Citrus Sinensis ID: 004423

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750----
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
ccccccHHHccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEccccccccHHHHHHHcccccccEEccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEEEcccEEEEEEEcccccHHEEccccEEEEcccccccccc
cccHHHHHcccccccccccccccccccccccccEEEEcEEEEEcccccccccEEEEEEcccccccccccccccccccHHHHccccccccEEEEEcccccccccEEEEcccccccccHccccccccccccccEcccEEEEEcccccccccccccccccccccccHHHHHHccccccccccccccccccccEEEEcccccEEEEEccccccHHHHHHHccccccEEccccccccccccccccccHHHcHHHHHHHHHHHHcccccccccccHccccccccccccccccEEEccccccccEEEEEcccccccccccccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEccccccccccccccccccccccccccEEEEEEccccccccccccccccccccHcccccccccccccEEEcccccccccccccccccccccccccccccccEEccccccEEEccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHccccccccccHHHccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccEEEEEEEcccccEEEEEEccccEEEEEEcccEEEEEccHcccccc
MVAAEDYARRFESGYvataskdiageeqgqsntNVMCRLCFVGENEGCERARrmlsckscgkkyhrnCLKNWAqnrdlfhwsswkcpscriceicrrtgdpnkfmfcrrcdaayhcycqhpphknvssgpylcpkhtkchscgsnvpgnglsVRWFLGYtccdacgrlfvkgnycpvclkvyrdsestpmvccdvcqrwvhcqcdgisdekYLQFQVdgnlqyrcptcrgecyqvRDLEDAVRELWRRKDMADKDLIASLRAaaglptedeifsispysddeengpvvlknefGRSLKLSLkgvvdkspkkvKEHGKKWlnkkyprkkgyqmplnskpepdqsfegyhdvhsygnsfgddtqspknegldipssvagivshtegvcsisqpgilkhkyvdevmvsdddkisrvkfktskphdldsgeddgkhvsksktiKAKKLVINLGArkinvtnsprsdasscqreqdlttsngiedpslqrmnskfvldrhdgssklgdgdrvdhssqsrglkiagrggnvikfgrvrqevsdsntkvsrgssadehepehmhvlsgkrnidRSRAAVSRVGEVAALrgdrkqlesrpnasresnddtsvlqslpkdskpplrlkfrkpnlenqnsqvsqpeeEKSLIkgqrskrkrpspftektlfnededaaQSNQDSLMSEIMDANWILKKLGKDAIGKRVEvhqqsdnswhkgvvTDTVEGTSTLSITLDDSRVKTLElgkqgvrfvpqkqkrsms
mvaaedyarrfesgyvataskdiageeqgqsntnVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLraaaglptedEIFSispysddeenGPVVLKNEFGRSLKLslkgvvdkspkkvkehgkkwlnkkyprkkgyqmplnSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEgvcsisqpgilkhkyvDEVMvsdddkisrvkfktskphdldsgeddgkhvsksktikakklvinlgarkinvtnsprsdasscqreqdlttsngiedpslqrMNSKFVLDRHDGssklgdgdrvdhssqsrglkiagrggnvikfgrvrqevsdsntkvsrgssadehepehmhvlsgkrnidrsRAAVSRVgevaalrgdrkqlesrpnasresnddtsvlqslpkdskpplrlkfrkpnlenqnsqvsqpeeekslikgqrskrkrpspftektlfnededaAQSNQDSLMSEIMDANWILKKLGKDAIGKRVevhqqsdnswhkgvvTDTVEgtstlsitlddsrvktlelgkqgvrfvpqkqkrsms
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
********************************TNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFS****************************************************************************************************VAGIVSHTEGVCSISQPGILKHKYVDEVMV**************************************KLVINLGA**************************************************************************VIKF******************************************************************************************************************************************************IMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTL*******************
***********************************MCRLCFVGEN*GCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCR****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************EIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVR***********
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGV***********GKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFK********************KTIKAKKLVINLGARKINVT****************TTSNGIEDPSLQRMNSKFVLDRHDGSSKL*************GLKIAGRGGNVIKFGRVRQ************************VLSGKRNIDRSRAAVSRVGEVAALRG**********************QSLPKDSKPPLRLKFRKPNLE****************************FTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFV*********
******************************SNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGE********DAVRELWRRKDMADKDLIASLRAAAGLPTEDEIF*ISPYSDDEENGPVVLKNEFGRSLKLSLKGVVD**************************************************************************************ILKHKYVDEVMVSDDDKISRVKFKTSK********************KAKKLVINLGA****************************************************************GLKIA***G***K************************************************************************************SKPPLRLKFRKPN***************************************************MSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQ*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query754 2.2.26 [Sep-21-2011]
O08550 2713 Histone-lysine N-methyltr yes no 0.232 0.064 0.333 8e-25
Q9UMN6 2715 Histone-lysine N-methyltr yes no 0.232 0.064 0.333 9e-25
Q8NEZ4 4911 Histone-lysine N-methyltr no no 0.237 0.036 0.308 1e-23
Q8BRH4 4903 Histone-lysine N-methyltr no no 0.237 0.036 0.308 2e-23
Q6PDK2 5588 Histone-lysine N-methyltr no no 0.248 0.033 0.297 3e-22
Q03164 3969 Histone-lysine N-methyltr no no 0.245 0.046 0.314 4e-22
O14686 5537 Histone-lysine N-methyltr no no 0.248 0.033 0.292 6e-22
P55200 3966 Histone-lysine N-methyltr no no 0.245 0.046 0.305 9e-21
Q24742 3828 Histone-lysine N-methyltr N/A no 0.286 0.056 0.264 9e-18
P20659 3726 Histone-lysine N-methyltr no no 0.283 0.057 0.253 3e-16
>sp|O08550|MLL4_MOUSE Histone-lysine N-methyltransferase MLL4 OS=Mus musculus GN=Wbp7 PE=1 SV=3 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 94/183 (51%), Gaps = 8/183 (4%)

Query: 54   MLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMF-CRRCDA 112
            ++ C+ C   +H  CL+  A+     H  +W C  C+ C +C R G  +K +  C RC  
Sbjct: 1221 LVFCQVCCDPFHPFCLEE-AERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRH 1279

Query: 113  AYHCYCQHPPHKNVSSG---PYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLF 169
            AYH  C  P +   ++     ++C    +C SCG+  PG    V W   Y+ C  C  L+
Sbjct: 1280 AYHPACLGPSYPTRATRRRRHWICSACVRCKSCGAT-PGKNWDVEWSGDYSLCPRCTELY 1338

Query: 170  VKGNYCPVCLKVYRDSE-STPMVCCDVCQRWVHCQCDGISDEKY-LQFQVDGNLQYRCPT 227
             KGNYCP+C + Y D++  + M+ C  C  WVH +C+G+SDE Y +   +  ++ Y C  
Sbjct: 1339 EKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGP 1398

Query: 228  CRG 230
            C G
Sbjct: 1399 CAG 1401
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q9UMN6|MLL4_HUMAN Histone-lysine N-methyltransferase MLL4 OS=Homo sapiens GN=WBP7 PE=1 SV=1 Back     alignment and function description
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description
>sp|Q6PDK2|MLL2_MOUSE Histone-lysine N-methyltransferase MLL2 OS=Mus musculus GN=Mll2 PE=1 SV=2 Back     alignment and function description
>sp|Q03164|MLL1_HUMAN Histone-lysine N-methyltransferase MLL OS=Homo sapiens GN=MLL PE=1 SV=5 Back     alignment and function description
>sp|O14686|MLL2_HUMAN Histone-lysine N-methyltransferase MLL2 OS=Homo sapiens GN=MLL2 PE=1 SV=2 Back     alignment and function description
>sp|P55200|MLL1_MOUSE Histone-lysine N-methyltransferase MLL OS=Mus musculus GN=Mll PE=1 SV=3 Back     alignment and function description
>sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 Back     alignment and function description
>sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
449436315847 PREDICTED: uncharacterized protein LOC10 0.945 0.841 0.656 0.0
224106097845 predicted protein [Populus trichocarpa] 0.932 0.831 0.633 0.0
356544287845 PREDICTED: uncharacterized protein LOC10 0.968 0.863 0.611 0.0
356529861820 PREDICTED: uncharacterized protein LOC10 0.932 0.857 0.601 0.0
297736278679 unnamed protein product [Vitis vinifera] 0.720 0.799 0.740 0.0
297833588778 protein binding protein [Arabidopsis lyr 0.875 0.848 0.581 0.0
145338256779 PHD finger-containing protein [Arabidops 0.875 0.847 0.573 0.0
6648214764 unknown protein [Arabidopsis thaliana] 0.855 0.844 0.558 0.0
413916644819 RING/FYVE/PHD-type zinc finger family pr 0.915 0.842 0.460 1e-174
357151790809 PREDICTED: uncharacterized protein LOC10 0.908 0.846 0.441 1e-168
>gi|449436315|ref|XP_004135938.1| PREDICTED: uncharacterized protein LOC101208296 [Cucumis sativus] gi|449488832|ref|XP_004158186.1| PREDICTED: uncharacterized protein LOC101230410 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/766 (65%), Positives = 584/766 (76%), Gaps = 53/766 (6%)

Query: 5   EDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKY 64
           EDYARRFESG +  AS +I GEEQGQSN NVMCR+CF GENE  ERAR+MLSCK+CGKKY
Sbjct: 119 EDYARRFESGNL-DASGNIVGEEQGQSNVNVMCRICFFGENESSERARKMLSCKTCGKKY 177

Query: 65  HRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHK 124
           HR+CLK+WAQ+RDLFHWSSW CPSCR CE+CRRTGDPNKFMFC+RCD AYHCYCQHPPHK
Sbjct: 178 HRSCLKSWAQHRDLFHWSSWTCPSCRACEVCRRTGDPNKFMFCKRCDGAYHCYCQHPPHK 237

Query: 125 NVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRD 184
           NVSSGPYLCPKHT+CHSCGSNVPGNG SVRWFLGYT CDACGRLFVKGNYCPVCLKVYRD
Sbjct: 238 NVSSGPYLCPKHTRCHSCGSNVPGNGQSVRWFLGYTFCDACGRLFVKGNYCPVCLKVYRD 297

Query: 185 SESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRE 244
           SESTPMVCCD+CQRWVHC CD ISDEKYLQFQ+DGNLQY+C  CRGECYQV++LEDAV+E
Sbjct: 298 SESTPMVCCDICQRWVHCHCDSISDEKYLQFQIDGNLQYKCTACRGECYQVKNLEDAVQE 357

Query: 245 LWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGV 304
           +WRR+D AD+DLI +LRAAAGLPT+DEIFSISPYSDDEENGP V+KNEFGRSLKLSLKG 
Sbjct: 358 IWRRRDEADRDLIVNLRAAAGLPTQDEIFSISPYSDDEENGPAVVKNEFGRSLKLSLKGF 417

Query: 305 VDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSP 364
            DK PKK K++GKK  NKKY ++KG   PL ++ E DQ+FE  +DV   G   G++    
Sbjct: 418 ADKVPKKSKDYGKKSSNKKYAKEKG--TPLANQSELDQNFEVRNDVQQSGFGEGNEKNGG 475

Query: 365 -----KNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTS 418
                 NEGLD  S VAG +SH EG CS++QPG+LKHK+VDEVMVSD++K S+ V+ K S
Sbjct: 476 LLPQNNNEGLDT-SPVAGSLSHNEGTCSVNQPGVLKHKFVDEVMVSDEEKTSKVVQIKAS 534

Query: 419 KPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGI 478
           K   LD+GED GK+ SKSKT K KKLVINLGARKINV  SP+SDASSCQR QDL  SN  
Sbjct: 535 KAQGLDTGEDSGKYASKSKTAKGKKLVINLGARKINVATSPKSDASSCQRGQDLAVSN-- 592

Query: 479 EDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDS 538
                                    G++V++SSQS GLK      +V  FG+VR   SD+
Sbjct: 593 -------------------------GEKVNNSSQSTGLKAGETENSVPSFGKVRFGSSDT 627

Query: 539 NTKVSRGSSADEHE---PEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDR----KQLESR 591
           NT   RG++A   E   P+   V S KRN++ S  AV  +G V+ ++ ++    KQLES 
Sbjct: 628 NTTFGRGNTASGSEVGPPDGTRVFSRKRNMEGSTPAVGSLGGVSTVKEEKVPSGKQLESG 687

Query: 592 PNASRESNDD---TSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSK 648
            +   + +DD   T + QSLP+DSKP L+ KF+KP L+N   Q+S  EEEKSL+KGQRSK
Sbjct: 688 SHICNDGHDDNGQTPLPQSLPRDSKPLLKFKFKKPPLDN---QISCHEEEKSLVKGQRSK 744

Query: 649 RKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSW 708
           RKRPSP  EK  FNE ED  +S+QD+L+    DANWILKKLGKDAIGKRVEV   SD SW
Sbjct: 745 RKRPSPLMEKVPFNEVEDLTRSHQDNLLD---DANWILKKLGKDAIGKRVEVQHPSDKSW 801

Query: 709 HKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS 754
            KGVV D ++GTSTLS+ LDD R KTLELGKQG+R VP KQKRS S
Sbjct: 802 QKGVVRDMIDGTSTLSVALDDGREKTLELGKQGIRLVPLKQKRSKS 847

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106097|ref|XP_002314042.1| predicted protein [Populus trichocarpa] gi|222850450|gb|EEE87997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544287|ref|XP_003540585.1| PREDICTED: uncharacterized protein LOC100815407 [Glycine max] Back     alignment and taxonomy information
>gi|356529861|ref|XP_003533505.1| PREDICTED: uncharacterized protein LOC100809429 [Glycine max] Back     alignment and taxonomy information
>gi|297736278|emb|CBI24916.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297833588|ref|XP_002884676.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297330516|gb|EFH60935.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145338256|ref|NP_187459.2| PHD finger-containing protein [Arabidopsis thaliana] gi|110739634|dbj|BAF01725.1| hypothetical protein [Arabidopsis thaliana] gi|110741394|dbj|BAF02246.1| hypothetical protein [Arabidopsis thaliana] gi|332641110|gb|AEE74631.1| PHD finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6648214|gb|AAF21212.1|AC013483_36 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413916644|gb|AFW56576.1| RING/FYVE/PHD-type zinc finger family protein [Zea mays] Back     alignment and taxonomy information
>gi|357151790|ref|XP_003575905.1| PREDICTED: uncharacterized protein LOC100821635 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
TAIR|locus:2077457779 AT3G08020 [Arabidopsis thalian 0.782 0.757 0.571 4.1e-184
TAIR|locus:2083715696 AT3G52100 [Arabidopsis thalian 0.322 0.349 0.766 3.6e-161
UNIPROTKB|H7BYJ6366 MLL "MLL cleavage product C180 0.240 0.494 0.331 7.3e-29
UNIPROTKB|E1BKN0 2711 LOC785776 "Uncharacterized pro 0.249 0.069 0.326 7.8e-26
MGI|MGI:109565 2713 Wbp7 "WW domain binding protei 0.249 0.069 0.321 1.3e-25
UNIPROTKB|Q9UMN6 2715 WBP7 "Histone-lysine N-methylt 0.249 0.069 0.321 1.6e-25
UNIPROTKB|J9NZ02 2194 RBM42 "Uncharacterized protein 0.249 0.085 0.316 3.4e-25
RGD|1308331 2705 Mll4 "myeloid/lymphoid or mixe 0.249 0.069 0.321 3.5e-25
UNIPROTKB|F1PTZ8 2728 RBM42 "Uncharacterized protein 0.249 0.068 0.316 4.5e-25
FB|FBgn0263667 1482 Lpt "Lost PHDs of trr" [Drosop 0.360 0.183 0.304 5.1e-25
TAIR|locus:2077457 AT3G08020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1786 (633.8 bits), Expect = 4.1e-184, P = 4.1e-184
 Identities = 358/626 (57%), Positives = 445/626 (71%)

Query:     3 AAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGK 62
             AAEDYARRFESG     S D AGEE G S  N+MCR+CF+GE EG +RARRMLSCK CGK
Sbjct:   114 AAEDYARRFESGVNDLTSNDHAGEELGHSGMNIMCRMCFLGEGEGSDRARRMLSCKDCGK 173

Query:    63 KYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPP 122
             KYH+NCLK+WAQ+RDLFHWSSW CPSCR+CE+CRRTGDPNKFMFC+RCDAAYHCYCQHPP
Sbjct:   174 KYHKNCLKSWAQHRDLFHWSSWSCPSCRVCEVCRRTGDPNKFMFCKRCDAAYHCYCQHPP 233

Query:   123 HKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVY 182
             HKNVSSGPYLCPKHT+CHSC S VPGNGLSVRWFL YTCCDACGRLFVKGNYCPVCLKVY
Sbjct:   234 HKNVSSGPYLCPKHTRCHSCDSTVPGNGLSVRWFLSYTCCDACGRLFVKGNYCPVCLKVY 293

Query:   183 RDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAV 242
             RDSESTPMVCCD+CQRWVHC CDGISD+KY+QFQVDG LQY+C TCRGECYQV+DL+DAV
Sbjct:   294 RDSESTPMVCCDICQRWVHCHCDGISDDKYMQFQVDGKLQYKCATCRGECYQVKDLQDAV 353

Query:   243 RELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLK 302
             +ELW++KD+ DK+LIASLRAAAGLPTE+EIFSI P+SDDEENGPV      GRSLK S+K
Sbjct:   354 QELWKKKDVVDKELIASLRAAAGLPTEEEIFSIFPFSDDEENGPVS-----GRSLKFSIK 408

Query:   303 GVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQ 362
             G+V+KSPKK KE+GK   +KK+  KKG     ++K EP+   E   +    G    D+  
Sbjct:   409 GLVEKSPKKSKEYGKHSSSKKHASKKGS----HTKLEPEVHQEIGSERRRLGGVRIDNVG 464

Query:   363 SPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTSKPH 421
                NE  D+ SSVAGI       CS  +P I+KHK VD+VMV+D++K SR V+ K SKPH
Sbjct:   465 FQINEQSDVNSSVAGI-------CSTHEPKIVKHKRVDDVMVTDEEKPSRIVRIKCSKPH 517

Query:   422 DLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDA-SSCQREQDLTTSNGIE- 479
             D DS ED  ++  + K++KAKKLVINLGARKINV+ S +S+  S   R++D +T  G + 
Sbjct:   518 DSDS-EDTLRNAGEEKSVKAKKLVINLGARKINVSGSSKSNVVSHLSRDKDQSTLGGDKV 576

Query:   480 DPSLQ----RMNSKFVLDRHDGS-SKLGDGDRVDHSSQSRGLKIAGRGG---NVIKFGR- 530
             D + +    +++ +F   + +GS +  G   +   +S S G  +  +      + K  R 
Sbjct:   577 DQTGEVRTLKISGRFGKTQSEGSKATFGSVTQFPAASTSEGNHVDDKTSISPALQKEARP 636

Query:   531 -VRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQL- 588
              ++ ++   N+     S   + E E +    G+R+    R   S + ++A+L+ D +   
Sbjct:   637 LLKFKLRKPNSGDQTSSVTTQSEDEKLSSAKGQRS---KRKRPSSLVDMASLKEDGEATT 693

Query:   589 ESRPNASR--ESNDDTSVLQSLPKDS 612
              S  + SR  E  D   +L+ L KDS
Sbjct:   694 HSHQDNSRNDEMMDANWILKKLGKDS 719
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2083715 AT3G52100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYJ6 MLL "MLL cleavage product C180" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKN0 LOC785776 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:109565 Wbp7 "WW domain binding protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UMN6 WBP7 "Histone-lysine N-methyltransferase MLL4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ02 RBM42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308331 Mll4 "myeloid/lymphoid or mixed-lineage leukemia 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTZ8 RBM42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0263667 Lpt "Lost PHDs of trr" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
pfam0062851 pfam00628, PHD, PHD-finger 9e-07
smart0024947 smart00249, PHD, PHD zinc finger 3e-06
smart0024947 smart00249, PHD, PHD zinc finger 4e-05
pfam0062851 pfam00628, PHD, PHD-finger 5e-05
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 45.9 bits (109), Expect = 9e-07
 Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 91  ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPP--HKNVSSGPYLCPKHTKCHSC 142
            C +C +  D  + + C  CD  +H  C  PP   + +  G + CP   +C   
Sbjct: 1   YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCP---ECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 754
KOG4443694 consensus Putative transcription factor HALR/MLL3, 100.0
KOG1244336 consensus Predicted transcription factor Requiem/N 99.64
KOG1512381 consensus PHD Zn-finger protein [General function 99.49
KOG0954893 consensus PHD finger protein [General function pre 99.33
KOG0956 900 consensus PHD finger protein AF10 [General functio 98.7
KOG4299613 consensus PHD Zn-finger protein [General function 98.64
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.54
KOG0383696 consensus Predicted helicase [General function pre 98.5
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.39
KOG4299613 consensus PHD Zn-finger protein [General function 98.34
COG5141669 PHD zinc finger-containing protein [General functi 98.3
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.28
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 98.22
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.21
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.18
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.07
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.07
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.93
KOG1512381 consensus PHD Zn-finger protein [General function 97.92
KOG4443694 consensus Putative transcription factor HALR/MLL3, 97.9
KOG1244336 consensus Predicted transcription factor Requiem/N 97.89
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.8
KOG0383696 consensus Predicted helicase [General function pre 97.64
KOG1973274 consensus Chromatin remodeling protein, contains P 97.51
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.33
KOG1973274 consensus Chromatin remodeling protein, contains P 97.21
COG5141669 PHD zinc finger-containing protein [General functi 97.13
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.13
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.02
KOG0954893 consensus PHD finger protein [General function pre 96.97
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.9
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 96.82
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.71
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.61
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.59
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 96.53
KOG0957707 consensus PHD finger protein [General function pre 96.53
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 96.45
KOG0957707 consensus PHD finger protein [General function pre 96.28
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 96.22
KOG2752345 consensus Uncharacterized conserved protein, conta 95.8
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 95.66
smart0074361 Agenet Tudor-like domain present in plant sequence 95.07
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 93.94
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 93.91
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 93.84
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 93.59
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 93.31
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 92.51
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 91.72
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.42
KOG1952950 consensus Transcription factor NF-X1, contains NFX 89.9
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 88.36
PF09038122 53-BP1_Tudor: Tumour suppressor p53-binding protei 88.29
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 87.92
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 87.92
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 85.67
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 85.13
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 84.91
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 83.4
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 82.46
PF13901202 DUF4206: Domain of unknown function (DUF4206) 82.05
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 81.28
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 80.9
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-75  Score=649.01  Aligned_cols=591  Identities=40%  Similarity=0.684  Sum_probs=496.1

Q ss_pred             cccccccccccCCccCCCceEEeCcCCCccchhccCCCccccccCCCCCccCCCCCccccccccCCCCCceeCCCCCCcc
Q 004423           35 VMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAY  114 (754)
Q Consensus        35 ~~C~vC~~gG~~gs~~~eeLL~Cd~C~rsYH~~CL~p~~e~~~~v~~~~W~Cp~Ck~C~vC~~sgd~~kLL~Cd~C~raY  114 (754)
                      .+|.+|...|   ......|+.|..|+..||++|+..|......+  ..|.|+.|+.|..|+..+++.++++|+.|+..|
T Consensus        19 ~mc~l~~s~G---~~~ag~m~ac~~c~~~yH~~cvt~~~~~~~l~--~gWrC~~crvCe~c~~~gD~~kf~~Ck~cDvsy   93 (694)
T KOG4443|consen   19 LMCPLCGSSG---KGRAGRLLACSDCGQKYHPYCVTSWAQHAVLS--GGWRCPSCRVCEACGTTGDPKKFLLCKRCDVSY   93 (694)
T ss_pred             hhhhhhcccc---ccccCcchhhhhhcccCCcchhhHHHhHHHhc--CCcccCCceeeeeccccCCcccccccccccccc
Confidence            4666666655   45566899999999999999999998876554  449999999999999999999999999999999


Q ss_pred             ccccCCCCCccCCCCCcccCCCcccCCCCCCCCCCCCccccccCccccCCCcccccCCccCccccccccCCCCCCceecc
Q 004423          115 HCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCD  194 (754)
Q Consensus       115 H~~CL~Ppl~~vp~g~W~CP~C~~C~~Cg~~~pgk~~s~RW~~~~slC~~C~~lf~KgnyCpVC~K~Y~Dsdgg~MLqCD  194 (754)
                      |.+|+.|++..++.+.|+|+.|..|..|+...++  +..+|..++..|.+|..    ..|||+|.+.|++.+..+|++|+
T Consensus        94 h~yc~~P~~~~v~sg~~~ckk~~~c~qc~~~lpg--~s~~~~~~~~~~~~c~s----~~~cPvc~~~Y~~~e~~~~~~c~  167 (694)
T KOG4443|consen   94 HCYCQKPPNDKVPSGPWLCKKCTRCRQCDSTLPG--LSLDLQEGYLQCAPCAS----LSYCPVCLIVYQDSESLPMVCCS  167 (694)
T ss_pred             cccccCCccccccCcccccHHHHhhhhccccccc--cchhhhccCcccccccc----cccCchHHHhhhhccchhhHHHH
Confidence            9999999999999999999999999999998876  67788888999999985    68999999999999999999999


Q ss_pred             CcCCeecccCCCCChHHHhhhccCCCCceeCCCCCCCCCCCCchHHHHHHhhcccccccHHHHHHHHHhcCCCCcccccc
Q 004423          195 VCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFS  274 (754)
Q Consensus       195 sC~~wFH~eCd~LsdE~ye~~~~d~d~~Y~CptCr~~~~qIk~lkda~~r~Wrare~~~~dvI~slRaa~GLp~~Eei~~  274 (754)
                      .|.+|.|..|+++.++.|.++.++  ..|.|.+||.+.++++++.++..+.|++.......+|..+++..-         
T Consensus       168 ~c~rwsh~~c~~~sdd~~~q~~vD--~~~~CS~CR~es~qvKdi~~~vqe~~~~k~~~~~~~~~tls~~a~---------  236 (694)
T KOG4443|consen  168 ICQRWSHGGCDGISDDKYMQAQVD--LQYKCSTCRGESYQVKDISDALQETWKAKDKPDKILIATLSAQAA---------  236 (694)
T ss_pred             HhcccccCCCCccchHHHHHHhhh--hhcccceeehhhhhhhhHHHHHHhhcchhhccccceeehhhhhhh---------
Confidence            999999999999999999998876  899999999999999999999999999998888888876666644         


Q ss_pred             CCCCCCcccCCCcchhhhhhhhhcccccCccCCCCCchhhhhccccCccCCCccCCCCCCCCCCCCCCCCCCcccccccC
Q 004423          275 ISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYG  354 (754)
Q Consensus       275 ~~p~sdD~~~~p~v~~~~~~~~~k~s~k~~~~k~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (754)
                            |..+++++     .++.+.+.|+..++++.++....+..+.+.+...+|..+     .+     ..+.|+.+|+
T Consensus       237 ------lq~~~~~~-----~~s~~~k~~~~~~~~~~~s~a~gq~s~~~~~~~~~g~~~-----dp-----~~~~e~~sE~  295 (694)
T KOG4443|consen  237 ------LQMHHAVI-----GDSSADKAGSSANSGSATSGASGQLSLTTANTPTLGVSL-----DP-----VKLQEVGSER  295 (694)
T ss_pred             ------hhhccccc-----cccccccccCcccCCcccccccccCCcccccccccCccc-----ch-----hhhhhccchh
Confidence                  34445555     677788999999999999999999999888888888777     22     4566777777


Q ss_pred             ----CCCCCCCCCCCCCCCCCCCCcccccccCCCccccCCCCcccccccceeeccCCCccce-eEeecCCCCCCCCCCcc
Q 004423          355 ----NSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTSKPHDLDSGEDD  429 (754)
Q Consensus       355 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  429 (754)
                          ..+..+...+       .++...+.+..|++++-.-+-.+.+..+.+.||+.+|...| ++||++||+++++ ++.
T Consensus       296 ~a~~~v~~e~vv~d-------~t~~~~~~~~~e~~~~p~~r~~~~~~m~~~~~vt~~e~~~r~~r~~Stk~~~~~~-~~~  367 (694)
T KOG4443|consen  296 KAKLLVKQEAVVKD-------STETPTVNSRAEEIGTPEKRLNANATMTAINQVTSEEKPTRTARIKSTKPPDSDS-ENN  367 (694)
T ss_pred             hhhhccchhhhhhc-------cccCcccccchhhccCccccccccceeeeeeccccccccceeeecCCCCCCCcch-hhh
Confidence                3455555555       44445556778999999999999999999999985554445 9999999999999 588


Q ss_pred             ccccccccccceeeEEEeeccccccccCCCCCCCcchhcccccccCCCCCChhhhhccccccccccCCCCcCCCCCcccc
Q 004423          430 GKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDH  509 (754)
Q Consensus       430 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  509 (754)
                      ..+++...++++++||||+|+|+||+.++.+.++.+---+-+     +    ++..++                |+++|-
T Consensus       368 ~r~a~edn~ll~~~l~~n~st~kl~~~~~t~~~v~~~~~~a~-----l----~~~~l~----------------~~~~~s  422 (694)
T KOG4443|consen  368 LRSAAEDNALLAKKLVINSSSRKLNVISSTSAHVGSASSSAP-----L----SQRKLI----------------GVRAPS  422 (694)
T ss_pred             hhhccchhhHHhhhcccccCccccccccccccccccccccCh-----h----hHHHhc----------------cCcCcc
Confidence            888999999999999999999999999999998874322211     1    222222                488888


Q ss_pred             ccccccceecccCCceeeeecccccccccCcccCCCCCCCCCCccccccccccchhhhhhhhcccccceeEEecCccccc
Q 004423          510 SSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLE  589 (754)
Q Consensus       510 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  589 (754)
                      +++.|++..+         |+.+.-                                         +.++.++.++....
T Consensus       423 ~~k~rsle~e---------gs~~~~-----------------------------------------~~v~~~~~a~~ssg  452 (694)
T KOG4443|consen  423 MGKVRSLEDE---------GSRGVI-----------------------------------------GPVTTATAAAGSSG  452 (694)
T ss_pred             hhhhhhhhhh---------cccCCC-----------------------------------------CCcCCcCccccccc
Confidence            8888888662         222221                                         12233333332222


Q ss_pred             cCCCccccCCCCcccccCCCCCCCCceeeeecCCCccCCCCCcCchHH--HhhhhhcccccCCCCCccccccccccc-hh
Q 004423          590 SRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEE--EKSLIKGQRSKRKRPSPFTEKTLFNED-ED  666 (754)
Q Consensus       590 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~k~k~~~~~~~~~~~~~~~~--~~~~~~gqrskrkr~~~~~~~~~~~~~-~~  666 (754)
                      .+.+..  ...+.+-+.+..++.+|+|+++|++|+.+.|++..++..|  .+...+|+|+|+||+++..+++.++++ |.
T Consensus       453 ss~~~~--~s~t~g~~~s~~~~~~~~l~~a~a~~~s~~~~s~~~v~~~~E~~~d~~~a~~~n~~~n~~~~~~~~~~~~q~  530 (694)
T KOG4443|consen  453 SSGDVK--TSTTPGTVASGQKSQRPLLKSAIAKPNSAVQISEPGVGSEAEQKSDGKGARSKNKRQNQAPPPPPPPEDQQQ  530 (694)
T ss_pred             CCCCCC--CCCCCCcCCcchhhhhhhhhhhhhcCCcccccccccccccccccCCcccccccccccCCCCCCCCCcchhhh
Confidence            222222  2233444668899999999999999999999987776655  559999999999999999999999999 99


Q ss_pred             hhhhhhh-hhhhhhhhhHHHHHHhccccccceEEEEecCCCceeeeeeEEee--cCeeEEEEEecCCcccceecCceeeE
Q 004423          667 AAQSNQD-SLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTV--EGTSTLSITLDDSRVKTLELGKQGVR  743 (754)
Q Consensus       667 ~~~~~~~-~~~~~~~d~~~il~~lg~da~~krvev~~~sd~~w~~g~v~~~~--~~~~~~~v~~d~g~~~~~~~gk~~vr  743 (754)
                      ...+++| ++.||||||+|||++||+||+|||+|||-.++|+|.+|+|+.|+  .+||.|.|++|+|.++|+++|+|+||
T Consensus       531 l~~s~~d~~~~d~~~~a~~~~~~~g~~~~~~~t~vhs~~~ns~~~g~vt~~~s~~~~s~~~~~~~~~~v~~~~~~~~~v~  610 (694)
T KOG4443|consen  531 LQPSPHDVSRLDEMVDAEWILKKLGKDAKTKRTEVHSKSMNSWPKGNVTIVISTGQTSPLEVQLKPGAVKTVELGKQGVR  610 (694)
T ss_pred             cCCCHHHHHHHHhhhccccccccCCCCCCcceeccccCCCCCCCCccceeeeccCCcccceeeccccccccccccccccc
Confidence            9999999 79999999999999999999999999999999999999999998  89999999999999999999999999


Q ss_pred             eeeccccccC
Q 004423          744 FVPQKQKRSM  753 (754)
Q Consensus       744 ~~~~~~k~~~  753 (754)
                      |+|++|||.+
T Consensus       611 f~pe~~k~~~  620 (694)
T KOG4443|consen  611 FLPEKQKRVR  620 (694)
T ss_pred             cChhhhhccc
Confidence            9999999876

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09038 53-BP1_Tudor: Tumour suppressor p53-binding protein-1 Tudor; InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
2ysm_A111 Solution Structure Of The First And Second Phd Doma 9e-08
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 4e-07
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 2e-05
2ln0_A110 Structure Of Moz Length = 110 5e-05
3v43_A112 Crystal Structure Of Moz Length = 112 6e-05
1f62_A51 Wstf-Phd Length = 51 4e-04
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
Query: 57  CKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHC 116
           C +CG+ YH  CL            + W+CP C++C+ C+++G+ +K + C  CD  YH 
Sbjct: 25  CTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHT 81
Query: 117 YCQHPPHKNVSSGPYLC 133
           +C  P  K+V +  + C
Sbjct: 82  FCLQPVMKSVPTNGWKC 98
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 7e-28
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 6e-04
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 8e-28
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-10
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 4e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-24
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 8e-07
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 5e-20
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 6e-04
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 7e-15
1we9_A64 PHD finger family protein; structural genomics, PH 3e-12
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 8e-12
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 1e-10
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-09
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 2e-09
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-09
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 1e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-08
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 4e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 7e-08
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 8e-08
1wem_A76 Death associated transcription factor 1; structura 1e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-05
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 2e-07
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 4e-07
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 5e-07
1wee_A72 PHD finger family protein; structural genomics, PH 5e-07
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-07
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 6e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 6e-07
3o70_A68 PHD finger protein 13; PHF13, structural genomics 7e-07
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 6e-06
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 6e-06
2yt5_A66 Metal-response element-binding transcription facto 6e-06
2yt5_A66 Metal-response element-binding transcription facto 4e-05
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 8e-06
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 9e-06
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 5e-05
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 6e-05
3nw0_A238 Non-structural maintenance of chromosomes element 6e-05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 6e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 8e-05
3kv5_D488 JMJC domain-containing histone demethylation prote 1e-04
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 1e-04
1wew_A78 DNA-binding family protein; structural genomics, P 2e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 2e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-04
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 3e-04
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-04
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
 Score =  107 bits (268), Expect = 7e-28
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 2/110 (1%)

Query: 37  CRLCFVGE--NEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEI 94
           C  C  G   N+   R   ++SC  CG+  H  CL+      +      W+C  C+ C +
Sbjct: 4   CDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCIL 63

Query: 95  CRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGS 144
           C  + + ++ +FC  CD  YH YC +PP      G + C    +     +
Sbjct: 64  CGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKA 113
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.84
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.81
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.8
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.47
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.36
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.34
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.3
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.25
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.21
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.16
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.03
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.96
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.94
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.93
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.85
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.84
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.79
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.74
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.73
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.73
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.72
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.72
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.7
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.65
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.61
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.59
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.59
2yt5_A66 Metal-response element-binding transcription facto 98.56
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.54
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.51
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.51
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.5
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.5
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.5
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.5
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.49
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.49
1we9_A64 PHD finger family protein; structural genomics, PH 98.48
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.47
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.46
2yt5_A66 Metal-response element-binding transcription facto 98.44
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.42
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.42
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.39
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.37
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.36
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.35
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.34
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.33
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.29
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.26
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.25
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.25
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.23
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.21
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.18
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.14
1wem_A76 Death associated transcription factor 1; structura 98.09
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.07
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.06
1weu_A91 Inhibitor of growth family, member 4; structural g 98.05
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.01
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.0
1weu_A91 Inhibitor of growth family, member 4; structural g 97.97
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.97
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.94
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.91
1wee_A72 PHD finger family protein; structural genomics, PH 97.89
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.88
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.86
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.86
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.85
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.83
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.83
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.81
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.8
1we9_A64 PHD finger family protein; structural genomics, PH 97.73
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.73
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.72
1wee_A72 PHD finger family protein; structural genomics, PH 97.72
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.7
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.68
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.66
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.53
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.51
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.5
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.47
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.43
1wew_A78 DNA-binding family protein; structural genomics, P 97.39
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.37
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.35
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.35
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.31
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.29
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.29
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.28
3kv5_D488 JMJC domain-containing histone demethylation prote 97.26
1wem_A76 Death associated transcription factor 1; structura 97.25
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.2
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 97.2
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.0
1wew_A78 DNA-binding family protein; structural genomics, P 96.98
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.81
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.56
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 96.23
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 96.03
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 95.97
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.79
3qii_A85 PHD finger protein 20; tudor domain, structural ge 95.74
3kv5_D488 JMJC domain-containing histone demethylation prote 95.7
2g3r_A123 Tumor suppressor P53-binding protein 1; tandem tud 95.62
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 95.5
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 94.33
1ssf_A156 Transformation related protein 53 binding protein 95.02
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 95.0
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 94.87
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 93.93
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 92.97
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 92.97
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 92.82
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 92.29
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 92.08
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 90.54
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 90.02
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 89.99
2ect_A78 Ring finger protein 126; metal binding protein, st 89.87
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 89.5
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 89.44
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 89.25
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 89.22
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 88.89
2d9t_A78 Tudor domain-containing protein 3; structural geno 88.84
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 87.99
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 87.83
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 87.75
3s6w_A54 Tudor domain-containing protein 3; methylated argi 87.13
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 87.05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 86.52
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 86.49
2ysl_A73 Tripartite motif-containing protein 31; ring-type 86.36
2ecm_A55 Ring finger and CHY zinc finger domain- containing 86.03
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 85.47
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 84.81
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 84.78
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 84.03
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 82.64
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 82.61
2lcd_A118 AT-rich interactive domain-containing protein 4A; 83.18
2ysj_A63 Tripartite motif-containing protein 31; ring-type 82.07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 82.03
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 81.93
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 81.8
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 81.78
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 81.77
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 81.55
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 81.44
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 80.74
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 80.7
2wac_A 218 CG7008-PA; unknown function, tudor, beta-barrel, n 80.37
2ect_A78 Ring finger protein 126; metal binding protein, st 80.29
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=1.9e-21  Score=176.59  Aligned_cols=104  Identities=28%  Similarity=0.812  Sum_probs=92.2

Q ss_pred             ccccccccccccccCCccCCCceEEeCcCCCccchhccCCCccccccCCCCCccCCCCCccccccccCCCCCceeCCCCC
Q 004423           32 NTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCD  111 (754)
Q Consensus        32 ~~d~~C~vC~~gG~~gs~~~eeLL~Cd~C~rsYH~~CL~p~~e~~~~v~~~~W~Cp~Ck~C~vC~~sgd~~kLL~Cd~C~  111 (754)
                      .++++|.+|..+|+     +++||.|+.|+++||+.||++...+   ++.+.|+|++|.+|.+|+..+++..||+|+.|+
T Consensus         5 ~~~~~C~~C~~~g~-----~~~ll~C~~C~~~~H~~Cl~~~~~~---~~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~   76 (111)
T 2ysm_A            5 SSGANCAVCDSPGD-----LLDQFFCTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCD   76 (111)
T ss_dssp             CCCSCBTTTCCCCC-----TTTSEECSSSCCEECTTTTTCCCCT---TTSTTCCCTTTCCCTTTCCCSCCTTEEECSSSC
T ss_pred             CCCCCCcCCCCCCC-----CcCCeECCCCCCCcChHHhCCcccc---ccccCccCCcCCcccccCccCCCCCeeECCCCC
Confidence            35679999999873     3578999999999999999997643   346899999999999999999888999999999


Q ss_pred             CccccccCCCCCccCCCCCcccCCCcccCCCC
Q 004423          112 AAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCG  143 (754)
Q Consensus       112 raYH~~CL~Ppl~~vp~g~W~CP~C~~C~~Cg  143 (754)
                      ++||.+|+.|++..+|.+.|+|+.|..|..++
T Consensus        77 ~~yH~~Cl~ppl~~~P~g~W~C~~C~~c~~g~  108 (111)
T 2ysm_A           77 KGYHTFCLQPVMKSVPTNGWKCKNCRICISGP  108 (111)
T ss_dssp             CEEEGGGSSSCCSSCCSSCCCCHHHHCCSCSC
T ss_pred             cHHhHHhcCCccccCCCCCcCCcCCcCcCCCC
Confidence            99999999999999999999999988776654
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 754
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 3e-10
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 0.002
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-09
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 4e-04
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 5e-07
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 0.001
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-07
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 5e-07
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 8e-05
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 3e-06
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 8e-05
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 5e-06
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 1e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 8e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 0.002
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 7e-05
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.001
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.2 bits (130), Expect = 3e-10
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 92  CEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSC 142
           C++CR+ G+ +K + C  C+ A+H +C  P    V  G + CP    C   
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCP---ACQPA 50
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.9
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.84
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.61
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.47
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.41
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.41
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.26
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.24
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.1
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.07
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.04
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.0
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.92
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.82
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.77
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.76
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.74
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.55
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.54
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.4
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.21
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.06
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.86
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.34
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 92.87
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 92.68
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 91.5
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 89.13
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 87.84
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 87.53
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 86.39
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 85.22
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 84.76
d2zgwa147 Biotin--[acetyl-CoA-carboxylase] ligase C-terminal 83.96
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 80.37
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 80.06
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.90  E-value=3e-10  Score=88.15  Aligned_cols=49  Identities=31%  Similarity=0.954  Sum_probs=44.0

Q ss_pred             ccccccccCCCCCceeCCCCCCccccccCCCCCccCCCCCcccCCCccc
Q 004423           91 ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKC  139 (754)
Q Consensus        91 ~C~vC~~sgd~~kLL~Cd~C~raYH~~CL~Ppl~~vp~g~W~CP~C~~C  139 (754)
                      .|.+|+..++++.||.|+.|+.+||..|+.|++..+|.+.|+|+.|..|
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcCc
Confidence            4777888888889999999999999999999999999999999998754
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zgwa1 b.34.1.1 (A:189-235) Biotin--[acetyl-CoA-carboxylase] ligase C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure