyb_         156 QIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEVDPEGKRTIGVITKLDLMDK----GTDAMEVLTGRVI---P-  227 (306)
T ss_dssp             HHHHHHHHHHHSTTEEEEEEEESSSCSTTCSHHHHHHHHCSSCSSEEEEEECTTSSCS----SCCCHHHHTTSSS---C-
T ss_pred             HHHHHHHHHHhCCCceeEEeecccccccccHHHHHHHHhCcCCCeEEEEEeccccccc----hhHHHHHHhCCcc---c-
Confidence            78899999999999999998765 7999999999999999999999999999999743    4567788887432   2 


Q ss_pred             cccCCCeeeecCCCCccCCCCCCCCCHHHHHHhhhhHHHhHHHHHHHH-h-cCCccccccCCcchHHHHHHHHHHHHHHH
Q 004351          239 ILGGSPFFTSVPSGRVGTGHDSVYSSNEEFKQAIFIREMEDITSLEEK-L-GRSLSKQERSRIGVSKLRSFLEELLQKRY  316 (759)
Q Consensus       239 ~LG~~~ffvs~P~~rvg~~~d~v~rs~~~~~~~~~~~e~~d~~~lE~~-f-~~~w~~~~~~r~Gi~~Lr~~Ls~lL~~~i  316 (759)
                       ++ .+|+....            +...+.....+..+   +...|.. | ..+|...+.+++|+.+|+.+|+++|++||
T Consensus       228 -~~-~~~~~~~~------------~~~~~~~~~~~~~~---~~~~E~~~f~~~~~~~~l~~r~Gi~~L~~~L~~~L~~~i  290 (306)
T d1jwyb_         228 -LT-LGFIGVIN------------RSQEDIIAKKSIRE---SLKSEILYFKNHPIYKSIANRSGTAYLSKTLNKLLMFHI  290 (306)
T ss_dssp             -CT-TCEEECCC------------CCHHHHSSSCCHHH---HHHHHHHHHHTCTTGGGSGGGCSHHHHHHHHHHHHHHHH
T ss_pred             -cc-CCceeeec------------CchhhccccCCHHH---HHHHHHHHHhCCchhcchHHHhhHHHHHHHHHHHHHHHH
Confidence             22 35665311            11222211122222   2223443 3 66788888999999999999999999999


Q ss_pred             HhhhhhhHHHHHH
Q 004351          317 MDSVPMIIPLLEK  329 (759)
Q Consensus       317 ~~~LP~i~~~L~~  329 (759)
                      +++||.|+..|++
T Consensus       291 ~~~lP~i~~~i~~  303 (306)
T d1jwyb_         291 RDTLPDLKVKVSK  303 (306)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHhHHHHHHHHH
Confidence            9999999887754
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure