Citrus Sinensis ID: 004419

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750----

MFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEGRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

cHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccc

cHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccEEEEEcccEccHHHHHHHHHHHHHHcccccccccccccEEEcc

mflcrllqvnsiessskDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAaamvngsvspekrpadgrmdlQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNelnddkyvhsSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESadaarntvddsESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMygqegrdprdlmeIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAIlkcgvcfdrpkevviTKCFHLFcnpciqrnleirhrkcpgcgtafgqsdvrfvki

mflcrllqvnsiessskdgILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAfheklsaedAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALtdsllidrslvlrrekeinvraesadaarntvddsesriERLEVQLQksiiekndlglkMEEAIqdsgrkdikAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLkvslsaktneqkrltdkCVEQMAEIKSLKALIEKLQKDKLESQIMLDmygqegrdprDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAkldaserdVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWlksavtssdkeyeqiqrktedmRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPgcgtafgqsdvrfvki

MFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHlageleetmaeleeSRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEGRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDmrkelenernerkkleeelmeVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

**LCRLLQVN********GILQYVEEAL********ELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMK*EAKNLHEVMEIIHLKHKEYADQIENYISS*****************************************************************************************************************DKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRRE***************************************************************************************************************************IKSLKALI**************************************************************************EAEIIELVAK******************************************************DLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLK********************************************************IQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDV*****

MFLCRL*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************CKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

MFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVR***************SRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEGRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSA**************TEDMRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

MFLCRLLQVNSIES*SKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDI*****************************DLQELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEGRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNERKKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQELKDSVEEAKILAADRLSExxxxxxxxxxxxxxxxxxxxxLNDDKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESxxxxxxxxxxxxxxxxxxxxxxxxxxxxKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKxxxxxxxxxxxxxxxxxxxxxKLESQIMLDMYGQEGRDPRDLMExxxxxxxxxxxxxxxxxxxxxHSLELRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSExxxxxxxxxxxxxxxxxxxxxxxxxxxxMKACLTEALRYNSEDRHLAVNxxxxxxxxxxxxxxxxxxxxxVTSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		754	2.2.26 [Sep-21-2011]
Q9C895		900	E3 ubiquitin-protein liga	yes	no	0.993	0.832	0.629	0.0
Q336R3		844	E3 ubiquitin-protein liga	yes	no	0.996	0.889	0.549	0.0
A2ZAC2		844	E3 ubiquitin-protein liga	N/A	no	0.996	0.889	0.549	0.0
Q8RXD6		878	E3 ubiquitin-protein liga	no	no	0.989	0.849	0.337	1e-107
A2XW69		884	E3 ubiquitin-protein liga	N/A	no	0.872	0.744	0.365	1e-101
Q7XU27		884	E3 ubiquitin-protein liga	no	no	0.872	0.744	0.364	1e-101
Q4R7K7		1001	E3 ubiquitin-protein liga	N/A	no	0.435	0.327	0.315	1e-36
Q8CJB9		1002	E3 ubiquitin-protein liga	yes	no	0.435	0.327	0.315	1e-36
Q3U319		1001	E3 ubiquitin-protein liga	yes	no	0.435	0.327	0.318	2e-36
Q5RAU7		1001	E3 ubiquitin-protein liga	yes	no	0.435	0.327	0.315	2e-36

>sp\|Q9C895\|BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana GN=HUB2 PE=1 SV=2	Back alignment and function desciption

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/753 (62%), Positives = 607/753 (80%), Gaps = 4/753 (0%)

Query: 2   FLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFH 61
           FLCRLLQV+S+++S  D +++ VEEALA RHSS  ELM   E  ID Q+ K +SI+++ H
Sbjct: 152 FLCRLLQVDSLDTSKSDEVVRKVEEALALRHSSTMELMGLFENTIDTQKTKAESISQSLH 211

Query: 62  EKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQH 121
              S EDA IQLS I+D+MKEE+KNL E+++ +H++HKE+++QI+ YISSHS DQ+E++H
Sbjct: 212 AVKSTEDATIQLSSINDLMKEESKNLREMIDALHVRHKEHSEQIQAYISSHSTDQSELKH 271

Query: 122 LAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQ 181
           L G+LEE  AELEE+RRKL++LKMQKD A   H   PA A  NGS+SPEK P D +  L+
Sbjct: 272 LKGQLEEIKAELEENRRKLITLKMQKDAACEGHVTSPAIA--NGSLSPEK-PVD-KTKLR 327

Query: 182 ELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQL 241
           ELKDS++E KI+A  RLSE++ +Q+ N++LS+Q ++++NEL DD+Y++SSRLY+L+ND++
Sbjct: 328 ELKDSIDEIKIMAEGRLSELQASQEYNLSLSRQCQDIENELKDDQYIYSSRLYSLINDRI 387

Query: 242 QHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQ 301
            HWN E++RYK LT+++  +RS V+RR+KE+N+RAES +AA +      SRIE LE +LQ
Sbjct: 388 HHWNAELDRYKILTEAIQAERSFVMRRDKELNLRAESLEAANHKTTTVGSRIEVLEKKLQ 447

Query: 302 KSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSL 361
             IIEKN L L+ EEAIQDS R+DIK+EF  MAS LSKEM MMEAQL RWK+TA +AL L
Sbjct: 448 SCIIEKNGLELETEEAIQDSERQDIKSEFIAMASTLSKEMEMMEAQLKRWKDTAQDALYL 507

Query: 362 REKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEG 421
           RE+A SL+VSLS K +EQK L DKC +QMAEIKSLKALIEKL K+KL+ Q +  +  +E 
Sbjct: 508 REQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLASICTREC 567

Query: 422 RDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIEL 481
            D R L EIK+S+R+A +QAE LKN LDEH LELRVKAA+E E+ACQ+RL+ A+AEI EL
Sbjct: 568 NDDRGLAEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAEL 627

Query: 482 VAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLN 541
             +LD SER+V+EL+E +K K++EAEA IAEMETIGQA+EDMQTQNQHLLQQVAERDD N
Sbjct: 628 RTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYN 687

Query: 542 IKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYN 601
           IKLVSESVKTK   +  LSEKQ + +QL Q+NA VE+ K RI H EEQMK C +EA +  
Sbjct: 688 IKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLI 747

Query: 602 SEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNERK 661
            EDRHL ++LETTKWE+ADA+KE +WLKSAV+SS+KEYEQI R+T+D++ EL++ER E+K
Sbjct: 748 QEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDERREKK 807

Query: 662 KLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLF 721
           KLEEELME+N ++ EL SE+ EAAI +LQ+E+K+CK ILKCGVCFDRPKEVVI KC+HLF
Sbjct: 808 KLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHLF 867

Query: 722 CNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI 754
           C  CIQR+LEIRHRKCPGCGTAFGQ+DVR VK+
Sbjct: 868 CQQCIQRSLEIRHRKCPGCGTAFGQNDVRLVKM 900

E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q336R3\|BRE1B_ORYSJ E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. japonica GN=BRE1B PE=2 SV=1	Back alignment and function description

>sp\|A2ZAC2\|BRE1B_ORYSI E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. indica GN=BRE1B PE=3 SV=2	Back alignment and function description

>sp\|Q8RXD6\|BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana GN=HUB1 PE=1 SV=1	Back alignment and function description

>sp\|A2XW69\|BRE1A_ORYSI E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. indica GN=BRE1A PE=3 SV=2	Back alignment and function description

>sp\|Q7XU27\|BRE1A_ORYSJ E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. japonica GN=BRE1A PE=2 SV=3	Back alignment and function description

>sp\|Q4R7K7\|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1	Back alignment and function description

>sp\|Q8CJB9\|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1	Back alignment and function description

>sp\|Q3U319\|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2	Back alignment and function description

>sp\|Q5RAU7\|BRE1B_PONAB E3 ubiquitin-protein ligase BRE1B OS=Pongo abelii GN=RNF40 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		754
359478442		872	PREDICTED: E3 ubiquitin-protein ligase B	0.994	0.860	0.757	0.0
297746431		879	unnamed protein product [Vitis vinifera]	0.994	0.853	0.757	0.0
255580072		945	Ubiquitin-protein ligase bre-1, putative	0.996	0.794	0.739	0.0
356554544		879	PREDICTED: E3 ubiquitin-protein ligase B	0.994	0.853	0.659	0.0
449448812		880	PREDICTED: E3 ubiquitin-protein ligase B	0.996	0.853	0.652	0.0
240254270		900	E3 ubiquitin-protein ligase BRE1-like 2	0.993	0.832	0.629	0.0
449519462		880	PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu	0.996	0.853	0.651	0.0
356501257		881	PREDICTED: E3 ubiquitin-protein ligase B	0.994	0.851	0.655	0.0
356554546		898	PREDICTED: E3 ubiquitin-protein ligase B	0.994	0.835	0.642	0.0
334183329		899	E3 ubiquitin-protein ligase BRE1-like 2	0.993	0.833	0.612	0.0

>gi\|359478442\|ref\|XP_002283417.2\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/754 (75%), Positives = 659/754 (87%), Gaps = 4/754 (0%)

Query: 1   MFLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAF 60
           +FLCRLL+ +S+ES+  DGI++YVEEALA RHSS  EL+K +E+ IDAQRVKT++IA+A 
Sbjct: 123 IFLCRLLETDSVESNGNDGIVKYVEEALALRHSSTLELIKSLEDTIDAQRVKTENIAQAL 182

Query: 61  HEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQ 120
           H KLSAEDAIIQLSKIDD+MKEEA NL EV++ +HLKHKEY D I+ Y+ SHSVDQ+EI+
Sbjct: 183 HGKLSAEDAIIQLSKIDDLMKEEANNLREVIDALHLKHKEYVDGIQTYVHSHSVDQSEIK 242

Query: 121 HLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDL 180
            LAGELEE+MAELEESRRKLV+LKMQKD+AS  H+  P    VNGS+SPEK  AD  M  
Sbjct: 243 RLAGELEESMAELEESRRKLVNLKMQKDVASVVHT--PVQGAVNGSLSPEKH-ADRTMGF 299

Query: 181 QELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQ 240
           +ELKDSVEE KILAADRLSE+ EAQ+DN+ LSKQL++LQNEL DDKYV+SSR Y L+NDQ
Sbjct: 300 RELKDSVEETKILAADRLSELHEAQEDNLILSKQLQDLQNELKDDKYVYSSRPYTLLNDQ 359

Query: 241 LQHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQL 300
           LQHWN E ERYK LTDSL  DR+ V+RREKE+N ++E ADAAR+ +++ +S+IE LE+QL
Sbjct: 360 LQHWNAEAERYKLLTDSLQADRAQVVRREKELNAKSELADAARSVIEN-DSKIEELELQL 418

Query: 301 QKSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALS 360
           QK +IEKNDL +KM+EA+QDSGRKDIKAEF VMASALSKEMGMME+QLNRWKETA EALS
Sbjct: 419 QKCLIEKNDLEVKMKEALQDSGRKDIKAEFHVMASALSKEMGMMESQLNRWKETAHEALS 478

Query: 361 LREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQE 420
           LRE+  SLK  L+ KTNEQK L DKC EQM EIKSLKALIEKLQK KLE QI +DM+GQE
Sbjct: 479 LREQVQSLKALLNKKTNEQKCLADKCEEQMVEIKSLKALIEKLQKGKLELQIFVDMHGQE 538

Query: 421 GRDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIE 480
             D RDLMEIKESE +AH QAEVL+NALDEHSLELRVKAANEAEAACQQRLSAAEAEI +
Sbjct: 539 SYDNRDLMEIKESEHKAHMQAEVLRNALDEHSLELRVKAANEAEAACQQRLSAAEAEIAD 598

Query: 481 LVAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDL 540
           L AKLDASERDV+EL+EA++ KD EAEAYI+E+ETIGQA+EDMQTQNQHLLQQV ERDD 
Sbjct: 599 LRAKLDASERDVLELKEAIRIKDVEAEAYISEIETIGQAYEDMQTQNQHLLQQVTERDDY 658

Query: 541 NIKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRY 600
           NIKLVSESVKTKQ+QSFLLSEKQALA+QLQQ+N  +ES K+RI  +EEQMK CL EAL+Y
Sbjct: 659 NIKLVSESVKTKQMQSFLLSEKQALAKQLQQVNNALESLKMRIAQSEEQMKVCLAEALKY 718

Query: 601 NSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENERNER 660
             EDRHLAV+LET KWELADAEKELKWLKSA+ SS+KEYEQIQRK E+++ EL+NER+ER
Sbjct: 719 TQEDRHLAVSLETAKWELADAEKELKWLKSALASSEKEYEQIQRKKEEVQMELDNERSER 778

Query: 661 KKLEEELMEVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHL 720
            KLEEEL E+N ++AE++SE+GEAAIQKLQDEIKD KAILKCGVCFDRPKEVVI KC+HL
Sbjct: 779 LKLEEELKELNREIAEMSSESGEAAIQKLQDEIKDGKAILKCGVCFDRPKEVVIVKCYHL 838

Query: 721 FCNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI 754
           FCNPCIQRNLEIRHRKCP CGTAFGQ+DVRFVKI
Sbjct: 839 FCNPCIQRNLEIRHRKCPACGTAFGQNDVRFVKI 872

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297746431\|emb\|CBI16487.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255580072\|ref\|XP_002530869.1\| Ubiquitin-protein ligase bre-1, putative [Ricinus communis] gi\|223529558\|gb\|EEF31509.1\| Ubiquitin-protein ligase bre-1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356554544\|ref\|XP_003545605.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|449448812\|ref\|XP_004142159.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|240254270\|ref\|NP_564680.4\| E3 ubiquitin-protein ligase BRE1-like 2 [Arabidopsis thaliana] gi\|257051000\|sp\|Q9C895.2\|BRE1B_ARATH RecName: Full=E3 ubiquitin-protein ligase BRE1-like 2; AltName: Full=Protein HISTONE MONOUBIQUITINATION 2; Short=AtHUB2 gi\|332195089\|gb\|AEE33210.1\| E3 ubiquitin-protein ligase BRE1-like 2 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449519462\|ref\|XP_004166754.1\| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase BRE1-like 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356501257\|ref\|XP_003519442.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356554546\|ref\|XP_003545606.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|334183329\|ref\|NP_001185233.1\| E3 ubiquitin-protein ligase BRE1-like 2 [Arabidopsis thaliana] gi\|332195091\|gb\|AEE33212.1\| E3 ubiquitin-protein ligase BRE1-like 2 [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		754
TAIR\|locus:2035726		900	HUB2 "histone mono-ubiquitinat	0.993	0.832	0.597	1.9e-234
TAIR\|locus:2054997		878	HUB1 "histone mono-ubiquitinat	0.989	0.849	0.318	4.2e-102
UNIPROTKB\|F1N9A6		984	RNF20 "E3 ubiquitin-protein li	0.737	0.565	0.247	3.4e-42
UNIPROTKB\|Q5ZLS3		984	RNF20 "E3 ubiquitin-protein li	0.737	0.565	0.247	3.4e-42
UNIPROTKB\|A2VDP1		975	RNF20 "E3 ubiquitin-protein li	0.936	0.724	0.241	7.3e-42
UNIPROTKB\|I3L5V4		978	LOC100625036 "Uncharacterized	0.937	0.722	0.239	7.4e-42
UNIPROTKB\|F6XUF9		975	RNF20 "Uncharacterized protein	0.938	0.726	0.247	1.6e-41
UNIPROTKB\|E2QZB1		977	RNF20 "Uncharacterized protein	0.938	0.724	0.247	1.6e-41
UNIPROTKB\|F1SSB0		975	LOC100154259 "Uncharacterized	0.936	0.724	0.239	2.7e-41
ZFIN\|ZDB-GENE-030131-6607		1004	rnf40 "ring finger protein 40"	0.740	0.555	0.273	6.5e-41

TAIR\|locus:2035726 HUB2 "histone mono-ubiquitination 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2261 (801.0 bits), Expect = 1.9e-234, P = 1.9e-234
 Identities = 450/753 (59%), Positives = 577/753 (76%)

Query:     2 FLCRLLQVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFH 61
             FLCRLLQV+S+++S  D +++ VEEALA RHSS  ELM   E  ID Q+ K +SI+++ H
Sbjct:   152 FLCRLLQVDSLDTSKSDEVVRKVEEALALRHSSTMELMGLFENTIDTQKTKAESISQSLH 211

Query:    62 EKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYADQIENYISSHSVDQAEIQH 121
                S EDA IQLS I+D+MKEE+KNL E+++ +H++HKE+++QI+ YISSHS DQ+E++H
Sbjct:   212 AVKSTEDATIQLSSINDLMKEESKNLREMIDALHVRHKEHSEQIQAYISSHSTDQSELKH 271

Query:   122 XXXXXXXXXXXXXXSRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQ 181
                           +RRKL++LKMQKD A   H   PA A  NGS+SPEK P D +  L+
Sbjct:   272 LKGQLEEIKAELEENRRKLITLKMQKDAACEGHVTSPAIA--NGSLSPEK-PVD-KTKLR 327

Query:   182 ELKDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELNDDKYVHSSRLYNLVNDQL 241
             ELKDS++E KI+A  RLSE++ +Q+ N++LS+Q ++++NEL DD+Y++SSRLY+L+ND++
Sbjct:   328 ELKDSIDEIKIMAEGRLSELQASQEYNLSLSRQCQDIENELKDDQYIYSSRLYSLINDRI 387

Query:   242 QHWNVEVERYKALTDSLLIDRSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQ 301
              HWN E++RYK LT+++  +RS V+RR+KE+N+RAES +AA +      SRIE LE +LQ
Sbjct:   388 HHWNAELDRYKILTEAIQAERSFVMRRDKELNLRAESLEAANHKTTTVGSRIEVLEKKLQ 447

Query:   302 KSIIEKNDLGLKMEEAIQDSGRKDIKAEFRVMASALSKEMGMMEAQLNRWKETADEALSL 361
               IIEKN L L+ EEAIQDS R+DIK+EF  MAS LSKEM MMEAQL RWK+TA +AL L
Sbjct:   448 SCIIEKNGLELETEEAIQDSERQDIKSEFIAMASTLSKEMEMMEAQLKRWKDTAQDALYL 507

Query:   362 REKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKALIEKLQKDKLESQIMLDMYGQEG 421
             RE+A SL+VSLS K +EQK L DKC +QMAEIKSLKALIEKL K+KL+ Q +  +  +E 
Sbjct:   508 REQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLASICTREC 567

Query:   422 RDPRDLMEIKESERRAHSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIEL 481
              D R L EIK+S+R+A +QAE LKN LDEH LELRVKAA+E E+ACQ+RL+ A+AEI EL
Sbjct:   568 NDDRGLAEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAEL 627

Query:   482 VAKLDASERDVMELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLN 541
               +LD SER+V+EL+E +K K++EAEA IAEMETIGQA+EDMQTQNQHLLQQVAERDD N
Sbjct:   628 RTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYN 687

Query:   542 IKLVSESVKTKQVQSFLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYN 601
             IKLVSESVKTK   +  LSEKQ + +QL Q+NA VE+ K RI H EEQMK C +EA +  
Sbjct:   688 IKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLI 747

Query:   602 SEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDXXXXXXXXXXXXX 661
              EDRHL ++LETTKWE+ADA+KE +WLKSAV+SS+KEYEQI R+T+D             
Sbjct:   748 QEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDERREKK 807

Query:   662 XXXXXXXXVNNKVAELTSETGEAAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLF 721
                     +N ++ EL SE+ EAAI +LQ+E+K+CK ILKCGVCFDRPKEVVI KC+HLF
Sbjct:   808 KLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHLF 867

Query:   722 CNPCIQRNLEIRHRKCPGCGTAFGQSDVRFVKI 754
             C  CIQR+LEIRHRKCPGCGTAFGQ+DVR VK+
Sbjct:   868 CQQCIQRSLEIRHRKCPGCGTAFGQNDVRLVKM 900

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0010162 "seed dormancy process" evidence=IMP

GO:0010390 "histone monoubiquitination" evidence=IMP

GO:0009965 "leaf morphogenesis" evidence=IMP

GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA;IMP

GO:0033523 "histone H2B ubiquitination" evidence=IMP

GO:0042803 "protein homodimerization activity" evidence=IPI

GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA

GO:0007346 "regulation of mitotic cell cycle" evidence=RCA

GO:0043687 "post-translational protein modification" evidence=RCA

GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA

TAIR\|locus:2054997 HUB1 "histone mono-ubiquitination 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9A6 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZLS3 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|A2VDP1 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|I3L5V4 LOC100625036 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F6XUF9 RNF20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QZB1 RNF20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SSB0 LOC100154259 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-6607 rnf40 "ring finger protein 40" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9C895	BRE1B_ARATH	6, ., 3, ., 2, ., -	0.6294	0.9933	0.8322	yes	no
A2ZAC2	BRE1B_ORYSI	6, ., 3, ., 2, ., -	0.5490	0.9960	0.8898	N/A	no
Q336R3	BRE1B_ORYSJ	6, ., 3, ., 2, ., -	0.5490	0.9960	0.8898	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		754
smart00184		40	smart00184, RING, Ring finger	1e-11
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	5e-11
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	8e-11
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	1e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-09
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-09
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	7e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-06
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	2e-06
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	3e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-06
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	4e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	5e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	5e-05
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	8e-05
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	1e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
PRK04863		1486	PRK04863, mukB, cell division protein MukB; Provis	2e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-04
PLN03208		193	PLN03208, PLN03208, E3 ubiquitin-protein ligase RM	3e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	8e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.001
COG5222		427	COG5222, COG5222, Uncharacterized conserved protei	0.001
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	0.002
TIGR00606		1311	TIGR00606, rad50, rad50	0.004
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	0.004

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

 Score = 59.4 bits (144), Expect = 1e-11
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 702 CGVCFDR-PKEVVITKCFHLFCNPCIQRNLEIRHRKCPGC 740
           C +C +   K+ VI  C H FC  CI++ LE  +  CP C
Sbjct: 1   CPICLEEYLKDPVILPCGHTFCRSCIRKWLESGNNTCPIC 40

E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s). Length = 40

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235316 PRK04863, mukB, cell division protein MukB; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|129694 TIGR00606, rad50, rad50	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		754
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	100.0
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.84
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.83
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.83
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.79
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.78
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.75
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.74
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.74
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.73
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.7
PRK02224		880	chromosome segregation protein; Provisional	99.67
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.65
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.63
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	99.61
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.6
PRK03918		880	chromosome segregation protein; Provisional	99.6
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.59
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	99.58
PRK03918		880	chromosome segregation protein; Provisional	99.56
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	99.54
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.51
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.44
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.42
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.36
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	99.36
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.35
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.35
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	99.35
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.34
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	99.32
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.31
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	99.3
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	99.27
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	99.26
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	99.25
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.25
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.25
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	99.24
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	99.23
PRK04863		1486	mukB cell division protein MukB; Provisional	99.21
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.14
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	99.13
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	99.11
PHA02929		238	N1R/p28-like protein; Provisional	99.09
PHA02926		242	zinc finger-like protein; Provisional	99.09
PF14634		44	zf-RING_5: zinc-RING finger domain	99.07
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.02
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.98
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	98.95
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.94
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.92
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.92
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.85
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.84
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.8
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.78
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.73
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.66
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	98.64
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	98.63
COG5152		259	Uncharacterized conserved protein, contains RING a	98.61
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.57
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.54
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.53
PRK04778		569	septation ring formation regulator EzrA; Provision	98.53
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.5
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.45
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.44
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.43
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.41
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	98.41
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.39
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	98.39
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.39
PRK04863		1486	mukB cell division protein MukB; Provisional	98.38
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	98.36
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.36
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.35
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.35
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	98.35
PRK04778		569	septation ring formation regulator EzrA; Provision	98.32
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.32
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	98.32
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	98.3
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	98.28
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	98.27
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.26
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.24
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.23
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	98.22
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.22
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	98.21
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	98.19
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	98.18
PF04641		260	Rtf2: Rtf2 RING-finger	98.18
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.16
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.13
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.11
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.09
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.08
KOG0018		1141	consensus Structural maintenance of chromosome pro	98.02
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.97
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.97
PRK11637		428	AmiB activator; Provisional	97.96
KOG0825		1134	consensus PHD Zn-finger protein [General function	97.96
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.95
KOG3039		303	consensus Uncharacterized conserved protein [Funct	97.93
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.91
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.91
PHA02562		562	46 endonuclease subunit; Provisional	97.9
PRK11637		428	AmiB activator; Provisional	97.9
KOG2660		331	consensus Locus-specific chromosome binding protei	97.89
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	97.89
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.89
PHA02562		562	46 endonuclease subunit; Provisional	97.87
KOG0297		391	consensus TNF receptor-associated factor [Signal t	97.82
KOG1003		205	consensus Actin filament-coating protein tropomyos	97.78
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.76
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.7
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	97.66
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	97.63
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	97.63
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	97.62
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.61
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.58
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.57
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.51
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	97.51
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	97.49
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.38
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	97.36
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	97.34
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.27
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.25
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.22
PRK09039		343	hypothetical protein; Validated	97.2
KOG1001		674	consensus Helicase-like transcription factor HLTF/	97.19
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	97.14
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	97.1
COG4372		499	Uncharacterized protein conserved in bacteria with	97.07
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	97.06
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	96.99
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	96.99
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	96.98
COG5175		480	MOT2 Transcriptional repressor [Transcription]	96.94
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	96.89
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	96.87
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	96.81
KOG3002		299	consensus Zn finger protein [General function pred	96.77
COG5236		493	Uncharacterized conserved protein, contains RING Z	96.71
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.68
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	96.68
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	96.66
COG4942		420	Membrane-bound metallopeptidase [Cell division and	96.65
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	96.64
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	96.63
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	96.6
PF13514		1111	AAA_27: AAA domain	96.57
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	96.55
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	96.55
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	96.55
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	96.54
KOG3579		352	consensus Predicted E3 ubiquitin ligase [Posttrans	96.53
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	96.43
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	96.41
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	96.41
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.33
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.29
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	96.24
PHA03096		284	p28-like protein; Provisional	96.2
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.2
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.19
PF06906		57	DUF1272: Protein of unknown function (DUF1272); In	96.16
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	96.15
COG5185		622	HEC1 Protein involved in chromosome segregation, i	96.15
KOG3113		293	consensus Uncharacterized conserved protein [Funct	96.12
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	96.07
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	95.9
COG5219		1525	Uncharacterized conserved protein, contains RING Z	95.89
KOG3039		303	consensus Uncharacterized conserved protein [Funct	95.86
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	95.85
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	95.84
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	95.82
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	95.77
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	95.65
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	95.62
COG5185		622	HEC1 Protein involved in chromosome segregation, i	95.6
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.56
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	95.56
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	95.55
COG5109		396	Uncharacterized conserved protein, contains RING Z	95.38
KOG1941		518	consensus Acetylcholine receptor-associated protei	95.32
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	95.32
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	95.29
KOG0963		629	consensus Transcription factor/CCAAT displacement	95.28
KOG0971		1243	consensus Microtubule-associated protein dynactin	95.26
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	95.25
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	95.14
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	95.05
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.05
KOG0298		1394	consensus DEAD box-containing helicase-like transc	95.01
COG3813		84	Uncharacterized protein conserved in bacteria [Fun	94.97
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	94.72
KOG4445		368	consensus Uncharacterized conserved protein, conta	94.7
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	94.65
KOG0825		1134	consensus PHD Zn-finger protein [General function	94.6
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	94.48
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	94.47
TIGR01562		305	FdhE formate dehydrogenase accessory protein FdhE.	94.41
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	94.39
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	94.38
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	94.34
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	94.24
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	94.15
PF14569		80	zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A.	94.08
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.06
KOG2113		394	consensus Predicted RNA binding protein, contains	94.0
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	93.99
COG4647		165	AcxC Acetone carboxylase, gamma subunit [Secondary	93.94
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	93.74
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	93.72
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	93.64
PF13240		23	zinc_ribbon_2: zinc-ribbon domain	93.58
KOG0979		1072	consensus Structural maintenance of chromosome pro	93.55
PRK03564		309	formate dehydrogenase accessory protein FdhE; Prov	93.37
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	93.2
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	93.06
PF04216		290	FdhE: Protein involved in formate dehydrogenase fo	93.05
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	92.94
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	92.71
PF13248		26	zf-ribbon_3: zinc-ribbon domain	92.7
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	92.69
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	92.66
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	92.65
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	92.59
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	92.16
KOG3899		381	consensus Uncharacterized conserved protein [Funct	91.83
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	91.8
PF02318		118	FYVE_2: FYVE-type zinc finger; InterPro: IPR003315	91.73
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	91.64
PF10235		90	Cript: Microtubule-associated protein CRIPT; Inter	91.62
KOG0963		629	consensus Transcription factor/CCAAT displacement	91.54
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	91.5
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	91.42
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	91.35
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	91.17
cd00065		57	FYVE FYVE domain; Zinc-binding domain; targets pro	91.0
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	90.98
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	90.97
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	90.8
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	90.78
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	90.46
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	90.29
PF01363		69	FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f	90.19
KOG2979		262	consensus Protein involved in DNA repair [General	90.07
KOG0993		542	consensus Rab5 GTPase effector Rabaptin-5 [Intrace	89.97
KOG4718		235	consensus Non-SMC (structural maintenance of chrom	89.93
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.92
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	89.66
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	89.39
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	89.29
smart00064		68	FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	89.22
COG4026		290	Uncharacterized protein containing TOPRIM domain,	89.21
COG4477		570	EzrA Negative regulator of septation ring formatio	89.16
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	89.01
PRK04023		1121	DNA polymerase II large subunit; Validated	88.37
KOG1940		276	consensus Zn-finger protein [General function pred	88.13
PF14353		128	CpXC: CpXC protein	87.68
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	87.67
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	87.65
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	87.51
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	87.39
PF04710		416	Pellino: Pellino; InterPro: IPR006800 Pellino is i	87.27
KOG3799		169	consensus Rab3 effector RIM1 and related proteins,	86.72
PF08882		112	Acetone_carb_G: Acetone carboxylase gamma subunit;	86.67
COG3058		308	FdhE Uncharacterized protein involved in formate d	86.52
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	86.52
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	86.47
PLN02189		1040	cellulose synthase	86.38
COG3364		112	Zn-ribbon containing protein [General function pre	86.01
PLN02436		1094	cellulose synthase A	85.96
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	85.84
KOG3842		429	consensus Adaptor protein Pellino [Signal transduc	85.63
COG4306		160	Uncharacterized protein conserved in bacteria [Fun	85.55
PF10083		158	DUF2321: Uncharacterized protein conserved in bact	85.51
KOG2068		327	consensus MOT2 transcription factor [Transcription	85.29
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	85.26
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	85.23
COG4026		290	Uncharacterized protein containing TOPRIM domain,	84.79
PF15616		131	TerY-C: TerY-C metal binding domain	84.78
KOG2113		394	consensus Predicted RNA binding protein, contains	84.74
PRK10884		206	SH3 domain-containing protein; Provisional	84.37
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	84.36
KOG4739		233	consensus Uncharacterized protein involved in syna	84.36
KOG1729		288	consensus FYVE finger containing protein [General	84.34
COG2433		652	Uncharacterized conserved protein [Function unknow	84.2
PLN02638		1079	cellulose synthase A (UDP-forming), catalytic subu	84.03
PLN02195		977	cellulose synthase A	84.02
KOG1842		505	consensus FYVE finger-containing protein [General	83.84
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	83.34
PF12773		50	DZR: Double zinc ribbon	83.24
COG1655		267	Uncharacterized protein conserved in bacteria [Fun	83.18
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	83.17
COG4477		570	EzrA Negative regulator of septation ring formatio	83.1
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	83.09
PLN02915		1044	cellulose synthase A [UDP-forming], catalytic subu	82.88
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	82.7
cd00350		33	rubredoxin_like Rubredoxin_like; nonheme iron bind	82.41
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	81.82
PF12660		99	zf-TFIIIC: Putative zinc-finger of transcription f	81.28
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	81.27
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	81.21
PLN02400		1085	cellulose synthase	81.18
PHA02862		156	5L protein; Provisional	81.14
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	81.06
KOG0249		916	consensus LAR-interacting protein and related prot	81.0
COG1867		380	TRM1 N2,N2-dimethylguanosine tRNA methyltransferas	80.82
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	80.74
PRK14714		1337	DNA polymerase II large subunit; Provisional	80.52
PF13514		1111	AAA_27: AAA domain	80.52
PRK11281		1113	hypothetical protein; Provisional	80.22
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	80.15
PHA02825		162	LAP/PHD finger-like protein; Provisional	80.15
PF14319		111	Zn_Tnp_IS91: Transposase zinc-binding domain	80.13

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=9.5e-38  Score=321.47  Aligned_cols=685  Identities=31%  Similarity=0.438  Sum_probs=471.8

Q ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhccChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHH
Q 004419           24 VEEALASRHSSARELMKFIEEVIDAQRVKTKSIAEAFHEKLSAEDAIIQLSKIDDMMKEEAKNLHEVMEIIHLKHKEYAD  103 (754)
Q Consensus        24 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~  103 (754)
                      +...+..++.+....+......++.+....+.+-..+..      .-..+...-+.+..++..++.....+...+..+..
T Consensus         3 ~~~~~~~~i~~~~~~~~~~~~~~D~lq~~~e~~~~~~~~------~~e~l~~~~~~L~~e~e~Lq~~~~~~~~~~~~~~~   76 (698)
T KOG0978|consen    3 VEEPLAGRIKSEKEAVSLVLIQIDDLQTQAEELARRLNR------VEEALTVLFDELAEENEKLQNLADHLQEKHATLSE   76 (698)
T ss_pred             chhhhHHHHHhhhhhhcccchhhHHHHHHHHHHHhhhhH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345677777777788888888888887777766666665      22235666777788888889999999999999999


Q ss_pred             HHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhcCcCccchhhhhhcCCCCCCcCccchhhcHHHH
Q 004419          104 QIENYISSHSVDQAEIQHLAGELEETMAELEESRRKLVSLKMQKDIASGTHSLVPAAAMVNGSVSPEKRPADGRMDLQEL  183 (754)
Q Consensus       104 ~l~~~~~~~~~~~~~l~~l~~~~~~~~~el~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  183 (754)
                      .+..+.+.+.........++..++.+..++.........+..-+..+.....  .   ...+.......+.-.......+
T Consensus        77 ~~~el~~k~s~~~~~~~e~~~~le~~~~d~eki~~~~~~l~~~la~~~~~~~--t---~~~~~~~~~~~~t~~~t~~~~l  151 (698)
T KOG0978|consen   77 QISELLDKISTAETEVDELEQQLEDLQADLEKIRRRSNKLNKHLAEALEHLN--T---YGNGNGSLSGTITVNSTELEEL  151 (698)
T ss_pred             HHHHHHHHHHHHhccHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhccCC--C---CCCcccccCcccccchhhhhhh
Confidence            9999999999999999999999999999999999998887644444332222  1   0000001111111112567777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh-hhHh-hhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004419          184 KDSVEEAKILAADRLSEVEEAQQDNINLSKQLENLQNELND-DKYV-HSSRLYNLVNDQLQHWNVEVERYKALTDSLLID  261 (754)
Q Consensus       184 ~~~l~~~~~~~~~~~~e~~~l~~~~~~~~~el~~l~~~l~~-~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~  261 (754)
                      ...++++.........++..++.....+..++..+...+.. .... .....+.-++            +...+..-..+
T Consensus       152 ~~~iee~~~~~~~~~~ele~lq~~~~~~~~~~~~~~~~l~~~~~~~~~~~~e~~~~~------------~NE~l~~~~~~  219 (698)
T KOG0978|consen  152 RDEIEELRELASTRMEELEKLQLYSDEILRQLDRFRVELRSLKEKVRSETFELRCLQ------------YNEELQRKTME  219 (698)
T ss_pred             ccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHH------------hhhhcccccch
Confidence            78888888877888888888888888888887777776643 1110 0000000000            00000000000


Q ss_pred             HHHHHHHHHHHHHHhhhHHHHHhhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC-ccchHHHHHHHHHHHHHH
Q 004419          262 RSLVLRREKEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKMEEAIQDSG-RKDIKAEFRVMASALSKE  340 (754)
Q Consensus       262 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~l~~~~~~~~-~~~~~~~l~~~~~~l~~~  340 (754)
                      ...+                 .     ....+..+...+.....+++.+....+....+.+ +..+..++..+...+...
T Consensus       220 ~~e~-----------------~-----~~~~~~~lee~~~~~~~e~~~l~~~~e~~~~~~~~~~~in~e~~~L~Ssl~e~  277 (698)
T KOG0978|consen  220 SDEA-----------------I-----NSKKVIKLEEKLAQCVKEYEMLRKEFENNKSQNDLFSSINREMRHLISSLQEH  277 (698)
T ss_pred             hhhh-----------------h-----ccchHHHHHHHHHHHHHHHHHHHHhHHHhHHhhhhhhhHHHHHHHHHHHHHHH
Confidence            0000                 0     0011233333334444444444444444333333 455666777777777777


Q ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHhHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHhhHHHHHHHHHHhcc
Q 004419          341 MGMMEAQLNRWKETADEALSLREKAVSLKVSLSAKTNEQKRLTDKCVEQMAEIKSLKA-LIEKLQKDKLESQIMLDMYGQ  419 (754)
Q Consensus       341 ~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~e~~~l~~-~l~~l~~~~~~l~~~~~~~~~  419 (754)
                      ...+......|.........++.....+...+......+..+.........++..+.. -+..+......++...+.+..
T Consensus       278 ~~~l~~~~~~~k~t~~~~~~lr~~~~s~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (698)
T KOG0978|consen  278 EKLLKEYERELKDTESDNLKLRKQHSSAADSLESKSRDLESLLDKIQDLISQEAELSKKLRSKLLESAKKLKILLREKDR  357 (698)
T ss_pred             HHHHHHHHHHHhcccchHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            7777666666777666777777666666655544444444444444444444444442 122222222233333332223


Q ss_pred             CCCCchhHHHHHHHHHH-HHHHHHHHHhhcchhhhHHHHHHHHHHHHHHHHHH-HHHHHHHHHHH-HHHHHhHh---hHH
Q 004419          420 EGRDPRDLMEIKESERR-AHSQAEVLKNALDEHSLELRVKAANEAEAACQQRL-SAAEAEIIELV-AKLDASER---DVM  493 (754)
Q Consensus       420 ~~~~~~~~~~l~~~~~~-~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~l-~~~~~el~~l~-~~~~~~~~---~~~  493 (754)
                      ......++.....++.. +...++.+..-......+++.....+. ..+..++ .....+...++ ...+....   ++.
T Consensus       358 e~~k~~di~~~k~el~~~~~~~le~~k~~~ke~~~~~~~ka~~E~-e~l~q~l~~~~k~e~~e~~k~~~d~~~r~~~~~~  436 (698)
T KOG0978|consen  358 ESQKERDILVAKSELLKTNELRLEMLKSLLKEQRDKLQVKARAET-ESLLQRLKALDKEERSEIRKQALDDAERQIRQVE  436 (698)
T ss_pred             HhhhhHhHHHHHHHHHHHHHHHHHHHhCCCHHHHhHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHH
Confidence            33333334444443333 444444444433332221111111111 1122222 22222333333 12223333   333


Q ss_pred             HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Q 004419          494 ELEEAMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQQVAERDDLNIKLVSESVKTKQVQSFLLSEKQALARQLQQIN  573 (754)
Q Consensus       494 ~l~~~l~~~~~~~~~l~~e~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~e~~~~~~~~~~l~~e~~~l~~~l~~~~  573 (754)
                      .+...+.........+..++..+...++++++.+..+..++...+...-.+..+...+.+.++.+..+...+..++..+.
T Consensus       437 ~~~e~Lqk~~~~~k~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~  516 (698)
T KOG0978|consen  437 ELSEELQKKEKNFKCLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLK  516 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44455556666667788899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHH
Q 004419          574 ALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKWELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKEL  653 (754)
Q Consensus       574 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~l  653 (754)
                      .........+..++.+...+......+..++..+...++..+....++...+..+...+....+.+..++..+.+...++
T Consensus       517 ~~~~~~~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~el  596 (698)
T KOG0978|consen  517 ASVDKLELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELEL  596 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhhhH-HHHHHHHHHHhccCCcccccccccccccceeccCCCcccHHHHHHHhcc
Q 004419          654 ENERNERKKLEEELMEVNNKVAELTSETGE-AAIQKLQDEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEI  732 (754)
Q Consensus       654 ~~~~~~~~~~~~e~~~~~~~l~~l~~~~~~-~~~~~l~~e~~~~~~~~~C~iC~~~~~~~~~~~CgH~fC~~C~~~~~~~  732 (754)
                      ........++++++..++.++.+++....+ .....+.+++..++..++||+|+.+|++.|+++|||.||+.|+.+++..
T Consensus       597 e~~~~k~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~et  676 (698)
T KOG0978|consen  597 EIEKFKRKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYET  676 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHH
Confidence            999999999999999999999999988775 5688899999999999999999999999999999999999999999999


Q ss_pred             CCCCccccCcCcCCCCCcccCC
Q 004419          733 RHRKCPGCGTAFGQSDVRFVKI  754 (754)
Q Consensus       733 ~~~~Cp~C~~~~~~~d~~~~~~  754 (754)
                      |+++||.|+.+|+++||+||||
T Consensus       677 RqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             hcCCCCCCCCCCCcccccccCC
Confidence            9999999999999999999997

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG3113 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>PF13240 zinc_ribbon_2: zinc-ribbon domain	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF13248 zf-ribbon_3: zinc-ribbon domain	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG3899 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG2979 consensus Protein involved in DNA repair [General function prediction only]	Back alignment and domain information

>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>PRK04023 DNA polymerase II large subunit; Validated	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF14353 CpXC: CpXC protein	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ]	Back alignment and domain information

>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits)

Back alignment and domain information

>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PLN02189 cellulose synthase	Back alignment and domain information

>COG3364 Zn-ribbon containing protein [General function prediction only]	Back alignment and domain information

>PLN02436 cellulose synthase A	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms]	Back alignment and domain information

>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF15616 TerY-C: TerY-C metal binding domain	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1729 consensus FYVE finger containing protein [General function prediction only]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit	Back alignment and domain information

>PLN02195 cellulose synthase A	Back alignment and domain information

>KOG1842 consensus FYVE finger-containing protein [General function prediction only]	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>PF12773 DZR: Double zinc ribbon	Back alignment and domain information

>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PLN02400 cellulose synthase	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>PRK14714 DNA polymerase II large subunit; Provisional	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		754
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-18
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-16
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-14
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	8e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-10
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-07
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	3e-12
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-11
1z6u_A		150	NP95-like ring finger protein isoform B; structura	3e-11
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	3e-11
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	3e-11
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	6e-11
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	7e-11
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	1e-10
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	3e-10
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	6e-10
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	8e-10
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-09
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	1e-09
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-09
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	7e-04
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	3e-09
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	3e-09
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	6e-09
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	1e-08
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	1e-08
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	2e-08
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	4e-08
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	6e-08
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	7e-08
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	7e-08
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	9e-08
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	2e-07
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	3e-07
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	3e-07
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	4e-07
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	1e-06
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	1e-06
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	1e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	1e-06
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	2e-06
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	2e-06
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	3e-06
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	8e-05
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	3e-06
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	4e-06
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	1e-05
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	1e-05
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	3e-05
2ea5_A		68	Cell growth regulator with ring finger domain prot	5e-05
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	1e-04
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	2e-04
2xs1_A		704	Programmed cell death 6-interacting protein; prote	4e-04
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	5e-04
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	5e-04
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 88.4 bits (218), Expect = 5e-18
 Identities = 110/737 (14%), Positives = 234/737 (31%), Gaps = 213/737 (28%)

Query: 8   QVNSIESSSKDGILQYVEEALASRHSSARELMKFIEEVIDAQRVK--TKSI--AEAFHEK 63
           +    +   KD IL   E+A             F++   D + V+   KSI   E     
Sbjct: 10  ETGEHQYQYKD-ILSVFEDA-------------FVDN-FDCKDVQDMPKSILSKEEIDHI 54

Query: 64  LSAEDAIIQLSKIDDMMKEEAKNLHE-------------VMEIIHLKHKEYADQIENYIS 110
           + ++DA+    ++   +  + + + +             +M  I  + ++ +     YI 
Sbjct: 55  IMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIE 114

Query: 111 SHSVDQAEIQHLAG---ELEETMAELEESRRKLVSLKMQKDIA------SGTHSLVPAAA 161
                  + Q  A       +   +L   R+ L+ L+  K++       SG   +   A 
Sbjct: 115 QRDRLYNDNQVFAKYNVSRLQPYLKL---RQALLELRPAKNVLIDGVLGSGKTWV---AL 168

Query: 162 MVNGSVSPEKRPADGR--MDLQELKDSVEEAKILAA--DRLSEVEEAQQDN-INLSKQLE 216
            V  S   + +       ++L+         ++L     ++     ++ D+  N+  ++ 
Sbjct: 169 DVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIH 228

Query: 217 NLQNELND----DKYVHSSRLYNLVNDQLQHWNVEVERYKALTDSLLID---RSLVLRRE 269
           ++Q EL        Y +   L  LV   +   N +   + A       +   + L+  R 
Sbjct: 229 SIQAELRRLLKSKPYENC--L--LVLLNV--QNAKA--WNAF------NLSCKILLTTRF 274

Query: 270 KEINVRAESADAARNTVDDSESRIERLEVQLQKSIIEKNDLGLKM----EEAIQDSGRKD 325
           K++    +   AA  T    +     L     KS++ K  L  +      E +  + R+ 
Sbjct: 275 KQV---TDFLSAATTTHISLDHHSMTLTPDEVKSLLLKY-LDCRPQDLPREVLTTNPRR- 329

Query: 326 IKAEFRVMASALSKEMGMMEAQLNRWKETADEALSLREKAVSLKVSLSA-KTNEQKRLTD 384
           +      + +   ++     A  + WK    + L+       ++ SL+  +  E +++ D
Sbjct: 330 LS-----IIAESIRDG---LATWDNWKHVNCDKLT-----TIIESSLNVLEPAEYRKMFD 376

Query: 385 KCVEQMAEIKSLKALIEKLQKD-KLESQIMLDMY--GQEGRDPRDLME--IKES--ERRA 437
           +              +        + + + L +        D   ++    K S  E++ 
Sbjct: 377 RLS------------V--FPPSAHIPTIL-LSLIWFDVIKSDVMVVVNKLHKYSLVEKQP 421

Query: 438 HSQAEVLKNALDEHSLELRVKAANEAEAACQQRLSAAEAEIIELVAKLDASERDVMELEE 497
                 +       S+ L +K   E E A  +        I++        + D +    
Sbjct: 422 KESTISI------PSIYLELKVKLENEYALHRS-------IVDHYNIPKTFDSDDL---- 464

Query: 498 AMKSKDREAEAYIAEMETIGQAFEDMQTQNQHLLQ-QVAERDDLNIKLVSESVKTKQVQS 556
                    + Y      IG           HL   +  ER  L   +            
Sbjct: 465 ---IPPYL-DQYFYSH--IGH----------HLKNIEHPERMTLFRMV------------ 496

Query: 557 FLLSEKQALARQLQQINALVESAKLRILHAEEQMKACLTEALRYNSEDRHLAVNLETTKW 616
           FL                       R L    + K      +R++S   + + ++  T  
Sbjct: 497 FL---------------------DFRFL----EQK------IRHDSTAWNASGSILNT-- 523

Query: 617 ELADAEKELKWLKSAVTSSDKEYEQIQRKTEDMRKELENE--RNERKKL-EEELMEVNNK 673
            L      LK+ K  +  +D +YE++     D   ++E     ++   L    LM  +  
Sbjct: 524 -LQQ----LKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEA 578

Query: 674 VAELTSETGEAA--IQK 688
           + E      EA   +Q+
Sbjct: 579 IFE------EAHKQVQR 589

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		754
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.6
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.56
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.55
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.53
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.53
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.53
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.52
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.52
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.52
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.51
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.5
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.5
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.49
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.48
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.48
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.47
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.47
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.46
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.46
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.46
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.44
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.44
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.43
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.42
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.39
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	99.39
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.39
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.39
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.38
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.37
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	99.36
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.36
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.36
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	99.36
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.35
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.34
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	99.32
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	99.32
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	99.32
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	99.31
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.31
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.31
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.3
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	99.3
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	99.26
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.25
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.25
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.24
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	99.24
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.24
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	99.23
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	99.23
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.23
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	99.22
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.22
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	99.22
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.2
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	99.18
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.17
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.15
2ea5_A		68	Cell growth regulator with ring finger domain prot	99.15
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.12
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	99.06
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.04
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.95
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.83
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.83
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	98.76
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	98.69
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	98.63
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.52
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	98.32
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.16
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	97.71
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	97.63
1joc_A		125	EEA1, early endosomal autoantigen 1; FYVE domain,	97.4
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.35
3nw0_A		238	Non-structural maintenance of chromosomes element	97.06
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	96.96
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.92
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	96.6
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	96.6
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	96.51
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	96.34
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	96.23
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	95.15
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	95.11
1weo_A		93	Cellulose synthase, catalytic subunit (IRX3); stru	94.59
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	94.5
2fiy_A		309	Protein FDHE homolog; FDHE protein, structural gen	93.32
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	93.11
1z60_A		59	TFIIH basal transcription factor complex P44 subun	92.81
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	92.47
1y02_A		120	CARP2, FYVE-ring finger protein sakura; zinc-bindi	92.38
2zet_C		153	Melanophilin; complex, GTP-binding protein, GTPase	91.94
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	91.55
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	91.49
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	91.16
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	91.15
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	90.12
3mpx_A		434	FYVE, rhogef and PH domain-containing protein 5; s	88.82
1vfy_A		73	Phosphatidylinositol-3-phosphate binding FYVE doma	88.7
2yw8_A		82	RUN and FYVE domain-containing protein 1; structur	87.84
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	87.68
2xqn_T		126	Testin, TESS; metal-binding protein, cytoskeleton,	87.3
1m3v_A		122	FLIN4, fusion of the LIM interacting domain of LDB	87.07
4ayb_P		48	DNA-directed RNA polymerase; transferase, multi-su	86.93
1z2q_A		84	LM5-1; membrane protein, FYVE domain, zinc-finger;	86.63
3t7l_A		90	Zinc finger FYVE domain-containing protein 16; str	86.45
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	86.34
1wfk_A		88	Zinc finger, FYVE domain containing 19; riken stru	85.75
2ct7_A		86	Ring finger protein 31; IBR, structural genomics,	85.45
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	85.42
1x4u_A		84	Zinc finger, FYVE domain containing 27 isoform B;	85.06
1zbd_B		134	Rabphilin-3A; G protein, effector, RABCDR, synapti	84.38
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	83.49
2cup_A		101	Skeletal muscle LIM-protein 1; four and half LIM d	83.16
1dvp_A		220	HRS, hepatocyte growth factor-regulated tyrosine k	83.05
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	83.01
2jne_A		101	Hypothetical protein YFGJ; zinc fingers, two zinc,	82.29
2jtn_A		182	LIM domain-binding protein 1, LIM/homeobox protein	81.91
3zyq_A		226	Hepatocyte growth factor-regulated tyrosine kinas	81.53
2jrp_A		81	Putative cytoplasmic protein; two-zinc binding pro	81.28
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	80.97
2rgt_A		169	Fusion of LIM/homeobox protein LHX3, linker, INSU	80.9

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

Probab=99.60  E-value=1.8e-15  Score=130.28  Aligned_cols=48  Identities=31%  Similarity=0.682  Sum_probs=44.1

Q ss_pred             cccccccccccccceeccCCCcccHHHHHHHhccCCCCccccCcCcCCC
Q 004419          699 ILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQS  747 (754)
Q Consensus       699 ~~~C~iC~~~~~~~~~~~CgH~fC~~C~~~~~~~~~~~Cp~C~~~~~~~  747 (754)
                      .+.|+||++.|.+||++||||+||..|+..|+. ....||.||.+|...
T Consensus        53 ~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~-~~~~CP~Cr~~~~~~  100 (138)
T 4ayc_A           53 ELQCIICSEYFIEAVTLNCAHSFCSYCINEWMK-RKIECPICRKDIKSK  100 (138)
T ss_dssp             HSBCTTTCSBCSSEEEETTSCEEEHHHHHHHTT-TCSBCTTTCCBCCCE
T ss_pred             cCCCcccCcccCCceECCCCCCccHHHHHHHHH-cCCcCCCCCCcCCCC
Confidence            379999999999999999999999999999998 477899999999764

PyMOL of 4ayc

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1	Back alignment and structure

>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens}	Back alignment and structure

>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1	Back alignment and structure

>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens}	Back alignment and structure

>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3	Back alignment and structure

>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X	Back alignment and structure

>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major}	Back alignment and structure

>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1	Back alignment and structure

>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1	Back alignment and structure

>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3	Back alignment and structure

>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1	Back alignment and structure

>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus}	Back alignment and structure

>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A*	Back alignment and structure

>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		754
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	3e-16
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	9e-12
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	8e-11
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	1e-09
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	3e-08
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	2e-07
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	4e-07
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	9e-07
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	5e-06
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	1e-05
d2c2la2		80	g.44.1.2 (A:225-304) STIP1 homology and U box-cont	8e-05
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	1e-04
d1v87a_		114	g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou	5e-04
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	6e-04

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.3 bits (177), Expect = 3e-16
 Identities = 18/60 (30%), Positives = 25/60 (41%)

Query: 691 DEIKDCKAILKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVR 750
           D        + C +C     + V T C HLFC  CI R L++    CP C      +D+ 
Sbjct: 15  DFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLE 74

PyMOL of d1rmda2

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		754
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.65
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.62
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.56
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.55
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.55
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.54
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.49
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.48
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.45
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.44
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.35
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.34
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.27
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.04
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	99.0
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.82
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.47
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	96.98
d1weoa_		93	Cellulose synthase A catalytic subunit 7, IRX3 {Th	95.34
d1z60a1		59	TFIIH p44 subunit cysteine-rich domain {Human (Hom	95.25
d1y02a2		51	Rififylin (FYVE-RING finger protein Sakura) {Human	94.3
d2dmda2		26	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	93.81
d1ibia2		31	Cysteine-rich (intestinal) protein, CRP, CRIP {Jap	92.69
d1zbdb_		124	Effector domain of rabphilin-3a {Rat (Rattus norve	92.57
d2fiya1		290	FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId	91.55
d2jnea1		71	Hypothetical protein YfgJ {Escherichia coli [TaxId	90.88
d1joca1		64	Eea1 {Human (Homo sapiens) [TaxId: 9606]}	89.59
d1vfya_		67	vps27p protein {Baker's yeast (Saccharomyces cerev	87.54
d1dvpa2		72	Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7	86.65
d1wffa_		85	ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus	83.95
d2epqa1		32	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	83.57
d1wila_		89	Hypothetical protein KIAA1045 {Human (Homo sapiens	83.08
d2dlqa4		27	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	82.04
d1lkoa2		44	Rubrerythrin, C-terminal domain {Desulfovibrio vul	81.67
d1wfpa_		74	Zinc finger A20 and AN1 domains containing protein	81.59
d2dasa1		49	Zinc finger MYM-type protein 5 {Human (Homo sapien	81.18

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.65  E-value=1.2e-17  Score=125.00  Aligned_cols=52  Identities=33%  Similarity=0.676  Sum_probs=48.8

Q ss_pred             ccccccccccccceeccCCCcccHHHHHHHhccCCCCccccCcCcCCCCCcc
Q 004419          700 LKCGVCFDRPKEVVITKCFHLFCNPCIQRNLEIRHRKCPGCGTAFGQSDVRF  751 (754)
Q Consensus       700 ~~C~iC~~~~~~~~~~~CgH~fC~~C~~~~~~~~~~~Cp~C~~~~~~~d~~~  751 (754)
                      +.|+||++.|.+||+++|||+||..|+..|+..+.++||.||.+|...|+.+
T Consensus        24 l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~   75 (86)
T d1rmda2          24 ISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLES   75 (86)
T ss_dssp             TBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBC
T ss_pred             cCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccC
Confidence            7999999999999999999999999999999878889999999999888753

PyMOL of d1rmda2

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]}	Back information, alignment and structure

>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2dasa1 g.39.1.17 (A:8-56) Zinc finger MYM-type protein 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure