Citrus Sinensis ID: 004467

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750--

MVKFTAEGLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCMYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL

cccccHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccEEEEEEEEcHHHHHHccccccccccEEEEccccccEEcccccccEEEEccccEEEEEccccEEEEcccccccHHHHHHHccccEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHccEEccccccccHHHHHHHHHccccccccccccccccccccccEEEEEEEEEcEEccccEEEEEccccccccccccEEEEEEEEEEEEccEEEEEcccccccEEEEEcccccccccEEEEcccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEccHHHHHHHHHHHHHHHcccccEEEcccEEEEEEEcccccccEEEEEcccccEEEEEEEccccHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHcccEEEEccccccccEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEccccccccccEEEHHHHHHHHHHHHccccEEEccEEEEEEEEccccHHHHHHHcccccEEEEEEEEEccccEEEEEEEEcccccccccHHHHHccccccEEcEEEccEEEccccccccccHHHHHHHHHHHcccccccccccccccccc

cccccHHHHHHHHccHHHccEEEEEccccccHHHHHHHHHHHHccccHHHcccccEcccHHHHHHccEEEEEEEEEEEEEccHHcccHcccccccccEEEEEEcccccccccHHHHHHHEHccccEEEEEccccHHHHHHHcccHHHHHHHHccccHEEcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHcccccccEEEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccEEEcccEEcccccccccccEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEcccHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEEEEccccEEEEccccccccEEEEEEEcccccHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEcccccEcHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEcccHHcccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccHHHccccHHHHHccccEEEcccccccccEEEEEEEEEHHHHccccHHHHHHccccccccEEEccccccccccccccccHHHHHHHHHHHcccccccccHHHHcccc

MVKFTAEGLRRIMDFKHnirnmsviahvdhgkstlTDSLVAAAGIIAQEvagdvrmtdtradeaergiTIKSTGISLYYEMTDDALKsykgerngneYLINLidspghvdfsseVTAALRITDGALVVVDCIEGVCMYaskfgvdesKMMERlwgenffdpatkkwttkntgsatckrgfVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFhlpspstaqKYRVEnlyegplddqyanairncdpngplmLYVSkmipasdkgrffaFGRVFsgkvstglkvrimgpnyvpgekkdlYVKSVQRTVIWMgkkqetvedvpcgntvAMVGLDQFITknatltnekevdahpiramkfsvsPVVRVAVQCKVASDLPKLVEGLKRlaksdpmvvCTIEESGEHIVAGAGELHLEICLKDLqddfmggaeiiksdpvvsfRETVLEKSCRTvmskspnkhnrlymearplEEGLaeaiddgrigprddpkarskilseefgwdkdLAKKIwcfgpettgpnmvvdMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHAdaihrgggqvipTARRVIYASqltakprllepvymveiqapeqaLGGIYSVLnqkrghvfeemqrpgtplynikaylpviesfgfsgtlraatsgqafpqcvfdhwdmmssdplepgtQAAQLVADIRKRKglkeqmtplsefedkl

MVKFTAEGLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAqevagdvrmtdtradeaergitikstgislYYEMTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCMYASKFGVDESKMMERLWGENffdpatkkwttkntgsatckrGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFsgkvstglkvrimgpnyvpgekkdlyVKSVQRTVIWmgkkqetvedvpCGNTVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCkvasdlpkLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAeiiksdpvvsfRETVLEKscrtvmskspnkhnrlymEARPLEEGLAeaiddgrigprddpKARSKILseefgwdkdlaKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHrgggqviptARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKglkeqmtplsefedkl

*******GLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCMYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMK***KDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSC**********************************************LSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDM***************************************

*VKFTAEGLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCMYASKFGVDESKMMERLWGENFFDPATKK************RGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLD***************LMLYVSKMIPASDKGRFFAFGRVFSGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTV**KSPNKHNRLYMEARPLEEGLAEAID**************KILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL

*VKFTAEGLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCMYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		752	2.2.26 [Sep-21-2011]
O23755		843	Elongation factor 2 OS=Be	N/A	no	0.819	0.730	0.912	0.0
P28996		845	Elongation factor 2 OS=Pa	N/A	no	0.819	0.728	0.788	0.0
P29691		852	Elongation factor 2 OS=Ca	yes	no	0.812	0.717	0.631	0.0
O14460		842	Elongation factor 2 OS=Sc	yes	no	0.813	0.726	0.627	0.0
P13060		844	Elongation factor 2 OS=Dr	yes	no	0.812	0.723	0.620	0.0
Q1HPK6		844	Translation elongation fa	N/A	no	0.812	0.723	0.618	0.0
Q96X45		844	Elongation factor 2 OS=Ne	N/A	no	0.813	0.725	0.615	0.0
P58252		858	Elongation factor 2 OS=Mu	yes	no	0.797	0.699	0.632	0.0
P09445		858	Elongation factor 2 OS=Cr	yes	no	0.797	0.699	0.632	0.0
P05197		858	Elongation factor 2 OS=Ra	yes	no	0.797	0.699	0.632	0.0

>sp\|O23755\|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1	Back alignment and function desciption

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/616 (91%), Positives = 593/616 (96%)

Query: 137 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCM 196
           MYASKFGVDESKMMERLWGENFFDPATKKWTTKN+G+A+CKRGFVQFCYEPIKQII  CM
Sbjct: 228 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNSGNASCKRGFVQFCYEPIKQIIAACM 287

Query: 197 NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ 256
           NDQKDKL   + KLG+ MK+EEKDLMG+ LMKRVMQTWLPASSALLEMMI HLPSP+TAQ
Sbjct: 288 NDQKDKLLAHVTKLGIQMKTEEKDLMGRPLMKRVMQTWLPASSALLEMMIHHLPSPATAQ 347

Query: 257 KYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGL 316
           +YRVENLYEGP+DD YA AIRNCDP GPLMLYVSKMIPASDKGRFFAFGRVF+GKVSTG+
Sbjct: 348 RYRVENLYEGPMDDVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFAGKVSTGM 407

Query: 317 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATL 376
           KVRIMGPNYVPGEKKDLYVK+VQRTVIWMGKKQETVEDVPCGNTVA+VGLDQ+ITKNATL
Sbjct: 408 KVRIMGPNYVPGEKKDLYVKNVQRTVIWMGKKQETVEDVPCGNTVALVGLDQYITKNATL 467

Query: 377 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE 436
           TNEKE DAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVC+IEESGE
Sbjct: 468 TNEKESDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSIEESGE 527

Query: 437 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRL 496
           HI+AGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVL++S RTVMSKSPNKHNRL
Sbjct: 528 HIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLDRSVRTVMSKSPNKHNRL 587

Query: 497 YMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMV 556
           YMEARP+EEGLAEAID+GRIGPRDDPK RSKIL+EE+GWDKDLAKKIWCFGPETTGPNMV
Sbjct: 588 YMEARPMEEGLAEAIDEGRIGPRDDPKNRSKILAEEYGWDKDLAKKIWCFGPETTGPNMV 647

Query: 557 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 616
           VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQ+I
Sbjct: 648 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQII 707

Query: 617 PTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 676
           PTARRV YASQLTAKPRLLEPVY+VEIQAPE ALGGIYSVLNQKRGHVFEEMQRPGTPLY
Sbjct: 708 PTARRVFYASQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLY 767

Query: 677 NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRK 736
           NIKAYLPV+ESFGFS TLRA+TSGQAFPQCVFDHW+MM SDPLE G+QA+ LV+ IRKRK
Sbjct: 768 NIKAYLPVVESFGFSSTLRASTSGQAFPQCVFDHWEMMPSDPLEAGSQASTLVSVIRKRK 827

Query: 737 GLKEQMTPLSEFEDKL 752
           GLKEQMTPLSEFEDKL
Sbjct: 828 GLKEQMTPLSEFEDKL 843

Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
Beta vulgaris (taxid: 161934)

>sp\|P28996\|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1	Back alignment and function description

>sp\|P29691\|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=1 SV=4	Back alignment and function description

>sp\|O14460\|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2	Back alignment and function description

>sp\|P13060\|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=Ef2b PE=2 SV=4	Back alignment and function description

>sp\|Q1HPK6\|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1	Back alignment and function description

>sp\|Q96X45\|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3	Back alignment and function description

>sp\|P58252\|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2	Back alignment and function description

>sp\|P09445\|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4	Back alignment and function description

>sp\|P05197\|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		752
356556977		843	PREDICTED: elongation factor 2-like [Gly	0.819	0.730	0.967	0.0
356525774		843	PREDICTED: elongation factor 2-like [Gly	0.819	0.730	0.967	0.0
225462164		843	PREDICTED: elongation factor 2-like isof	0.819	0.730	0.962	0.0
255544686		843	eukaryotic translation elongation factor	0.819	0.730	0.962	0.0
255565836		843	eukaryotic translation elongation factor	0.819	0.730	0.961	0.0
357451819		843	Elongation factor EF-2 [Medicago truncat	0.819	0.730	0.956	0.0
357451779		843	Elongation factor EF-2 [Medicago truncat	0.819	0.730	0.956	0.0
224094244		843	predicted protein [Populus trichocarpa]	0.819	0.730	0.954	0.0
224081451		843	predicted protein [Populus trichocarpa]	0.819	0.730	0.959	0.0
224096654		843	predicted protein [Populus trichocarpa]	0.819	0.730	0.952	0.0

>gi\|356556977\|ref\|XP_003546795.1\| PREDICTED: elongation factor 2-like [Glycine max]	Back alignment and taxonomy information

 Score = 1263 bits (3269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/616 (96%), Positives = 607/616 (98%)

Query: 137 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCM 196
           MYASKFGVDE KMMERLWGENFFDPATKKW++KNTGSATCKRGFVQFCYEPIKQIINTCM
Sbjct: 228 MYASKFGVDEGKMMERLWGENFFDPATKKWSSKNTGSATCKRGFVQFCYEPIKQIINTCM 287

Query: 197 NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ 256
           NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ
Sbjct: 288 NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ 347

Query: 257 KYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGL 316
           KYRVENLYEGPLDDQYA+AIRNCDP GPLMLYVSKMIPASDKGRFFAFGRVFSG+VSTGL
Sbjct: 348 KYRVENLYEGPLDDQYASAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVSTGL 407

Query: 317 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATL 376
           KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGK+QETVEDVPCGNTVAMVGLDQFITKNATL
Sbjct: 408 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKRQETVEDVPCGNTVAMVGLDQFITKNATL 467

Query: 377 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE 436
           TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE
Sbjct: 468 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE 527

Query: 437 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRL 496
           HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLE+SCRTVMSKSPNKHNRL
Sbjct: 528 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLERSCRTVMSKSPNKHNRL 587

Query: 497 YMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMV 556
           YMEARPLEEGLAEAIDDG+IGPRDDPK RSKILSEEFGWDKDLAKKIWCFGPET GPNMV
Sbjct: 588 YMEARPLEEGLAEAIDDGKIGPRDDPKIRSKILSEEFGWDKDLAKKIWCFGPETLGPNMV 647

Query: 557 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 616
           VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMR ICFEVCDVVLHADAIHRGGGQ+I
Sbjct: 648 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRAICFEVCDVVLHADAIHRGGGQII 707

Query: 617 PTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 676
           PTARRV YASQ+TAKPRLLEPVY+VEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY
Sbjct: 708 PTARRVFYASQITAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 767

Query: 677 NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRK 736
           NIKAYLPVIESFGFS TLRAATSGQAFPQCVFDHWDMMSSDPLE G+QAAQLV DIRKRK
Sbjct: 768 NIKAYLPVIESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEAGSQAAQLVTDIRKRK 827

Query: 737 GLKEQMTPLSEFEDKL 752
           GLKEQMTPLSEFEDKL
Sbjct: 828 GLKEQMTPLSEFEDKL 843

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356525774\|ref\|XP_003531498.1\| PREDICTED: elongation factor 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|225462164\|ref\|XP_002266780.1\| PREDICTED: elongation factor 2-like isoform 1 [Vitis vinifera] gi\|359494453\|ref\|XP_003634783.1\| PREDICTED: elongation factor 2-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255544686\|ref\|XP_002513404.1\| eukaryotic translation elongation factor, putative [Ricinus communis] gi\|223547312\|gb\|EEF48807.1\| eukaryotic translation elongation factor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255565836\|ref\|XP_002523907.1\| eukaryotic translation elongation factor, putative [Ricinus communis] gi\|223536837\|gb\|EEF38476.1\| eukaryotic translation elongation factor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357451819\|ref\|XP_003596186.1\| Elongation factor EF-2 [Medicago truncatula] gi\|355485234\|gb\|AES66437.1\| Elongation factor EF-2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357451779\|ref\|XP_003596166.1\| Elongation factor EF-2 [Medicago truncatula] gi\|355485214\|gb\|AES66417.1\| Elongation factor EF-2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224094244\|ref\|XP_002310106.1\| predicted protein [Populus trichocarpa] gi\|222853009\|gb\|EEE90556.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224081451\|ref\|XP_002306416.1\| predicted protein [Populus trichocarpa] gi\|222855865\|gb\|EEE93412.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224096654\|ref\|XP_002310687.1\| predicted protein [Populus trichocarpa] gi\|222853590\|gb\|EEE91137.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		752
TAIR\|locus:2205235		843	LOS1 "AT1G56070" [Arabidopsis	0.819	0.730	0.935	0.0
TAIR\|locus:2829525		820	AT3G12915 [Arabidopsis thalian	0.816	0.748	0.900	0.0
POMBASE\|SPAC513.01c		842	eft201 "translation elongation	0.812	0.725	0.631	1.4e-262
POMBASE\|SPCP31B10.07		842	eft202 "translation elongation	0.812	0.725	0.631	1.4e-262
WB\|WBGene00001167		852	eef-2 [Caenorhabditis elegans	0.812	0.717	0.631	2e-261
MGI\|MGI:95288		858	Eef2 "eukaryotic translation e	0.797	0.699	0.632	1.9e-258
RGD\|61979		858	Eef2 "eukaryotic translation e	0.797	0.699	0.632	1.9e-258
UNIPROTKB\|Q3SYU2		858	EEF2 "Elongation factor 2" [Bo	0.797	0.699	0.632	3e-258
UNIPROTKB\|P13639		858	EEF2 "Elongation factor 2" [Ho	0.799	0.700	0.630	1e-257
UNIPROTKB\|F6XRY2		858	EEF2 "Uncharacterized protein"	0.799	0.700	0.630	1e-257

TAIR\|locus:2205235 LOS1 "AT1G56070" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3056 (1080.8 bits), Expect = 0., Sum P(2) = 0.
 Identities = 576/616 (93%), Positives = 598/616 (97%)

Query:   137 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCM 196
             MYASKFGV ESKMMERLWGENFFDPAT+KW+ KNTGS TCKRGFVQFCYEPIKQII TCM
Sbjct:   228 MYASKFGVVESKMMERLWGENFFDPATRKWSGKNTGSPTCKRGFVQFCYEPIKQIIATCM 287

Query:   197 NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ 256
             NDQKDKLWPML KLGV+MK++EK+LMGK LMKRVMQTWLPAS+ALLEMMIFHLPSP TAQ
Sbjct:   288 NDQKDKLWPMLAKLGVSMKNDEKELMGKPLMKRVMQTWLPASTALLEMMIFHLPSPHTAQ 347

Query:   257 KYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGL 316
             +YRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVF+GKVSTG+
Sbjct:   348 RYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFAGKVSTGM 407

Query:   317 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATL 376
             KVRIMGPNY+PGEKKDLY KSVQRTVIWMGK+QETVEDVPCGNTVAMVGLDQFITKNATL
Sbjct:   408 KVRIMGPNYIPGEKKDLYTKSVQRTVIWMGKRQETVEDVPCGNTVAMVGLDQFITKNATL 467

Query:   377 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE 436
             TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCT+EESGE
Sbjct:   468 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTMEESGE 527

Query:   437 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRL 496
             HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETV ++S RTVMSKSPNKHNRL
Sbjct:   528 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVCDRSTRTVMSKSPNKHNRL 587

Query:   497 YMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMV 556
             YMEARP+EEGLAEAIDDGRIGPRDDPK RSKIL+EEFGWDKDLAKKIW FGPETTGPNMV
Sbjct:   588 YMEARPMEEGLAEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWAFGPETTGPNMV 647

Query:   557 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 616
             VDMCKGVQYLNEIKDSVVAGFQWASKEG LAEENMRGICFEVCDVVLH+DAIHRGGGQVI
Sbjct:   648 VDMCKGVQYLNEIKDSVVAGFQWASKEGPLAEENMRGICFEVCDVVLHSDAIHRGGGQVI 707

Query:   617 PTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 676
             PTARRVIYASQ+TAKPRLLEPVYMVEIQAPE ALGGIYSVLNQKRGHVFEEMQRPGTPLY
Sbjct:   708 PTARRVIYASQITAKPRLLEPVYMVEIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLY 767

Query:   677 NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRK 736
             NIKAYLPV+ESFGFS  LRAATSGQAFPQCVFDHW+MMSSDPLEPGTQA+ LVADIRKRK
Sbjct:   768 NIKAYLPVVESFGFSSQLRAATSGQAFPQCVFDHWEMMSSDPLEPGTQASVLVADIRKRK 827

Query:   737 GLKEQMTPLSEFEDKL 752
             GLKE MTPLSEFEDKL
Sbjct:   828 GLKEAMTPLSEFEDKL 843

GO:0003746 "translation elongation factor activity" evidence=ISS

GO:0003924 "GTPase activity" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0008135 "translation factor activity, nucleic acid binding" evidence=ISS

GO:0009409 "response to cold" evidence=IMP

GO:0005730 "nucleolus" evidence=IDA

GO:0005507 "copper ion binding" evidence=IDA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0048046 "apoplast" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

TAIR\|locus:2829525 AT3G12915 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

POMBASE\|SPAC513.01c eft201 "translation elongation factor 2 (EF-2) Eft2,A" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

POMBASE\|SPCP31B10.07 eft202 "translation elongation factor 2 (EF-2) Eft2,B" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

WB\|WBGene00001167 eef-2 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

MGI\|MGI:95288 Eef2 "eukaryotic translation elongation factor 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|61979 Eef2 "eukaryotic translation elongation factor 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SYU2 EEF2 "Elongation factor 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P13639 EEF2 "Elongation factor 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F6XRY2 EEF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P09445	EF2_CRIGR	No assigned EC number	0.6326	0.7978	0.6993	yes	no
C4KHE9	EF2_SULIK	No assigned EC number	0.3389	0.9308	0.9510	yes	no
C3MQ53	EF2_SULIL	No assigned EC number	0.3389	0.9308	0.9510	yes	no
Q975H5	EF2_SULTO	No assigned EC number	0.3420	0.9375	0.9565	yes	no
A8ACA7	EF2_IGNH4	No assigned EC number	0.3455	0.9375	0.9527	yes	no
Q874B9	EF2_PICPA	No assigned EC number	0.5980	0.8138	0.7268	yes	no
P28996	EF2_PARKE	No assigned EC number	0.7880	0.8191	0.7289	N/A	no
Q5R8Z3	EF2_PONAB	No assigned EC number	0.6303	0.7992	0.7004	yes	no
Q6FYA7	EF2_CANGA	No assigned EC number	0.5899	0.8138	0.7268	yes	no
Q90705	EF2_CHICK	No assigned EC number	0.6287	0.7992	0.7004	yes	no
O14460	EF2_SCHPO	No assigned EC number	0.6272	0.8138	0.7268	yes	no
Q3SYU2	EF2_BOVIN	No assigned EC number	0.6326	0.7978	0.6993	yes	no
Q6BJ25	EF2_DEBHA	No assigned EC number	0.5786	0.8138	0.7268	yes	no
C3N5S0	EF2_SULIA	No assigned EC number	0.3389	0.9308	0.9510	yes	no
P13060	EF2_DROME	No assigned EC number	0.6201	0.8125	0.7239	yes	no
P13639	EF2_HUMAN	No assigned EC number	0.6303	0.7992	0.7004	yes	no
P29691	EF2_CAEEL	No assigned EC number	0.6314	0.8125	0.7171	yes	no
Q875Z2	EF2_NAUCC	No assigned EC number	0.5931	0.8138	0.7268	yes	no
C3MVH1	EF2_SULIM	No assigned EC number	0.3389	0.9308	0.9510	yes	no
B1YE08	EF2_PYRNV	No assigned EC number	0.3545	0.9242	0.9391	yes	no
Q6CPQ9	EF2_KLULA	No assigned EC number	0.5867	0.8138	0.7268	yes	no
Q754C8	EF2_ASHGO	No assigned EC number	0.5867	0.8138	0.7268	yes	no
C3NHB6	EF2_SULIN	No assigned EC number	0.3389	0.9308	0.9510	yes	no
P58252	EF2_MOUSE	No assigned EC number	0.6326	0.7978	0.6993	yes	no
A4YCV9	EF2_METS5	No assigned EC number	0.3342	0.9361	0.9565	yes	no
Q9YC19	EF2_AERPE	No assigned EC number	0.3618	0.9255	0.9456	yes	no
P05197	EF2_RAT	No assigned EC number	0.6326	0.7978	0.6993	yes	no
A0SXL6	EF2_CALJA	No assigned EC number	0.6326	0.7978	0.6993	yes	no
P15112	EF2_DICDI	No assigned EC number	0.5967	0.8111	0.7270	yes	no
P32324	EF2_YEAST	No assigned EC number	0.5931	0.8138	0.7268	yes	no
C3NED6	EF2_SULIY	No assigned EC number	0.3389	0.9308	0.9510	yes	no
O23755	EF2_BETVU	No assigned EC number	0.9123	0.8191	0.7307	N/A	no
A1RVX2	EF2_PYRIL	No assigned EC number	0.3558	0.9242	0.9391	yes	no
B1L7Q0	EF2_KORCO	No assigned EC number	0.3419	0.9441	0.9607	yes	no
P30925	EF2_SULSO	No assigned EC number	0.3389	0.9308	0.9510	yes	no
Q23716	EF2_CRYPV	No assigned EC number	0.6061	0.8111	0.7331	yes	no
A3DMV6	EF2_STAMF	No assigned EC number	0.3584	0.9175	0.9375	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00070821	SubName- Full=Putative uncharacterized protein; (844 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.II.2147.1	hypothetical protein; Required for the methylation step in diphthamide biosynthesis (By similar [...] (274 aa)		•		•		•	0.762
	eugene3.01500038	aminoacyl-tRNA ligase (EC-6.1.1.4) (1068 aa)		•				•	0.663
	estExt_fgenesh4_pm.C_LG_VIII0253	RecName- Full=60S acidic ribosomal protein P0; (323 aa)		•	•		•	•	0.655
	eugene3.00860050	aminoacyl-tRNA ligase (EC-6.1.1.4) (1087 aa)		•				•	0.643
	estExt_fgenesh4_pg.C_LG_X1707	RecName- Full=60S acidic ribosomal protein P0; (321 aa)		•	•		•	•	0.635
	gw1.IV.3113.1	hypothetical protein (690 aa)	•	•				•	0.612
	estExt_Genewise1_v1.C_LG_IV3101	hypothetical protein (421 aa)	•	•				•	0.566
	gw1.122.137.1	annotation not avaliable (183 aa)		•	•			•	0.545
	estExt_Genewise1_v1.C_440425	RecName- Full=Ribosomal protein L19; (210 aa)		•	•			•	0.508
	estExt_fgenesh4_kg.C_LG_IV0028	RecName- Full=Ribosomal protein L19; (211 aa)		•	•			•	0.507

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		752
PLN00116		843	PLN00116, PLN00116, translation elongation factor	0.0
PTZ00416		836	PTZ00416, PTZ00416, elongation factor 2; Provision	0.0
COG0480		697	COG0480, FusA, Translation elongation factors (GTP	1e-165
PRK07560		731	PRK07560, PRK07560, elongation factor EF-2; Review	1e-154
TIGR00490		720	TIGR00490, aEF-2, translation elongation factor aE	1e-148
cd01681		177	cd01681, aeEF2_snRNP_like_IV, This family represen	1e-100
PLN00116		843	PLN00116, PLN00116, translation elongation factor	6e-93
PTZ00416		836	PTZ00416, PTZ00416, elongation factor 2; Provision	5e-73
cd01885		218	cd01885, EF2, Elongation Factor 2 (EF2) in archaea	1e-66
cd01683		178	cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain	9e-62
cd04096		80	cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: thi	4e-47
PRK07560		731	PRK07560, PRK07560, elongation factor EF-2; Review	1e-45
pfam03764		120	pfam03764, EFG_IV, Elongation factor G, domain IV	2e-43
pfam00009		184	pfam00009, GTP_EFTU, Elongation factor Tu GTP bind	9e-42
cd03700		93	cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th	3e-39
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	1e-35
cd01890		179	cd01890, LepA, LepA also known as Elongation Facto	1e-33
cd00881		183	cd00881, GTP_translation_factor, GTP translation f	2e-33
cd04098		80	cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family i	8e-32
cd04167		213	cd04167, Snu114p, Snu114p, a spliceosome protein,	3e-31
cd01514		79	cd01514, Elongation_Factor_C, Elongation factor G	7e-29
smart00889		120	smart00889, EFG_IV, Elongation factor G, domain IV	9e-29
PRK05433		600	PRK05433, PRK05433, GTP-binding protein LepA; Prov	4e-28
TIGR01393		595	TIGR01393, lepA, GTP-binding protein LepA	5e-28
cd01891		194	cd01891, TypA_BipA, Tyrosine phosphorylated protei	1e-27
COG0481		603	COG0481, LepA, Membrane GTPase LepA [Cell envelope	1e-27
TIGR00484		689	TIGR00484, EF-G, translation elongation factor EF-	2e-26
pfam00679		89	pfam00679, EFG_C, Elongation factor G C-terminus	6e-24
COG1217		603	COG1217, TypA, Predicted membrane GTPase involved	2e-23
TIGR01394		594	TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip	2e-23
cd04168		237	cd04168, TetM_like, Tet(M)-like family includes Te	1e-22
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	2e-22
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	6e-22
cd01886		270	cd01886, EF-G, Elongation factor G (EF-G) family i	5e-21
smart00838		85	smart00838, EFG_C, Elongation factor G C-terminus	3e-20
cd04090		94	cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514	3e-20
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	2e-19
PRK12739		691	PRK12739, PRK12739, elongation factor G; Reviewed	6e-18
PRK10218		607	PRK10218, PRK10218, GTP-binding protein; Provision	3e-17
TIGR00484		689	TIGR00484, EF-G, translation elongation factor EF-	6e-17
PRK00007		693	PRK00007, PRK00007, elongation factor G; Reviewed	2e-16
PRK12739		691	PRK12739, PRK12739, elongation factor G; Reviewed	3e-16
cd04170		268	cd04170, EF-G_bact, Elongation factor G (EF-G) fam	2e-15
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	2e-14
PRK00007		693	PRK00007, PRK00007, elongation factor G; Reviewed	4e-14
cd04169		268	cd04169, RF3, Release Factor 3 (RF3) protein invol	2e-13
COG4108		528	COG4108, PrfC, Peptide chain release factor RF-3 [	8e-13
PRK12739		691	PRK12739, PRK12739, elongation factor G; Reviewed	1e-12
cd03713		78	cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar	3e-12
cd01680		116	cd01680, EFG_like_IV, Elongation Factor G-like dom	4e-11
TIGR00503		527	TIGR00503, prfC, peptide chain release factor 3	9e-11
COG3276		447	COG3276, SelB, Selenocysteine-specific translation	4e-10
PRK00007		693	PRK00007, PRK00007, elongation factor G; Reviewed	7e-10
PRK00741		526	PRK00741, prfC, peptide chain release factor 3; Pr	2e-09
TIGR00483		426	TIGR00483, EF-1_alpha, translation elongation fact	1e-08
TIGR03680		406	TIGR03680, eif2g_arch, translation initiation fact	2e-08
TIGR00475		581	TIGR00475, selB, selenocysteine-specific elongatio	3e-08
cd01884		195	cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b	5e-08
cd04171		170	cd04171, SelB, SelB, the dedicated elongation fact	6e-08
cd01889		192	cd01889, SelB_euk, SelB, the dedicated elongation	7e-08
cd01883		219	cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1	8e-08
COG0050		394	COG0050, TufB, GTPases - translation elongation fa	9e-08
COG5257		415	COG5257, GCD11, Translation initiation factor 2, g	1e-07
pfam03144		70	pfam03144, GTP_EFTU_D2, Elongation factor Tu domai	2e-07
COG5256		428	COG5256, TEF1, Translation elongation factor EF-1a	2e-07
PRK12317		425	PRK12317, PRK12317, elongation factor 1-alpha; Rev	2e-07
PLN03126		478	PLN03126, PLN03126, Elongation factor Tu; Provisio	4e-07
cd01888		197	cd01888, eIF2_gamma, Gamma subunit of initiation f	1e-06
CHL00071		409	CHL00071, tufA, elongation factor Tu	1e-06
cd01342		83	cd01342, Translation_Factor_II_like, Translation_F	2e-06
TIGR00485		394	TIGR00485, EF-Tu, translation elongation factor TU	2e-06
PTZ00141		446	PTZ00141, PTZ00141, elongation factor 1- alpha; Pr	3e-06
PRK04000		411	PRK04000, PRK04000, translation initiation factor	4e-06
cd04097		78	cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho	5e-06
PLN03127		447	PLN03127, PLN03127, Elongation factor Tu; Provisio	6e-06
PRK12735		396	PRK12735, PRK12735, elongation factor Tu; Reviewed	1e-05
cd01887		169	cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk	1e-05
cd03711		78	cd03711, Tet_C, Tet_C: C-terminus of ribosomal pro	2e-05
PRK12736		394	PRK12736, PRK12736, elongation factor Tu; Reviewed	2e-05
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	2e-05
cd04088		83	cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamil	2e-05
TIGR01394		594	TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip	3e-05
COG1217		603	COG1217, TypA, Predicted membrane GTPase involved	6e-05
PRK00049		396	PRK00049, PRK00049, elongation factor Tu; Reviewed	7e-05
PRK04004		586	PRK04004, PRK04004, translation initiation factor	8e-05
PLN00043		447	PLN00043, PLN00043, elongation factor 1-alpha; Pro	1e-04
PRK10512		614	PRK10512, PRK10512, selenocysteinyl-tRNA-specific	1e-04
CHL00189		742	CHL00189, infB, translation initiation factor 2; P	2e-04
TIGR00487		587	TIGR00487, IF-2, translation initiation factor IF-	2e-04
TIGR00491		590	TIGR00491, aIF-2, translation initiation factor aI	0.001
cd04166		209	cd04166, CysN_ATPS, CysN, together with protein Cy	0.001
COG0532		509	COG0532, InfB, Translation initiation factor 2 (IF	0.001
cd03698		83	cd03698, eRF3_II_like, eRF3_II_like: domain simila	0.003
PRK10218		607	PRK10218, PRK10218, GTP-binding protein; Provision	0.004

>gnl\|CDD\|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

 Score = 1397 bits (3617), Expect = 0.0
 Identities = 585/616 (94%), Positives = 604/616 (98%)

Query: 137 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSATCKRGFVQFCYEPIKQIINTCM 196
           MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGS TCKRGFVQFCYEPIKQIINTCM
Sbjct: 228 MYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSPTCKRGFVQFCYEPIKQIINTCM 287

Query: 197 NDQKDKLWPMLQKLGVTMKSEEKDLMGKALMKRVMQTWLPASSALLEMMIFHLPSPSTAQ 256
           NDQKDKLWPML+KLGVT+KS+EK+LMGKALMKRVMQTWLPAS ALLEM+IFHLPSP+ AQ
Sbjct: 288 NDQKDKLWPMLEKLGVTLKSDEKELMGKALMKRVMQTWLPASDALLEMIIFHLPSPAKAQ 347

Query: 257 KYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGKVSTGL 316
           +YRVENLYEGPLDD+YA AIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSG V+TG+
Sbjct: 348 RYRVENLYEGPLDDKYATAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGRVFSGTVATGM 407

Query: 317 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATL 376
           KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQE+VEDVPCGNTVAMVGLDQFITKNATL
Sbjct: 408 KVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATL 467

Query: 377 TNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGE 436
           TNEKEVDAHPI+AMKFSVSPVVRVAVQCK ASDLPKLVEGLKRLAKSDPMV CTIEESGE
Sbjct: 468 TNEKEVDAHPIKAMKFSVSPVVRVAVQCKNASDLPKLVEGLKRLAKSDPMVQCTIEESGE 527

Query: 437 HIVAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRL 496
           HI+AGAGELHLEICLKDLQDDFMGGAEI  SDPVVSFRETVLEKSCRTVMSKSPNKHNRL
Sbjct: 528 HIIAGAGELHLEICLKDLQDDFMGGAEIKVSDPVVSFRETVLEKSCRTVMSKSPNKHNRL 587

Query: 497 YMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCFGPETTGPNMV 556
           YMEARPLEEGLAEAIDDGRIGPRDDPK RSKIL+EEFGWDKDLAKKIWCFGPETTGPNMV
Sbjct: 588 YMEARPLEEGLAEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWCFGPETTGPNMV 647

Query: 557 VDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 616
           VDMCKGVQYLNEIKDSVVAGFQWA+KEGALAEENMRGICFEVCDVVLHADAIHRGGGQ+I
Sbjct: 648 VDMCKGVQYLNEIKDSVVAGFQWATKEGALAEENMRGICFEVCDVVLHADAIHRGGGQII 707

Query: 617 PTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 676
           PTARRVIYASQLTAKPRLLEPVY+VEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY
Sbjct: 708 PTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLY 767

Query: 677 NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRK 736
           NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLE G+QAAQLVADIRKRK
Sbjct: 768 NIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEAGSQAAQLVADIRKRK 827

Query: 737 GLKEQMTPLSEFEDKL 752
           GLKEQM PLSE+EDKL
Sbjct: 828 GLKEQMPPLSEYEDKL 843

Length = 843

>gnl\|CDD\|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed	Back alignment and domain information

>gnl\|CDD\|129581 TIGR00490, aEF-2, translation elongation factor aEF-2	Back alignment and domain information

>gnl\|CDD\|238839 cd01681, aeEF2_snRNP_like_IV, This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein	Back alignment and domain information

>gnl\|CDD\|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya	Back alignment and domain information

>gnl\|CDD\|238840 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome	Back alignment and domain information

>gnl\|CDD\|239763 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>gnl\|CDD\|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed	Back alignment and domain information

>gnl\|CDD\|202760 pfam03764, EFG_IV, Elongation factor G, domain IV	Back alignment and domain information

>gnl\|CDD\|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain	Back alignment and domain information

>gnl\|CDD\|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4)	Back alignment and domain information

>gnl\|CDD\|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors	Back alignment and domain information

>gnl\|CDD\|239765 cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>gnl\|CDD\|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase	Back alignment and domain information

>gnl\|CDD\|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|214887 smart00889, EFG_IV, Elongation factor G, domain IV	Back alignment and domain information

>gnl\|CDD\|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional	Back alignment and domain information

>gnl\|CDD\|130460 TIGR01393, lepA, GTP-binding protein LepA	Back alignment and domain information

>gnl\|CDD\|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases	Back alignment and domain information

>gnl\|CDD\|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|129575 TIGR00484, EF-G, translation elongation factor EF-G	Back alignment and domain information

>gnl\|CDD\|201388 pfam00679, EFG_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA	Back alignment and domain information

>gnl\|CDD\|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis	Back alignment and domain information

>gnl\|CDD\|197906 smart00838, EFG_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|239757 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|237185 PRK12739, PRK12739, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|104396 PRK10218, PRK10218, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|129575 TIGR00484, EF-G, translation elongation factor EF-G	Back alignment and domain information

>gnl\|CDD\|234569 PRK00007, PRK00007, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|237185 PRK12739, PRK12739, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|234569 PRK00007, PRK00007, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria	Back alignment and domain information

>gnl\|CDD\|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237185 PRK12739, PRK12739, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G	Back alignment and domain information

>gnl\|CDD\|238838 cd01680, EFG_like_IV, Elongation Factor G-like domain IV	Back alignment and domain information

>gnl\|CDD\|129594 TIGR00503, prfC, peptide chain release factor 3	Back alignment and domain information

>gnl\|CDD\|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|234569 PRK00007, PRK00007, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|179105 PRK00741, prfC, peptide chain release factor 3; Provisional	Back alignment and domain information

>gnl\|CDD\|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha	Back alignment and domain information

>gnl\|CDD\|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma	Back alignment and domain information

>gnl\|CDD\|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB	Back alignment and domain information

>gnl\|CDD\|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins	Back alignment and domain information

>gnl\|CDD\|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family	Back alignment and domain information

>gnl\|CDD\|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2	Back alignment and domain information

>gnl\|CDD\|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed	Back alignment and domain information

>gnl\|CDD\|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional	Back alignment and domain information

>gnl\|CDD\|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma)	Back alignment and domain information

>gnl\|CDD\|177010 CHL00071, tufA, elongation factor Tu	Back alignment and domain information

>gnl\|CDD\|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>gnl\|CDD\|129576 TIGR00485, EF-Tu, translation elongation factor TU	Back alignment and domain information

>gnl\|CDD\|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional	Back alignment and domain information

>gnl\|CDD\|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>gnl\|CDD\|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>gnl\|CDD\|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional	Back alignment and domain information

>gnl\|CDD\|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family	Back alignment and domain information

>gnl\|CDD\|239682 cd03711, Tet_C, Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>gnl\|CDD\|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|239755 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes	Back alignment and domain information

>gnl\|CDD\|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA	Back alignment and domain information

>gnl\|CDD\|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated	Back alignment and domain information

>gnl\|CDD\|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional	Back alignment and domain information

>gnl\|CDD\|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>gnl\|CDD\|177089 CHL00189, infB, translation initiation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|232995 TIGR00487, IF-2, translation initiation factor IF-2	Back alignment and domain information

>gnl\|CDD\|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>gnl\|CDD\|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex	Back alignment and domain information

>gnl\|CDD\|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>gnl\|CDD\|104396 PRK10218, PRK10218, GTP-binding protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		752
KOG0469		842	consensus Elongation factor 2 [Translation, riboso	100.0
PLN00116		843	translation elongation factor EF-2 subunit; Provis	100.0
PTZ00416		836	elongation factor 2; Provisional	100.0
KOG0468		971	consensus U5 snRNP-specific protein [Translation,	100.0
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	100.0
PRK07560		731	elongation factor EF-2; Reviewed	100.0
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	100.0
KOG0465		721	consensus Mitochondrial elongation factor [Transla	100.0
KOG0467		887	consensus Translation elongation factor 2/ribosome	100.0
PRK12739		691	elongation factor G; Reviewed	100.0
PRK00007		693	elongation factor G; Reviewed	100.0
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	100.0
PRK13351		687	elongation factor G; Reviewed	100.0
PRK12740		668	elongation factor G; Reviewed	100.0
KOG0464		753	consensus Elongation factor G [Translation, riboso	100.0
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	100.0
PRK05433		600	GTP-binding protein LepA; Provisional	100.0
PRK10218		607	GTP-binding protein; Provisional	100.0
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	100.0
KOG0462		650	consensus Elongation factor-type GTP-binding prote	100.0
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	100.0
COG1217		603	TypA Predicted membrane GTPase involved in stress	100.0
PRK00741		526	prfC peptide chain release factor 3; Provisional	100.0
TIGR00503		527	prfC peptide chain release factor 3. This translat	100.0
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	100.0
cd01683		178	EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part	100.0
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	100.0
PLN00043		447	elongation factor 1-alpha; Provisional	100.0
PTZ00141		446	elongation factor 1- alpha; Provisional	100.0
cd01681		177	aeEF2_snRNP_like_IV This family represents domain	100.0
CHL00071		409	tufA elongation factor Tu	100.0
PLN03126		478	Elongation factor Tu; Provisional	100.0
PRK12736		394	elongation factor Tu; Reviewed	100.0
TIGR00485		394	EF-Tu translation elongation factor TU. This align	99.98
KOG0458		603	consensus Elongation factor 1 alpha [Translation,	99.98
PRK12735		396	elongation factor Tu; Reviewed	99.98
PRK00049		396	elongation factor Tu; Reviewed	99.97
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	99.97
PLN03127		447	Elongation factor Tu; Provisional	99.97
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	99.97
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.97
PRK12317		425	elongation factor 1-alpha; Reviewed	99.97
COG0050		394	TufB GTPases - translation elongation factors [Tra	99.97
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	99.97
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	99.97
KOG0460		449	consensus Mitochondrial translation elongation fac	99.97
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.97
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.96
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	99.96
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	99.95
PRK05306		787	infB translation initiation factor IF-2; Validated	99.95
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.95
KOG0459		501	consensus Polypeptide release factor 3 [Translatio	99.94
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	99.94
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	99.94
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.93
PRK04000		411	translation initiation factor IF-2 subunit gamma;	99.93
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.93
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	99.93
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	99.92
CHL00189		742	infB translation initiation factor 2; Provisional	99.92
COG3276		447	SelB Selenocysteine-specific translation elongatio	99.92
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	99.91
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.91
COG5258		527	GTPBP1 GTPase [General function prediction only]	99.89
cd04098		80	eEF2_C_snRNP eEF2_C_snRNP: This family includes a	99.89
KOG0461		522	consensus Selenocysteine-specific elongation facto	99.89
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	99.86
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.86
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.85
KOG1145		683	consensus Mitochondrial translation initiation fac	99.85
PF00679		89	EFG_C: Elongation factor G C-terminus; InterPro: I	99.84
smart00838		85	EFG_C Elongation factor G C-terminus. This domain	99.84
PF03764		120	EFG_IV: Elongation factor G, domain IV; InterPro:	99.83
PRK04004		586	translation initiation factor IF-2; Validated	99.83
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.83
cd04096		80	eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r	99.82
cd04097		78	mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo	99.82
cd03711		78	Tet_C Tet_C: C-terminus of ribosomal protection pr	99.81
cd03713		78	EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-	99.8
cd03710		79	BipA_TypA_C BipA_TypA_C: a C-terminal portion of B	99.79
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.78
cd01514		79	Elongation_Factor_C Elongation factor G C-terminus	99.78
PF14492		75	EFG_II: Elongation Factor G, domain II; PDB: 1WDT_	99.78
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.77
cd03709		80	lepA_C lepA_C: This family represents the C-termin	99.76
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.74
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.72
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.71
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.7
cd04090		94	eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina	99.66
cd01684		115	Tet_like_IV EF-G_domain IV_RPP domain is a part of	99.65
cd01680		116	EFG_like_IV Elongation Factor G-like domain IV. Th	99.62
KOG0466		466	consensus Translation initiation factor 2, gamma s	99.6
cd03690		85	Tet_II Tet_II: This subfamily represents domain II	99.6
PRK14845		1049	translation initiation factor IF-2; Provisional	99.58
cd04092		83	mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri	99.54
cd00881		189	GTP_translation_factor GTP translation factor fami	99.52
cd01434		116	EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do	99.51
cd03700		93	eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami	99.5
cd03689		85	RF3_II RF3_II: this subfamily represents the domai	99.49
cd04088		83	EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen	99.48
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.47
cd04091		81	mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri	99.46
cd01693		120	mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i	99.44
KOG0463		641	consensus GTP-binding protein GP-1 [General functi	99.44
cd03691		86	BipA_TypA_II BipA_TypA_II: domain II of BipA (also	99.43
cd03699		86	lepA_II lepA_II: This subfamily represents the dom	99.34
KOG1143		591	consensus Predicted translation elongation factor	99.3
KOG1144		1064	consensus Translation initiation factor 5B (eIF-5B	99.28
COG1159		298	Era GTPase [General function prediction only]	99.27
KOG0052		391	consensus Translation elongation factor EF-1 alpha	99.25
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.25
COG1160		444	Predicted GTPases [General function prediction onl	99.23
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.17
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.17
PRK00093		435	GTP-binding protein Der; Reviewed	99.16
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.1
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.09
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.09
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.07
PRK03003		472	GTP-binding protein Der; Reviewed	99.06
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.05
PRK00093		435	GTP-binding protein Der; Reviewed	99.05
COG1160		444	Predicted GTPases [General function prediction onl	99.04
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.04
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.04
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.03
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.02
PRK15494		339	era GTPase Era; Provisional	99.02
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.01
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	98.98
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	98.98
COG2229		187	Predicted GTPase [General function prediction only	98.97
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.97
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.96
PRK03003		472	GTP-binding protein Der; Reviewed	98.95
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.95
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	98.94
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	98.93
PRK15467		158	ethanolamine utilization protein EutP; Provisional	98.93
PRK00089		292	era GTPase Era; Reviewed	98.92
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	98.92
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	98.91
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.91
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	98.91
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.9
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	98.9
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	98.89
cd04105		203	SR_beta Signal recognition particle receptor, beta	98.89
smart00178		184	SAR Sar1p-like members of the Ras-family of small	98.89
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	98.88
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.88
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	98.87
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	98.87
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	98.86
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.86
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	98.86
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	98.85
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	98.85
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	98.85
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	98.84
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	98.84
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	98.84
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.83
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	98.81
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	98.8
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	98.8
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	98.8
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	98.8
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	98.8
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.79
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	98.79
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	98.79
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	98.78
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	98.77
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	98.77
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	98.76
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.76
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.75
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	98.75
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	98.73
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	98.73
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.73
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	98.73
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	98.73
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.71
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	98.71
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	98.71
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	98.71
PLN03118		211	Rab family protein; Provisional	98.7
PTZ00369		189	Ras-like protein; Provisional	98.69
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	98.69
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	98.68
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	98.68
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	98.67
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.67
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	98.67
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	98.64
cd01881		176	Obg_like The Obg-like subfamily consists of five w	98.63
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	98.63
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	98.62
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	98.62
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	98.62
PF03144		74	GTP_EFTU_D2: Elongation factor Tu domain 2; InterP	98.61
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	98.61
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	98.6
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	98.59
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	98.59
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	98.59
PRK04213		201	GTP-binding protein; Provisional	98.59
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	98.58
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.57
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.57
PRK12298		390	obgE GTPase CgtA; Reviewed	98.57
COG1084		346	Predicted GTPase [General function prediction only	98.57
PRK11058		426	GTPase HflX; Provisional	98.56
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	98.54
PLN00223		181	ADP-ribosylation factor; Provisional	98.54
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	98.54
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	98.54
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.53
COG0218		200	Predicted GTPase [General function prediction only	98.53
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	98.53
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	98.53
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	98.52
COG0486		454	ThdF Predicted GTPase [General function prediction	98.51
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	98.51
PLN03110		216	Rab GTPase; Provisional	98.5
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	98.5
PF09439		181	SRPRB: Signal recognition particle receptor beta s	98.49
PRK12299		335	obgE GTPase CgtA; Reviewed	98.49
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	98.48
PTZ00133		182	ADP-ribosylation factor; Provisional	98.48
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	98.48
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	98.47
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	98.47
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	98.47
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	98.46
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	98.46
PLN03108		210	Rab family protein; Provisional	98.46
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.45
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	98.45
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	98.43
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	98.43
PRK12296		500	obgE GTPase CgtA; Reviewed	98.42
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.4
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	98.4
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	98.4
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	98.39
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	98.37
PRK12297		424	obgE GTPase CgtA; Reviewed	98.37
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	98.36
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	98.35
cd03698		83	eRF3_II_like eRF3_II_like: domain similar to domai	98.35
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	98.34
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	98.33
cd03693		91	EF1_alpha_II EF1_alpha_II: this family represents	98.33
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	98.31
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	98.27
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.26
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	98.26
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	98.25
cd01342		83	Translation_Factor_II_like Translation_Factor_II_l	98.24
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.23
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.23
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.22
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	98.18
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	98.13
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	98.11
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	98.07
cd04089		82	eRF3_II eRF3_II: domain II of the eukaryotic class	98.07
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	98.06
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	98.06
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	98.05
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	98.04
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	98.04
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	98.03
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	98.02
PRK09866		741	hypothetical protein; Provisional	98.02
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	98.01
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	97.96
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	97.96
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	97.95
PLN00023		334	GTP-binding protein; Provisional	97.92
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	97.91
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	97.9
PTZ00258		390	GTP-binding protein; Provisional	97.87
cd03694		87	GTPBP_II Domain II of the GP-1 family of GTPase. T	97.85
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	97.85
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	97.82
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	97.79
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.78
cd03697		87	EFTU_II EFTU_II: Elongation factor Tu domain II. E	97.78
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	97.78
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	97.76
cd03696		83	selB_II selB_II: this subfamily represents the dom	97.75
PRK09601		364	GTP-binding protein YchF; Reviewed	97.75
COG1100		219	GTPase SAR1 and related small G proteins [General	97.72
cd03695		81	CysN_NodQ_II CysN_NodQ_II: This subfamily represen	97.7
COG2262		411	HflX GTPases [General function prediction only]	97.68
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	97.67
PRK09435		332	membrane ATPase/protein kinase; Provisional	97.61
PRK13768		253	GTPase; Provisional	97.6
KOG0090		238	consensus Signal recognition particle receptor, be	97.59
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	97.59
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	97.56
cd03688		113	eIF2_gamma_II eIF2_gamma_II: this subfamily repres	97.55
COG1163		365	DRG Predicted GTPase [General function prediction	97.53
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	97.52
PRK10416		318	signal recognition particle-docking protein FtsY;	97.51
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	97.49
PRK09602		396	translation-associated GTPase; Reviewed	97.49
TIGR00064		272	ftsY signal recognition particle-docking protein F	97.48
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	97.45
KOG0073		185	consensus GTP-binding ADP-ribosylation factor-like	97.45
KOG1547		336	consensus Septin CDC10 and related P-loop GTPases	97.44
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	97.4
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	97.38
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	97.36
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.34
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	97.32
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	97.3
KOG0084		205	consensus GTPase Rab1/YPT1, small G protein superf	97.28
PRK00771		437	signal recognition particle protein Srp54; Provisi	97.25
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	97.25
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	97.25
COG3596		296	Predicted GTPase [General function prediction only	97.24
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	97.23
cd03114		148	ArgK-like The function of this protein family is u	97.19
COG5019		373	CDC3 Septin family protein [Cell division and chro	97.15
KOG0080		209	consensus GTPase Rab18, small G protein superfamil	97.12
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	97.09
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	97.08
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.06
KOG0078		207	consensus GTP-binding protein SEC4, small G protei	97.06
cd03115		173	SRP The signal recognition particle (SRP) mediates	97.05
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.05
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.03
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	97.02
PRK14974		336	cell division protein FtsY; Provisional	97.02
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	97.02
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	96.99
PRK12288		347	GTPase RsgA; Reviewed	96.98
PRK10867		433	signal recognition particle protein; Provisional	96.93
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	96.86
cd03692		84	mtIF2_IVc mtIF2_IVc: this family represents the C2	96.84
PRK12289		352	GTPase RsgA; Reviewed	96.79
KOG0098		216	consensus GTPase Rab2, small G protein superfamily	96.78
KOG2655		366	consensus Septin family protein (P-loop GTPase) [C	96.76
TIGR00959		428	ffh signal recognition particle protein. This mode	96.74
cd03112		158	CobW_like The function of this protein family is u	96.71
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	96.7
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.66
KOG0070		181	consensus GTP-binding ADP-ribosylation factor Arf1	96.62
PRK13796		365	GTPase YqeH; Provisional	96.61
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	96.58
KOG0095		213	consensus GTPase Rab30, small G protein superfamil	96.58
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.58
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	96.55
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	96.5
PRK09563		287	rbgA GTPase YlqF; Reviewed	96.49
COG1162		301	Predicted GTPases [General function prediction onl	96.49
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	96.48
PRK08099		399	bifunctional DNA-binding transcriptional repressor	96.46
COG1161		322	Predicted GTPases [General function prediction onl	96.46
KOG2486		320	consensus Predicted GTPase [General function predi	96.44
TIGR00257		204	IMPACT_YIGZ uncharacterized protein, YigZ family.	96.41
KOG0076		197	consensus GTP-binding ADP-ribosylation factor-like	96.4
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	96.4
KOG1534		273	consensus Putative transcription factor FET5 [Tran	96.33
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	96.32
PRK11568		204	hypothetical protein; Provisional	96.31
KOG0077		193	consensus Vesicle coat complex COPII, GTPase subun	96.26
PTZ00099		176	rab6; Provisional	96.23
KOG1486		364	consensus GTP-binding protein DRG2 (ODN superfamil	96.22
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	96.18
PRK00098		298	GTPase RsgA; Reviewed	96.16
cd03110		179	Fer4_NifH_child This protein family's function is	96.14
KOG0395		196	consensus Ras-related GTPase [General function pre	96.14
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	96.06
KOG0086		214	consensus GTPase Rab4, small G protein superfamily	96.0
KOG0092		200	consensus GTPase Rab5/YPT51 and related small G pr	95.98
KOG0075		186	consensus GTP-binding ADP-ribosylation factor-like	95.95
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	95.95
TIGR00092		368	GTP-binding protein YchF. This predicted GTP-bindi	95.92
TIGR00101		199	ureG urease accessory protein UreG. This model rep	95.91
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	95.91
KOG0074		185	consensus GTP-binding ADP-ribosylation factor-like	95.87
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	95.84
COG0536		369	Obg Predicted GTPase [General function prediction	95.74
cd03702		95	IF2_mtIF2_II This family represents the domain II	95.68
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	95.66
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	95.62
KOG3883		198	consensus Ras family small GTPase [Signal transduc	95.62
KOG0079		198	consensus GTP-binding protein H-ray, small G prote	95.59
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	95.56
KOG0394		210	consensus Ras-related GTPase [General function pre	95.4
KOG0087		222	consensus GTPase Rab11/YPT3, small G protein super	95.24
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	95.07
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	95.01
KOG0093		193	consensus GTPase Rab3, small G protein superfamily	94.95
KOG1533		290	consensus Predicted GTPase [General function predi	94.86
PRK01889		356	GTPase RsgA; Reviewed	94.86
PF13555		62	AAA_29: P-loop containing region of AAA domain	94.61
cd03701		95	IF2_IF5B_II IF2_IF5B_II: This family represents th	94.58
KOG0780		483	consensus Signal recognition particle, subunit Srp	94.44
KOG0410		410	consensus Predicted GTP binding protein [General f	94.3
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	94.11
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	93.83
KOG1954		532	consensus Endocytosis/signaling protein EHD1 [Sign	93.66
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	93.54
PF06431		417	Polyoma_lg_T_C: Polyomavirus large T antigen C-ter	93.53
PRK13849		231	putative crown gall tumor protein VirC1; Provision	93.5
COG0012		372	Predicted GTPase, probable translation factor [Tra	93.5
KOG4252		246	consensus GTP-binding protein [Signal transduction	93.29
cd03703		110	aeIF5B_II aeIF5B_II: This family represents the do	93.22
PHA00729		226	NTP-binding motif containing protein	93.21
cd03116		159	MobB Molybdenum is an essential trace element in t	93.17
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	93.11
KOG2423		572	consensus Nucleolar GTPase [General function predi	93.02
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	92.95
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	92.88
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	92.82
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	92.8
KOG0096		216	consensus GTPase Ran/TC4/GSP1 (nuclear protein tra	92.76
PRK11537		318	putative GTP-binding protein YjiA; Provisional	92.7
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	92.66
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	92.51
COG4559		259	ABC-type hemin transport system, ATPase component	92.38
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	92.37
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	92.32
PRK05480		209	uridine/cytidine kinase; Provisional	92.18
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	92.02
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	91.99
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	91.95
cd02036		179	MinD Bacterial cell division requires the formatio	91.94
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	91.88
KOG1424		562	consensus Predicted GTP-binding protein MMR1 [Gene	91.86
TIGR00235		207	udk uridine kinase. Model contains a number of lon	91.76
KOG4181		491	consensus Uncharacterized conserved protein [Funct	91.73
PRK08118		167	topology modulation protein; Reviewed	91.72
COG0523		323	Putative GTPases (G3E family) [General function pr	91.67
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	91.57
PRK07261		171	topology modulation protein; Provisional	91.56
PRK07667		193	uridine kinase; Provisional	91.54
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	91.42
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	91.37
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	91.35
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	91.33
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	91.28
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	91.27
PRK08233		182	hypothetical protein; Provisional	91.24
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	91.17
KOG0071		180	consensus GTP-binding ADP-ribosylation factor Arf6	91.16
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	91.13
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	91.13
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	91.03
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	90.94
KOG0088		218	consensus GTPase Rab21, small G protein superfamil	90.83
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	90.83
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	90.8
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	90.72
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	90.54
PRK06547		172	hypothetical protein; Provisional	90.45
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	90.43
PRK13833		323	conjugal transfer protein TrbB; Provisional	90.32
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	90.26
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	90.23
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	90.2
smart00382		148	AAA ATPases associated with a variety of cellular	90.16
PRK05057		172	aroK shikimate kinase I; Reviewed	90.14
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	90.13
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	90.11
PF09186		56	DUF1949: Domain of unknown function (DUF1949); Int	90.09
cd03111		106	CpaE_like This protein family consists of proteins	90.01
PF14578		81	GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1	89.96
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	89.93
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	89.87
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	89.86
COG0410		237	LivF ABC-type branched-chain amino acid transport	89.63
PF00005		137	ABC_tran: ABC transporter This structure is on hol	89.61
PRK14738		206	gmk guanylate kinase; Provisional	89.56
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	89.53
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	89.44
PRK13949		169	shikimate kinase; Provisional	89.36
KOG1491		391	consensus Predicted GTP-binding protein (ODN super	89.35
PRK06696		223	uridine kinase; Validated	89.35
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	89.34
PTZ00301		210	uridine kinase; Provisional	89.23
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	89.11
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	89.06
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	89.0
PRK06217		183	hypothetical protein; Validated	88.99
PRK00625		173	shikimate kinase; Provisional	88.98
KOG2484		435	consensus GTPase [General function prediction only	88.73
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	88.72
PRK13947		171	shikimate kinase; Provisional	88.71
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	88.69
cd02034		116	CooC The accessory protein CooC, which contains a	88.65

>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=1.3e-162  Score=1264.23  Aligned_cols=748  Identities=67%  Similarity=1.102  Sum_probs=728.3

Q ss_pred             CcccCHHHHHHhhcccCCeeEEEEEeCCCCChHHHHHHHHHHcCCCccccCCCccccCCchhHhHhcceeccceEEEEEe
Q 004467            1 MVKFTAEGLRRIMDFKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYE   80 (752)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~iRni~iighvd~GKTTL~~~ll~~~g~i~~~~~g~~~~~D~~~~E~eRgiTi~s~~~~~~~~   80 (752)
                      |+.|..++++.+|.+..+|||+++++|||||||||+++|...+|+|+..++|+.++||++++||||||||+|+.+++.|+
T Consensus         1 Mv~Ftvd~vr~lM~k~~NiRNmSVIAHVDHGKSTLTDsLV~kAgIis~akaGe~Rf~DtRkDEQeR~iTIKStAISl~~e   80 (842)
T KOG0469|consen    1 MVAFTVDQVRELMDKKKNIRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGETRFTDTRKDEQERGITIKSTAISLFFE   80 (842)
T ss_pred             CccccHHHHHHHhccccccccceEEEEecCCcchhhHHHHHhhceeeecccCCccccccccchhhcceEeeeeeeeehhh
Confidence            88999999999999999999999999999999999999999999999888999999999999999999999999999999


Q ss_pred             eccchhccccCCCCCCceEEEEEcCCCCcccHHHHHHHHHhhcceEEEEecchhHH------------------------
Q 004467           81 MTDDALKSYKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVC------------------------  136 (752)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~inliDtPGh~df~~e~~~~l~~~D~avlvvda~~Gv~------------------------  136 (752)
                      ..+..++.+....+++++.|||||+|||+||++||..|||+.|||++|||+++|+|                        
T Consensus        81 ~~~~dl~~~k~~~d~~~FLiNLIDSPGHVDFSSEVTAALRVTDGALVVVDcv~GvCVQTETVLrQA~~ERIkPvlv~NK~  160 (842)
T KOG0469|consen   81 MSDDDLKFIKQEGDGNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLVMNKM  160 (842)
T ss_pred             hhHhHHHHhcCCCCCcceeEEeccCCCcccchhhhhheeEeccCcEEEEEccCceEechHHHHHHHHHhhccceEEeehh
Confidence            87777777777788889999999999999999999999999999999999999998                        


Q ss_pred             -------------------------------------------------------------------HHHHHhCCCHHHH
Q 004467          137 -------------------------------------------------------------------MYASKFGVDESKM  149 (752)
Q Consensus       137 -------------------------------------------------------------------~~~~~~~~p~~~~  149 (752)
                                                                                         .|++++|+.+-.+
T Consensus       161 DRAlLELq~~~EeLyqtf~R~VE~vNviisTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF~~~~~km  240 (842)
T KOG0469|consen  161 DRALLELQLSQEELYQTFQRIVENVNVIISTYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKFGIDVRKM  240 (842)
T ss_pred             hHHHHhhcCCHHHHHHHHHHHHhcccEEEEecccCCcCceEecCCCCceeeccccchhhhhHHHHHHHHHHHhCCcHHHH
Confidence                                                                               8899999999999


Q ss_pred             HHHhhCCCCcchhhccccccC---CCCccccCcceeeEechHHHHHHHhhccchhhHHHHHHHcCCCCChhhHhhchHHH
Q 004467          150 MERLWGENFFDPATKKWTTKN---TGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQKLGVTMKSEEKDLMGKAL  226 (752)
Q Consensus       150 inkldg~~~~~~~~~~~~~~~---~g~~~~~~~fv~~~l~~i~~l~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~l  226 (752)
                      .|++||++|+++.+++|++..   .|. ++.+.||.|+++||+++++++++...+++..+++++++.+..++...++++|
T Consensus       241 m~~LWg~~~f~~ktkk~~~s~t~~~gn-~~~r~F~~~iLdPIykvfdaimN~kkeei~~llekl~v~lk~~~kd~eGK~L  319 (842)
T KOG0469|consen  241 MNRLWGDNFFNPKTKKWSKSATDAEGN-PLRRAFCMFILDPIYKVFDAIMNFKKEEIATLLEKLEVTLKGDEKDLEGKAL  319 (842)
T ss_pred             HHHhhcccccCccCCcccccccccccC-ccccceeEEeechHHHHHHHHhhccHHHHHHHHHHhcceeccccccccchHH
Confidence            999999999999999999765   454 6789999999999999999999999999999999999999888888899999


Q ss_pred             HHHHHhccccchHHHHHHHHhcCCCchhhhhhhhhcccCCCCcccccccccccCCCCCeEEEEEEEeecCCCCceeEEEE
Q 004467          227 MKRVMQTWLPASSALLEMMIFHLPSPSTAQKYRVENLYEGPLDDQYANAIRNCDPNGPLMLYVSKMIPASDKGRFFAFGR  306 (752)
Q Consensus       227 ~~~~~~~~~P~~~~LLd~i~~~lPsP~e~~~~~~~~~~~g~~~~~~~~~i~~~~~~~pl~~~V~Kv~~~~~~g~~v~~~R  306 (752)
                      ++.+|++|+|..++||++|.-++|||..+|.||.+.+|+||.+++..-+|++||+++|+.+||+|+.+..++|+|.+|||
T Consensus       320 lK~vMr~wLPAadallemIalhLPSPvtaQkyR~e~LYEGP~DDe~a~aik~CD~~aplmmYvSKMvPtsDkgRFyAFGR  399 (842)
T KOG0469|consen  320 LKVVMRKWLPAADALLEMIALHLPSPVTAQKYRAEYLYEGPADDEAAVAIKNCDPKAPLMMYVSKMVPTSDKGRFYAFGR  399 (842)
T ss_pred             HHHHHHHhcchHHHHHHHHHhhCCCchHHHHHHHHHhhcCCCchHHhhHhhccCCCCCeEEeeeeccccCCCceEEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeeecCCCEEEEccCCCCCCCcccceeeeeeeEEEEecCceeeeccccCCCEEEEeccccccccceeeccCCCCCccc
Q 004467          307 VFSGKVSTGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQFITKNATLTNEKEVDAHP  386 (752)
Q Consensus       307 V~SGtL~~Gd~v~i~~~n~~~~~~~~~~~~kv~~l~~~~g~~~~~V~ea~AGdIvai~Gl~~~~~~tgTL~~~~~~~~~~  386 (752)
                      ||||++.+|+++++.+|||.||++++++...|.+..+|||+..++++.++||||+++.|++++++++||+++.+  ....
T Consensus       400 VFsG~v~~G~KvRiqgPnY~PGkkedl~~K~iqRtvlMMGr~vepied~PaGNIiGlvGvDqfLvKtGTiTt~e--~AHN  477 (842)
T KOG0469|consen  400 VFSGKVFTGLKVRIQGPNYVPGKKEDLYIKAIQRTVLMMGRFVEPIEDCPAGNIIGLVGVDQFLVKTGTITTSE--AAHN  477 (842)
T ss_pred             eecceeccCcEEEEeCCCCCCCcHHHHHHHHHHHHHHHhcccccccccCCCCcEEEEeehhHhhhccCceeehh--hhcc
Confidence            99999999999999999999999998888889999999999999999999999999999999999999999988  7788


Q ss_pred             cccccccCCceEEEEEEeCCCCCHhHHHHHHHHHHhcCCeEEEEEcCCCcEEEEecchhhHHHHHHHHHhhcCCCcEEEE
Q 004467          387 IRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCTIEESGEHIVAGAGELHLEICLKDLQDDFMGGAEIIK  466 (752)
Q Consensus       387 ~~~~~~~~~Pv~~~~i~p~~~~d~~kL~~~L~~L~~eDPsl~v~~~etge~il~g~GelhLei~~~rL~~~f~~~vev~~  466 (752)
                      +..|+|...||+.++|+++++.|++||.++|++|+++||...+..+|+||++|.|.||||||||+++|.+.|| +|.++.
T Consensus       478 mrvMKFSVSPVV~VAVe~Knp~DLpKLvEGLkrLakSDP~v~~~~~esGehiiAgaGeLHLEICLkDLeedhA-~iPlk~  556 (842)
T KOG0469|consen  478 MRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHA-CIPLKK  556 (842)
T ss_pred             ceEEEeeccceEEEEEecCChhhhHHHHHHHHHHhccCCeEEEEeccCCceEEeccchhhHHHHHhhHhhccc-CCceec
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999 999999


Q ss_pred             eCcEEEEEeecccccceeEEeecCCCceEEEEEEEeCChhhHHHHHcCCCCCCCChHHHHHHhhhhcCCchhccCcEEEe
Q 004467          467 SDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKARSKILSEEFGWDKDLAKKIWCF  546 (752)
Q Consensus       467 s~p~V~yrETi~~~~~~~~~~~~~~~~~~i~~~~ePl~~~~~~~i~~g~~~~~~~~~~~~~~l~~~~~~~~~~~~~v~~~  546 (752)
                      |+|.|+||||+.++++..|.++|||+||++|++++||++++.+.|+.|.++++|++|.|+.+|.+.|+||-+++++||||
T Consensus       557 sdPvVsYrEtvs~~ss~~~lsKSpNKHNRi~mtaeP~~~~l~~~i~~g~v~~rd~fK~rAr~~aeky~~dvt~aRKIWCf  636 (842)
T KOG0469|consen  557 SDPVVSYRETVSEESSQTCLSKSPNKHNRIYMTAEPMDDGLSDDIENGKVNARDEFKARARILAEKYGWDVTEARKIWCF  636 (842)
T ss_pred             CCCeeeeecccccccchhhhccCCcccceeEEecccCCchhhhhhhcCccChhHHHHHHHHHHHHHhCCchhhhheeeEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCceEEecccCccchHHHHHHHHHHHHHHHHcCCcCCCCeeeeEEEEEeeeecccccccCCCchHHHHHHHHHHH
Q 004467          547 GPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYAS  626 (752)
Q Consensus       547 ~P~~~~~n~~~~~~~~~~~~~~~~~~i~~G~~~a~~~Gpl~~~pv~~v~v~l~d~~~~~d~~~~~~~~~~~a~~~a~~~a  626 (752)
                      ||+..|+|+++|.++|.+|+++|++++.+|||||.++|||+||.++||+|.|.|..+|+|..|++++|+++.+|++|+.+
T Consensus       637 gPd~tg~Nll~D~TK~vqylnEIKdsVvagFqwA~keG~l~~E~mRgvrfni~DvtLHADAIHRGggQiipt~rr~~ya~  716 (842)
T KOG0469|consen  637 GPDGTGPNLLVDQTKGVQYLNEIKDSVVAGFQWATKEGPLFGENMRGVRFNILDVTLHADAIHRGGGQIIPTARRVLYAS  716 (842)
T ss_pred             CCCCCCCcEEEecchhhHHHHHHHHHHHHHHHHHhccCCcccccccceeEEeeeeeeehhhhhcCCCeechHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCeEEeeEEEEEEEecCcccccHHHHhhhhccccccccccCCCCcEEEEEEecchhhcCchHHhhhhCCCceeeee
Q 004467          627 QLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQC  706 (752)
Q Consensus       627 ~~~a~~~LlEPi~~~eI~~p~~~~g~v~~~L~~rrg~i~~~~~~~~~~~~~I~a~vP~~e~~gy~~~Lrs~T~G~~~~~~  706 (752)
                      ++.|+|+|+||+|.|||+||+.++|.||++|++|||++.+++...|+++|.|+|++|+.|+|||..+|||.|+|+|.+||
T Consensus       717 ~l~A~P~l~EPvylvEIq~pe~avGgiy~vLn~kRG~v~~e~q~~Gtp~f~vkayLPVnESFgFt~dLrs~t~GqAfpq~  796 (842)
T KOG0469|consen  717 VLTAGPILQEPVYLVEIQCPEQAVGGIYGVLNRKRGHVFEEEQVPGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQM  796 (842)
T ss_pred             HHhcCceecCceEEEEEeCchhhhchhhheeeccccceecccccCCCcceEEEEEeecccccccchhhhcccCCccccce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecceeecCCCCCCCchHHHHHHHHHHHhcCCCCCCCCcccccccC
Q 004467          707 VFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL  752 (752)
Q Consensus       707 ~f~~y~~v~~d~~~~~~~~~~~~~~~r~rkGl~~~i~~~~~~~~~l  752 (752)
                      .|+||+++|+||+|++|..-+++.++||||||.|.+|.+.+|+|||
T Consensus       797 vFdHws~lpgdp~dp~sk~~~iV~~~RKrkglke~~P~~~~y~Dkl  842 (842)
T KOG0469|consen  797 VFDHWSILPGDPLDPTSKPGQIVLATRKRKGLKEGVPDLDEYLDKL  842 (842)
T ss_pred             eeeccccCCCCCCCCCccchHHHHHHHHhcCCCCCCCChHHHhhcC
Confidence            9999999999999999999999999999999999999999999997

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>COG5258 GTPBP1 GTPase [General function prediction only]	Back alignment and domain information

>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>smart00838 EFG_C Elongation factor G C-terminus	Back alignment and domain information

>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G	Back alignment and domain information

>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01514 Elongation_Factor_C Elongation factor G C-terminus	Back alignment and domain information

>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family	Back alignment and domain information

>cd01680 EFG_like_IV Elongation Factor G-like domain IV	Back alignment and domain information

>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G	Back alignment and domain information

>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3)	Back alignment and domain information

>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>cd01693 mtEFG2_like_IV mtEF-G2 domain IV	Back alignment and domain information

>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only]	Back alignment and domain information

>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu	Back alignment and domain information

>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only]	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG2486 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR00257 IMPACT_YIGZ uncharacterized protein, YigZ family	Back alignment and domain information

>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11568 hypothetical protein; Provisional	Back alignment and domain information

>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>KOG0395 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00092 GTP-binding protein YchF	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG0394 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>PF06431 Polyoma_lg_T_C: Polyomavirus large T antigen C-terminus; InterPro: IPR010932 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses []	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>KOG2423 consensus Nucleolar GTPase [General function prediction only]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11537 putative GTP-binding protein YjiA; Provisional	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only]	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>KOG4181 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>COG0523 Putative GTPases (G3E family) [General function prediction only]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only]	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PF09186 DUF1949: Domain of unknown function (DUF1949); InterPro: IPR015269 Members of this entry are a set of functionally uncharacterised hypothetical bacterial proteins	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>KOG2484 consensus GTPase [General function prediction only]	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

Homologous Structure Templates