Citrus Sinensis ID: 004481

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDDDFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRWVPV
cccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEccccccccccccccccccccccccEEEEEEEccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHcccccccccccccccccccccccccccccccEEccccccccccccccccccccEEEEccccccHHHHHHHHHHcccccccccEEEEccccEEEccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHcccccccccHHHHHHHccccccccccccccccEEEEEcccccccEEEEEEEccccccccEEEcccccccccccccc
cccccccccccccccccEEEEEEEccccccccccccccEcccccccEEEEccccccccccccEEccccccccccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccEEEcccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccccccccccEEEEcccccccccEEEEEEEccHHcHHHHHHHccccccccEEEEEccccccHHHHcHccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccccccEEEEccccccccccccccEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHHHccccccccEEEEEccccccHcccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHEEEEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccEEEccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEEEEEcccccccEEEEEEEcccccEEEEEEccccccHccEEEEc
mtpelisapvaedapiqysfateyegppvsydipravpinvqkiPVAAVVKQVSlsdklslpvvhpivsadklktsfskdlkpasveaevksettvsptsviDRAADSVNCVlsgelsssgalefsnyvsgelgncsngfnpttenlnissserSRESWsrlrgsnvgkesldmtdelnqpdwesnesvlsmdypssrvsslktgdlsnrinhdddgfesngdarrgpvvtfrdiasddededddfgdefsQEAPRIMQRVkrepetrgkkgscyrcfkgnrftekeVCIVCDAKYCCNCVLramgsmpegrkcvtcigypideakrgslgKCSRMLKRLLNPLEVKQIMKAEKLceanqlppeyicvngkplchEELVIlqtcpnppkklkpgnywydkvsglwgkegqkpskiisphlsvggpikpdasngntqifinGREITKVELRMLQLAGvqcagnphfwvnedgsyqeegqkNTKGYIWGMAKTKLVCAVlslpvpskssnpgaeqgsglmsrsvpdYIERRTLQKLLLVgcsgsgtstIFKQAKILykavpfsddehenIKLKIQSNAYGYLGILLEGRERFEEEILGEkrkkqssdetnpvgssdstdgktiytigPRLKAFSDWLLKTMVSGnleaifpaatreySPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVdisrtdyepsdldilyaegvtssnglacvdfsfprsasddsvdtadqhdsllrwvpv
mtpelisapvaedapIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIvsadklktsfskdlkpasveaevksettvsptsvidrAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTEnlnisssersreswsrlrgsnvgkesldmtdelnqpdWESNESVLSMDYPSSRVSslktgdlsnrinhdddgfesngdarrgpvvtfrdiasddededddfgdefsqeaprimqrvkrepetrgkkgscyrcfkgnrfteKEVCIVCDAKYCCNCVLramgsmpegrKCVTCIGYPIdeakrgslgkCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCpnppkklkpgNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKssnpgaeqgsglmSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILgekrkkqssdetnpvgssdstdgktiYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPrsasddsvdtadqhdsllrwvpv
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVlsgelsssgalefsNYVSGELGNCSNGFNPTTENLNIsssersreswsrlrgsNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASddededddfgdefSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRWVPV
**************PIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSA*************************************SVNCVLSG******ALEFSNYVSGEL*******************************************************************************************************************************************SCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGK**************************NTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSL***********************DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRER******************************TIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSF************************
**********AEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKI************************************************************************************************************************************************************************************************************************************************EKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVT************************LNPLEVKQI***********LP**YICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVC******************************IERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEK*************SSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRWVPV
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSK******************PTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLN****************SNVGKESLDMTDELNQPDWESNESVLSM**********KTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASD*********DEFSQEAPRIMQ************GSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPV***************MSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEIL*********************DGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPR***********QHDSLLRWVPV
*****ISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVS******************************SVIDRAADSVNCVLSGELSSSGA**********************************************************P*****ESVLS**********************************RGP*V***D*A******************PRIMQRV*******GKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRWV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDDDFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRWVPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query750 2.2.26 [Sep-21-2011]
P93163 385 Guanine nucleotide-bindin no no 0.256 0.498 0.308 1e-15
P49082 384 Guanine nucleotide-bindin N/A no 0.254 0.497 0.302 3e-15
P49084 385 Guanine nucleotide-bindin no no 0.222 0.433 0.309 4e-15
O04279 384 Guanine nucleotide-bindin N/A no 0.222 0.434 0.319 2e-14
Q0DJ33 380 Guanine nucleotide-bindin no no 0.226 0.447 0.334 3e-14
A2Y3B5 380 Guanine nucleotide-bindin N/A no 0.226 0.447 0.334 3e-14
O04278 384 Guanine nucleotide-bindin N/A no 0.221 0.432 0.303 4e-14
Q40224 384 Guanine nucleotide-bindin N/A no 0.221 0.432 0.308 4e-14
P26981 384 Guanine nucleotide-bindin N/A no 0.222 0.434 0.324 1e-12
P93564 384 Guanine nucleotide-bindin N/A no 0.222 0.434 0.324 1e-12
>sp|P93163|GPA2_SOYBN Guanine nucleotide-binding protein alpha-2 subunit OS=Glycine max GN=GPA2 PE=2 SV=1 Back     alignment and function desciption
 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 111/227 (48%), Gaps = 35/227 (15%)

Query: 529 RTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRE 588
           + +QKLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G +
Sbjct: 38  KHIQKLLLLGAGESGKSTIFKQIKLLFQT-GFDEAELKSYLPVIHANVYQTIKLLHDGSK 96

Query: 589 RFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIF 648
            F +               N V SS        Y I    K   + LL+  + G L+  +
Sbjct: 97  EFAQ---------------NDVDSSK-------YVISNENKEIGEKLLE--IGGRLD--Y 130

Query: 649 PAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDIL 708
           P  ++E +  +E LWKD AIQ TY+R SEL+ +     YF+E +  +S  +Y P+  D+L
Sbjct: 131 PYLSKELAQEIENLWKDPAIQETYARGSELQ-IPDCTDYFMENLQRLSDANYVPTKEDVL 189

Query: 709 YAEGVTSSNGLACVDFS-FPRSASDDSV----DTADQHDSLLRWVPV 750
           YA   T+  G+  + FS    +   D V    D   Q +   +W+ +
Sbjct: 190 YARVRTT--GVVEIQFSPVGENKKSDEVYRLFDVGGQRNERRKWIHL 234
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Glycine max (taxid: 3847)
>sp|P49082|GPA1_LOTJA Guanine nucleotide-binding protein alpha-1 subunit OS=Lotus japonicus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P49084|GPA1_SOYBN Guanine nucleotide-binding protein alpha-1 subunit OS=Glycine max GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|O04279|GPA2_PEA Guanine nucleotide-binding protein alpha-2 subunit OS=Pisum sativum GN=GPA2 PE=2 SV=1 Back     alignment and function description
>sp|Q0DJ33|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica GN=GPA1 PE=1 SV=2 Back     alignment and function description
>sp|A2Y3B5|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. indica GN=GPA1 PE=2 SV=2 Back     alignment and function description
>sp|O04278|GPA1_PEA Guanine nucleotide-binding protein alpha-1 subunit OS=Pisum sativum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|Q40224|GPA1_LUPLU Guanine nucleotide-binding protein alpha-1 subunit OS=Lupinus luteus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P26981|GPA1_SOLLC Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum lycopersicum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P93564|GPA1_SOLTU Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum tuberosum GN=GPA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query750
359480423 918 PREDICTED: uncharacterized protein LOC10 0.949 0.775 0.719 0.0
255562733 917 GTP-binding protein alpha subunit, gna, 0.946 0.774 0.719 0.0
356537768 917 PREDICTED: uncharacterized protein LOC10 0.949 0.776 0.694 0.0
356496832 915 PREDICTED: uncharacterized protein LOC10 0.948 0.777 0.693 0.0
147794785 1056 hypothetical protein VITISV_002365 [Viti 0.96 0.681 0.625 0.0
449448536 908 PREDICTED: uncharacterized protein LOC10 0.937 0.774 0.686 0.0
449520756 908 PREDICTED: uncharacterized protein LOC10 0.937 0.774 0.686 0.0
357483115 907 Guanine nucleotide-binding protein alpha 0.934 0.772 0.685 0.0
357483117 908 Guanine nucleotide-binding protein alpha 0.930 0.768 0.686 0.0
224096872 901 predicted protein [Populus trichocarpa] 0.921 0.766 0.686 0.0
>gi|359480423|ref|XP_003632458.1| PREDICTED: uncharacterized protein LOC100248291 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/744 (71%), Positives = 602/744 (80%), Gaps = 32/744 (4%)

Query: 10  VAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVS 69
           V +D P  YSFA EY GPPV+YDIPRAVPINV+KIPVA VV QVSLSDKLSLPVV P+++
Sbjct: 7   VDDDGP--YSFAMEYHGPPVTYDIPRAVPINVEKIPVATVVAQVSLSDKLSLPVVQPLLA 64

Query: 70  ADKLKTSFSKDLKPASVEAEVKSETTVSPTSVI--DRAAD---SVNCVLSGELSSSGALE 124
            D      SK++K       + S++TVSPTSVI  +R ++      CVLSGEL+SSGALE
Sbjct: 65  PDPRCKMLSKEIK-------LGSKSTVSPTSVIAFERGSEDDAGHECVLSGELTSSGALE 117

Query: 125 FSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWE 184
           FS+  +  LG   +       +    S + S  S +    SN  KESLD  D LN PDW 
Sbjct: 118 FSDNSNELLGGAGSSGTIEFSDRLYKSRDLSGSSGA-FEVSNGCKESLDFND-LNAPDWV 175

Query: 185 SNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDD 244
           S ES +S+DYPSSRVSSLK GD SN         E   D RR PVV+FR +A DD     
Sbjct: 176 STESQVSLDYPSSRVSSLKAGDCSN---------EPGCDVRRTPVVSFRGVALDD----- 221

Query: 245 DFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRA 304
           D  +EFS   P I+ R K+EPET+GKKGSCYRCFKG+RFTEKEVCIVCDAKYC NCVLRA
Sbjct: 222 DTNEEFSSAEPEIV-RPKKEPETKGKKGSCYRCFKGSRFTEKEVCIVCDAKYCSNCVLRA 280

Query: 305 MGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPE 364
           MGSMPEGRKCVTCIGYPIDE+KRG+LGKCSRMLKRLLN LEV+QIMK+EK+CE NQLPPE
Sbjct: 281 MGSMPEGRKCVTCIGYPIDESKRGNLGKCSRMLKRLLNELEVRQIMKSEKMCETNQLPPE 340

Query: 365 YICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGG 424
           Y+CVN KPL  EELV+LQ CPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISP+LSVGG
Sbjct: 341 YVCVNEKPLSQEELVLLQNCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPNLSVGG 400

Query: 425 PIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY 484
           PI+ +ASNGNTQ+FINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY
Sbjct: 401 PIRANASNGNTQVFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY 460

Query: 485 IWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGT 544
           IWG A TKLVCAVLSLPVPSK  +P  EQ +  ++R+VPDY+E+RTLQKLLL+G +GSGT
Sbjct: 461 IWGKAGTKLVCAVLSLPVPSKFLSPSGEQVNNFVTRTVPDYLEQRTLQKLLLIGNNGSGT 520

Query: 545 STIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSS 604
           STIFKQAKILYKA PFS+DE ENIKLKIQSN YGYLGILLEGRERFE+E L E RK++S 
Sbjct: 521 STIFKQAKILYKATPFSEDERENIKLKIQSNVYGYLGILLEGRERFEDESLIEMRKRKSY 580

Query: 605 DETNPVGSS-DSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELW 663
            +++ +G++ D  D KTIY+IG RLKAFSDWLLKTMV+GNLEAIFPAATREY+PLVEELW
Sbjct: 581 HKSDSIGNTDDENDDKTIYSIGTRLKAFSDWLLKTMVAGNLEAIFPAATREYAPLVEELW 640

Query: 664 KDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVD 723
            DAAIQATY RRSELEML SVASYFLER VDI RTDYEPSD+DILYAEGVTSSNGLACVD
Sbjct: 641 NDAAIQATYKRRSELEMLPSVASYFLERAVDILRTDYEPSDVDILYAEGVTSSNGLACVD 700

Query: 724 FSFPRSASDDSVDTADQHDSLLRW 747
           FSFP+S   D +DTAD HDSLLR+
Sbjct: 701 FSFPQSEPGDDIDTADLHDSLLRY 724

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562733|ref|XP_002522372.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223538450|gb|EEF40056.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356537768|ref|XP_003537397.1| PREDICTED: uncharacterized protein LOC100820512 [Glycine max] Back     alignment and taxonomy information
>gi|356496832|ref|XP_003517269.1| PREDICTED: uncharacterized protein LOC100778059 [Glycine max] Back     alignment and taxonomy information
>gi|147794785|emb|CAN66844.1| hypothetical protein VITISV_002365 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449448536|ref|XP_004142022.1| PREDICTED: uncharacterized protein LOC101221850 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520756|ref|XP_004167399.1| PREDICTED: uncharacterized protein LOC101225793 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357483115|ref|XP_003611844.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] gi|355513179|gb|AES94802.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|357483117|ref|XP_003611845.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] gi|355513180|gb|AES94803.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|224096872|ref|XP_002310767.1| predicted protein [Populus trichocarpa] gi|222853670|gb|EEE91217.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query750
TAIR|locus:2046738 888 XLG1 "AT2G23460" [Arabidopsis 0.750 0.634 0.715 3.3e-241
UNIPROTKB|Q9LI02 867 P0029D06.12 "cDNA clone:J02303 0.633 0.547 0.556 3.9e-155
TAIR|locus:2034446 848 XLG3 "AT1G31930" [Arabidopsis 0.702 0.621 0.531 3.9e-153
UNIPROTKB|Q0IM71 686 Os12g0593000 "Os12g0593000 pro 0.561 0.613 0.617 3.7e-146
TAIR|locus:2116204 861 XLG2 "AT4G34390" [Arabidopsis 0.444 0.386 0.606 2.5e-119
UNIPROTKB|Q0IZ94 440 Os10g0117800 "Os10g0117800 pro 0.309 0.527 0.508 2.3e-55
UNIPROTKB|Q6QM19 362 Q6QM19 "Uncharacterized protei 0.125 0.259 0.333 2.3e-10
UNIPROTKB|Q14344 377 GNA13 "Guanine nucleotide-bind 0.12 0.238 0.351 2.5e-10
WB|WBGene00001673 363 gpa-11 [Caenorhabditis elegans 0.122 0.253 0.312 2.6e-10
UNIPROTKB|O76584 363 gpa-11 "Guanine nucleotide-bin 0.122 0.253 0.312 2.6e-10
TAIR|locus:2046738 XLG1 "AT2G23460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2137 (757.3 bits), Expect = 3.3e-241, Sum P(2) = 3.3e-241
 Identities = 419/586 (71%), Positives = 480/586 (81%)

Query:   169 KESLDMTDELNQP---DWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDAR 225
             KESLD+ +  + P   DWESNESVLSMDYPSSRV    TGD  +         E+NGD +
Sbjct:   133 KESLDLNESSSNPLVPDWESNESVLSMDYPSSRV----TGDCVS---------ETNGDGK 179

Query:   226 RGPVVTFRDIASXXXXXXXXXXXXXSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTE 285
             + PVVTF  IAS              +   R++  VK++P+T+GKKGSCYRCFKG+RFTE
Sbjct:   180 KQPVVTFLGIASDDGFEEEESCSNLRRV--RVVP-VKKQPQTKGKKGSCYRCFKGSRFTE 236

Query:   286 KEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLE 345
             KEVC+VCDAKYC +CVLRAMGSMPEGRKCVTCIG+PIDE+KRGSLGKCSRMLKRLLN LE
Sbjct:   237 KEVCLVCDAKYCNSCVLRAMGSMPEGRKCVTCIGFPIDESKRGSLGKCSRMLKRLLNDLE 296

Query:   346 VKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLW 405
             VKQIMK E+ CEANQLP EY+ VNG+PL  EELV LQTC NPPKKLKPG+YWYDKVSGLW
Sbjct:   297 VKQIMKTERFCEANQLPAEYVYVNGQPLYPEELVTLQTCSNPPKKLKPGDYWYDKVSGLW 356

Query:   406 GKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHF 465
             GKEG+KP +IISPHL+VGGPI P+ASNGNTQ+FINGREITKVELRMLQLAGVQCAGNPHF
Sbjct:   357 GKEGEKPYQIISPHLNVGGPISPEASNGNTQVFINGREITKVELRMLQLAGVQCAGNPHF 416

Query:   466 WVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSS-NPGAEQGSGLMSRSVPD 524
             WVNEDGSYQEEGQKNTKGYIWG A TKL+CAVLSLPVPSKS+ N   EQ     SRS+ D
Sbjct:   417 WVNEDGSYQEEGQKNTKGYIWGKAGTKLLCAVLSLPVPSKSTANASGEQLYSANSRSILD 476

Query:   525 YIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILL 584
             ++E RTLQK+LLVG SGSGTSTIFKQAKILYK VPF +DE ENIK+ IQ+N YGYLG+LL
Sbjct:   477 HLEHRTLQKILLVGNSGSGTSTIFKQAKILYKDVPFLEDERENIKVIIQTNVYGYLGMLL 536

Query:   585 EGRERFEEEILGEKRKKQSSDETNPVGSSDS-TDGKTI--YTIGPRLKAFSDWLLKTMVS 641
             EGRERFEEE L  +  KQ   E  P    D+ ++ KT+  Y+IGPRLKAFSDWLLKTM +
Sbjct:   537 EGRERFEEEALALRNTKQCVLENIPADEGDAKSNDKTVTMYSIGPRLKAFSDWLLKTMAA 596

Query:   642 GNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYE 701
             GNL  IFPAA+REY+PLVEELW+DAAIQATY RRSEL +L SVASYFLER +D+   DYE
Sbjct:   597 GNLGVIFPAASREYAPLVEELWRDAAIQATYKRRSELGLLPSVASYFLERAIDVLTPDYE 656

Query:   702 PSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRW 747
             PSDLDILYAEGVTSS+GLAC+DFSFP++AS++++D +D HDSLLR+
Sbjct:   657 PSDLDILYAEGVTSSSGLACLDFSFPQTASEENLDPSDHHDSLLRY 702
GO:0001664 "G-protein coupled receptor binding" evidence=IBA
GO:0003924 "GTPase activity" evidence=IBA
GO:0004871 "signal transducer activity" evidence=IEA;ISS;IBA
GO:0005834 "heterotrimeric G-protein complex" evidence=IBA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006184 "GTP catabolic process" evidence=IBA
GO:0007165 "signal transduction" evidence=IEA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA
GO:0019001 "guanyl nucleotide binding" evidence=IEA
GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA
GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA
GO:0005634 "nucleus" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IGI
GO:0009744 "response to sucrose stimulus" evidence=IGI
GO:0009749 "response to glucose stimulus" evidence=IGI
GO:0009750 "response to fructose stimulus" evidence=IGI
GO:0010555 "response to mannitol stimulus" evidence=IGI
GO:2000067 "regulation of root morphogenesis" evidence=IGI
UNIPROTKB|Q9LI02 P0029D06.12 "cDNA clone:J023031J07, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2034446 XLG3 "AT1G31930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IM71 Os12g0593000 "Os12g0593000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2116204 XLG2 "AT4G34390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IZ94 Os10g0117800 "Os10g0117800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QM19 Q6QM19 "Uncharacterized protein" [Strongylocentrotus purpuratus (taxid:7668)] Back     alignment and assigned GO terms
UNIPROTKB|Q14344 GNA13 "Guanine nucleotide-binding protein subunit alpha-13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00001673 gpa-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O76584 gpa-11 "Guanine nucleotide-binding protein alpha-11 subunit" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00013154001
SubName- Full=Chromosome undetermined scaffold_444, whole genome shotgun sequence; (896 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
cd00066 315 cd00066, G-alpha, Alpha subunit of G proteins (gua 3e-37
pfam00503 329 pfam00503, G-alpha, G-protein alpha subunit 1e-31
smart00275 342 smart00275, G_alpha, G protein alpha subunit 3e-20
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information 
 Score =  141 bits (358), Expect = 3e-37
 Identities = 58/197 (29%), Positives = 79/197 (40%), Gaps = 37/197 (18%)

Query: 532 QKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFE 591
            KLLL+G   SG STI KQ KIL+    FSD+E    +  I SN    +  LL   E   
Sbjct: 1   VKLLLLGAGESGKSTILKQMKILHG-NGFSDEERREFRPVIYSNILQSMKALLRAMETLN 59

Query: 592 EEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAA 651
                 + +K +                               +L         A     
Sbjct: 60  IPYGDPENEKDA-----------------------------KKILSLAP----RAEEGPL 86

Query: 652 TREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAE 711
             E +  ++ LWKD  IQA Y RR+E   L+  A YFL+ +  IS  DY P++ DIL + 
Sbjct: 87  PPELAEAIKRLWKDPGIQACYDRRNEY-QLNDSAKYFLDNLDRISDPDYIPTEQDILRSR 145

Query: 712 GVTSSNGLACVDFSFPR 728
             T+  G+   DFS   
Sbjct: 146 VKTT--GIIETDFSIKN 160

The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute. Length = 315
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 750
KOG0082 354 consensus G-protein alpha subunit (small G protein 100.0
KOG0085 359 consensus G protein subunit Galphaq/Galphay, small 100.0
KOG0099 379 consensus G protein subunit Galphas, small G prote 100.0
smart00275 342 G_alpha G protein alpha subunit. Subunit of G prot 100.0
cd00066 317 G-alpha G protein alpha subunit. The alpha subunit 100.0
PF00503 389 G-alpha: G-protein alpha subunit; InterPro: IPR001 100.0
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 95.9
PF00025175 Arf: ADP-ribosylation factor family The prints ent 94.91
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.64
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 94.31
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.16
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.02
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 93.71
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 93.61
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.54
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 93.52
cd00154159 Rab Rab family. Rab GTPases form the largest famil 93.4
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 93.4
PRK07261171 topology modulation protein; Provisional 93.4
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 93.36
PRK08118167 topology modulation protein; Reviewed 93.21
PTZ00133182 ADP-ribosylation factor; Provisional 93.14
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.1
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 92.88
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 92.79
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.7
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 92.41
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 92.41
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 92.36
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 92.33
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 92.29
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 92.29
cd04123162 Rab21 Rab21 subfamily. The localization and functi 92.22
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 92.2
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.2
PRK06217183 hypothetical protein; Validated 92.16
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 92.13
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 92.12
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 92.03
COG1100219 GTPase SAR1 and related small G proteins [General 91.99
PLN00223181 ADP-ribosylation factor; Provisional 91.98
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 91.89
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 91.81
smart00178184 SAR Sar1p-like members of the Ras-family of small 91.81
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 91.75
PF1355562 AAA_29: P-loop containing region of AAA domain 91.69
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 91.62
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 91.62
cd00876160 Ras Ras family. The Ras family of the Ras superfam 91.55
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 91.51
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 91.41
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 91.38
COG4639168 Predicted kinase [General function prediction only 91.33
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 91.3
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.3
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 91.3
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 91.26
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 91.23
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 91.17
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 91.17
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 91.14
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 91.13
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 91.11
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 90.97
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 90.9
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 90.85
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 90.85
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 90.8
cd01878204 HflX HflX subfamily. A distinct conserved domain w 90.7
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 90.68
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 90.67
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 90.65
PLN03108210 Rab family protein; Provisional 90.63
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 90.56
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.52
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 90.51
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 90.51
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 90.51
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 90.45
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 90.44
smart00382148 AAA ATPases associated with a variety of cellular 90.43
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 90.43
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 90.43
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 90.42
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 90.39
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 90.36
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 90.32
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 90.29
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 90.27
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 90.27
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 90.24
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 90.11
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 90.04
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 89.83
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 89.79
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 89.76
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 89.75
PRK03839180 putative kinase; Provisional 89.73
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 89.67
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 89.58
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 89.46
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 89.46
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.31
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 89.24
PRK14532188 adenylate kinase; Provisional 89.12
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 89.12
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 89.1
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 89.02
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 89.0
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 88.93
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 88.89
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 88.88
PTZ00369189 Ras-like protein; Provisional 88.83
PRK13949169 shikimate kinase; Provisional 88.74
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 88.67
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 88.64
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 88.62
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.61
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 88.58
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 88.5
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 88.5
COG4619223 ABC-type uncharacterized transport system, ATPase 88.46
PRK14530215 adenylate kinase; Provisional 88.42
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 88.36
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.36
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 88.34
PF05729166 NACHT: NACHT domain 88.31
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 88.23
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 88.0
PRK00300205 gmk guanylate kinase; Provisional 87.95
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 87.93
PRK00454196 engB GTP-binding protein YsxC; Reviewed 87.9
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 87.87
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 87.86
PRK08233182 hypothetical protein; Provisional 87.79
PF00004132 AAA: ATPase family associated with various cellula 87.77
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 87.62
PLN03071219 GTP-binding nuclear protein Ran; Provisional 87.57
PRK02496184 adk adenylate kinase; Provisional 87.57
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 87.5
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 87.34
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 87.26
PRK13695174 putative NTPase; Provisional 87.19
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 87.19
PTZ00088229 adenylate kinase 1; Provisional 87.14
PF13173128 AAA_14: AAA domain 87.08
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 87.05
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 87.02
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 87.01
TIGR00235207 udk uridine kinase. Model contains a number of lon 86.97
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 86.93
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 86.88
COG1136226 SalX ABC-type antimicrobial peptide transport syst 86.87
PRK14531183 adenylate kinase; Provisional 86.86
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 86.81
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 86.69
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 86.6
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 86.59
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 86.56
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 86.55
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 86.49
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 86.48
COG1126240 GlnQ ABC-type polar amino acid transport system, A 86.42
cd03234226 ABCG_White The White subfamily represents ABC tran 86.39
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 86.38
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 86.26
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 86.24
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 86.22
PF10497105 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida 86.21
PRK00279215 adk adenylate kinase; Reviewed 86.19
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 86.14
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 86.08
PLN03118211 Rab family protein; Provisional 85.96
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 85.93
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 85.93
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 85.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 85.75
cd03269210 ABC_putative_ATPase This subfamily is involved in 85.75
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 85.75
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 85.74
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 85.68
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 85.6
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 85.59
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 85.54
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 85.54
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 85.54
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 85.53
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 85.51
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 85.48
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 85.41
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 85.29
PRK04213201 GTP-binding protein; Provisional 85.25
PLN03110216 Rab GTPase; Provisional 85.24
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 85.23
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 85.22
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 85.19
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 85.19
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 85.15
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 85.14
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 85.13
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 85.12
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 85.11
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 85.09
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 85.08
PRK05480209 uridine/cytidine kinase; Provisional 85.06
PF13479213 AAA_24: AAA domain 84.84
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 84.79
COG3638258 ABC-type phosphate/phosphonate transport system, A 84.78
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 84.75
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 84.75
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 84.73
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 84.7
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 84.69
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 84.66
PRK14242253 phosphate transporter ATP-binding protein; Provisi 84.66
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 84.62
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 84.61
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 84.6
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 84.56
COG4598256 HisP ABC-type histidine transport system, ATPase c 84.55
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 84.49
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 84.49
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 84.44
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 84.44
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 84.44
PRK05057172 aroK shikimate kinase I; Reviewed 84.44
KOG1818634 consensus Membrane trafficking and cell signaling 84.4
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 84.35
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 84.35
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 84.24
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 84.24
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 84.22
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 84.22
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 84.21
PRK14528186 adenylate kinase; Provisional 84.19
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 84.0
PHA02530300 pseT polynucleotide kinase; Provisional 83.99
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 83.99
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 83.97
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 83.96
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 83.92
PRK00131175 aroK shikimate kinase; Reviewed 83.92
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 83.92
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 83.92
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 83.91
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 83.9
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 83.85
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 83.82
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 83.79
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 83.78
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 83.77
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 83.76
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 83.65
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 83.64
COG4615546 PvdE ABC-type siderophore export system, fused ATP 83.64
KOG3362156 consensus Predicted BBOX Zn-finger protein [Genera 83.62
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 83.62
PRK09825176 idnK D-gluconate kinase; Provisional 83.61
cd03215182 ABC_Carb_Monos_II This family represents domain II 83.57
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 83.56
PRK10908222 cell division protein FtsE; Provisional 83.55
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 83.54
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 83.52
PRK14527191 adenylate kinase; Provisional 83.46
PRK14241258 phosphate transporter ATP-binding protein; Provisi 83.45
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 83.43
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 83.41
cd03216163 ABC_Carb_Monos_I This family represents the domain 83.37
PRK14526211 adenylate kinase; Provisional 83.25
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 83.2
PRK04182180 cytidylate kinase; Provisional 83.19
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 83.18
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 83.17
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 83.16
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 83.13
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 83.13
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 83.07
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 82.97
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 82.87
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 82.87
cd04105203 SR_beta Signal recognition particle receptor, beta 82.86
PRK14738206 gmk guanylate kinase; Provisional 82.82
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 82.75
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 82.71
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 82.7
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 82.69
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 82.69
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 82.66
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 82.66
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 82.64
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 82.63
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 82.61
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 82.6
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 82.6
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 82.58
PRK06762166 hypothetical protein; Provisional 82.57
cd03246173 ABCC_Protease_Secretion This family represents the 82.54
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 82.51
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 82.46
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 82.41
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 82.38
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 82.33
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 82.32
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 82.25
PRK14737186 gmk guanylate kinase; Provisional 82.22
PLN00023334 GTP-binding protein; Provisional 82.19
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 82.17
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 82.1
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 82.09
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 82.08
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 82.05
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 81.99
COG4559259 ABC-type hemin transport system, ATPase component 81.95
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 81.94
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 81.89
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 81.88
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 81.87
PLN02200234 adenylate kinase family protein 81.83
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 81.81
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 81.78
PRK00625173 shikimate kinase; Provisional 81.77
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 81.74
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 81.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 81.72
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 81.72
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 81.69
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 81.68
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 81.67
PRK14240250 phosphate transporter ATP-binding protein; Provisi 81.66
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 81.66
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 81.64
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 81.63
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 81.63
PRK01184184 hypothetical protein; Provisional 81.63
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 81.58
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 81.57
KOG2355291 consensus Predicted ABC-type transport, ATPase com 81.53
PRK08356195 hypothetical protein; Provisional 81.52
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 81.51
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 81.45
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 81.44
cd01896233 DRG The developmentally regulated GTP-binding prot 81.44
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 81.43
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 81.42
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 81.41
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 81.4
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 81.39
PRK14239252 phosphate transporter ATP-binding protein; Provisi 81.36
PRK09580248 sufC cysteine desulfurase ATPase component; Review 81.35
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 81.34
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 81.32
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 81.31
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 81.28
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 81.27
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 81.24
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 81.18
PRK10790592 putative multidrug transporter membrane\ATP-bindin 81.14
TIGR00101199 ureG urease accessory protein UreG. This model rep 81.14
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 81.11
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 81.09
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 81.08
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 81.01
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 80.99
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 80.94
PRK14238271 phosphate transporter ATP-binding protein; Provisi 80.94
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 80.94
PRK14529223 adenylate kinase; Provisional 80.94
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 80.93
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 80.91
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 80.91
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 80.84
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 80.82
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 80.82
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 80.82
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 80.8
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 80.79
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 80.77
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 80.74
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 80.66
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 80.63
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 80.57
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 80.55
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 80.54
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 80.52
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 80.52
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 80.51
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 80.49
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 80.39
COG4098441 comFA Superfamily II DNA/RNA helicase required for 80.39
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 80.38
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 80.33
PRK13947171 shikimate kinase; Provisional 80.32
PRK14235267 phosphate transporter ATP-binding protein; Provisi 80.3
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 80.28
cd03114148 ArgK-like The function of this protein family is u 80.28
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 80.25
COG1127263 Ttg2A ABC-type transport system involved in resist 80.21
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 80.21
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 80.19
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 80.13
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 80.13
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 80.09
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 80.05
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=9.3e-47  Score=402.45  Aligned_cols=199  Identities=31%  Similarity=0.432  Sum_probs=168.2

Q ss_pred             ccccccccccch-hHHHhcceeeEEEeecCCCCchhHHhHhhhhhcCCCCCHHHHhhhhHHHHHHHHHHHHHHHhhhcch
Q 004481          512 EQGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERF  590 (750)
Q Consensus       512 kriSd~IDrsLq-dk~~~kr~iKLLLLGaGESGKSTILKQMKILh~~~GFSeeER~~~K~IIqsNIi~smkiLLeamE~f  590 (750)
                      .+.|..||++|+ ++.+.++.+||||||+||||||||+|||||||. +|||++|+..+|.+||.|++++|..||++|+.+
T Consensus        13 ~~~~~~I~~~l~~~~~~~~~~iKlLLLGageSGKSTI~KQmkilh~-~gfs~ee~~~~r~~I~~N~~~~~~~ll~a~~~~   91 (354)
T KOG0082|consen   13 VKRSKEIDKQLKKEKKKEKKIIKLLLLGAGESGKSTIVKQMKILHG-DGFSEEELLEYRPVIYSNIIQSLKALLRAMETL   91 (354)
T ss_pred             chhhhhhhHHHHHHHHhhhhheeeeeecCCCCchHHHHHHHHHHhc-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            336999999998 888999999999999999999999999999999 999999999999999999999999999999977


Q ss_pred             hhhHHHhhhhcCCCCCCCCCCCCCCcCCcceeccchhhHHhHHHHHhhhhcCCccccCCccchhHHHHHHHHhccHHHHH
Q 004481          591 EEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQA  670 (750)
Q Consensus       591 eie~l~e~r~l~spdes~~~g~~~~~ndr~IySi~~~lkafsd~lLe~~~~gdld~~fp~lt~E~A~aI~eLWkDpgIQ~  670 (750)
                      ++++.                ++...++.             ..+.......  + ..+++++|++++|++||+|++||+
T Consensus        92 ~i~~~----------------~~~~~~d~-------------~~~~~~~~~~--~-~~~~~~~e~~~~i~~lW~d~~Iq~  139 (354)
T KOG0082|consen   92 GINLD----------------DPERENDA-------------QKLTLLADAA--E-ELGVFSPELAEAIKELWKDPGIQA  139 (354)
T ss_pred             cCCCC----------------ChhhhhHH-------------HHHHHhhhcc--c-ccccCCHHHHHHHHHHHcCHHHHH
Confidence            66532                11111110             1111111111  1 113467899999999999999999


Q ss_pred             HHhhcchhhhhhhhHhhhhhhcccccCCCCCCCccceeeeecccCCCCeEEEEEEcCCCCCCCccCCCCCCCccccc
Q 004481          671 TYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRW  747 (750)
Q Consensus       671 ~y~RRnEFqlLpDSA~YFLDnIdRIaspDYvPTDqDILRARvkTtsnGI~E~eFs~~~~s~~~~~d~~~~~~~~~~y  747 (750)
                      ||+||+||+ |+|+|.|||+|++||++|+|+||++||||+|++|+  ||+|+.|++++ -....+|+++|.+.+.|+
T Consensus       140 ~~~r~~e~~-l~Dsa~Yfl~~l~rI~~~~Y~PT~~DIL~~R~~T~--GI~e~~F~~k~-~~f~~~DvGGQRseRrKW  212 (354)
T KOG0082|consen  140 CYERRREFQ-LNDSAKYFLENLDRISSPDYVPTEQDILRSRVPTT--GIVEVEFTIKG-LKFRMFDVGGQRSERKKW  212 (354)
T ss_pred             HHHcCCcCC-CCccHHHHHHhHHHhcCCCCCCCHHHHHhhccCcC--CeeEEEEEeCC-CceEEEeCCCcHHHhhhH
Confidence            999999999 79999999999999999999999999999999998  99999999999 556789999998877765

>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
2xtz_A 354 Crystal Structure Of The G Alpha Protein Atgpa1 Fro 2e-13
1zcb_A 362 Crystal Structure Of G Alpha 13 In Complex With Gdp 1e-10
3cx7_A 338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 2e-10
1shz_A 340 Crystal Structure Of The P115rhogef Rgrgs Domain In 7e-10
3cx6_A 338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 1e-09
1zca_A 359 Crystal Structure Of G Alpha 12 In Complex With Gdp 4e-09
3ums_A 354 Crystal Structure Of The G202a Mutant Of Human G-Al 2e-08
4g5o_A 330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 2e-08
2ode_A 350 Crystal Structure Of The Heterodimeric Complex Of H 2e-08
2ihb_A 323 Crystal Structure Of The Heterodimeric Complex Of H 2e-08
4g5r_A 330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 2e-08
1azs_C 402 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-08
1cs4_C 394 Complex Of Gs-Alpha With The Catalytic Domains Of M 3e-08
1cjk_C 402 Complex Of Gs-Alpha With The Catalytic Domains Of M 5e-08
3ffb_A 360 Crystal Structure Of A Fast Activating G Protein Mu 5e-08
2zjy_A 356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 5e-08
3onw_A 328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 7e-08
3umr_A 354 Crystal Structure Of The G202d Mutant Of Human G-Al 7e-08
1kjy_A 325 Crystal Structure Of Human G[alpha]i1 Bound To The 8e-08
3sn6_A 380 Crystal Structure Of The Beta2 Adrenergic Receptor- 8e-08
2xns_A 327 Crystal Structure Of Human G Alpha I1 Bound To A De 8e-08
1gp2_A 353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 8e-08
2gtp_A 323 Crystal Structure Of The Heterodimeric Complex Of H 9e-08
3qi2_A 328 A Galpha P-Loop Mutation Prevents Transition To The 9e-08
2ik8_A 324 Crystal Structure Of The Heterodimeric Complex Of H 9e-08
1y3a_A 329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 9e-08
4g5q_A 330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 1e-07
1gg2_A 353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-07
3qe0_A 325 A Galpha-I1 P-Loop Mutation Prevents Transition To 1e-07
2g83_A 313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 1e-07
1cul_C 380 Complex Of Gs-Alpha With The Catalytic Domains Of M 1e-07
1as0_A 353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 1e-07
3c7k_A 333 Molecular Architecture Of Galphao And The Structura 1e-07
1svk_A 353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 1e-07
1gil_A 353 Structure Of Active Conformations Of Gia1 And The M 1e-07
3d7m_A 354 Crystal Structure Of The G Protein Fast-Exchange Do 2e-07
1bh2_A 315 A326s Mutant Of An Inhibitory Alpha Subunit Length 2e-07
3v00_C 356 Studies Of A Constitutively Active G-Alpha Subunit 2e-05
4fid_A 340 Crystal Structure Of A Heterotrimeric G-Protein Sub 5e-05
1fqj_A 325 Crystal Structure Of The Heterotrimeric Complex Of 1e-04
1tnd_A 324 The 2.2 Angstroms Crystal Structure Of Transducin-A 2e-04
1got_A 350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 4e-04
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From Arabidopsis Thaliana Length = 354 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 108/226 (47%), Gaps = 37/226 (16%)
Query: 531 LQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERF 590
           ++KLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G + F
Sbjct: 9   IRKLLLLGAGESGKSTIFKQIKLLFQT-GFDEGELKSYVPVIHANVYQTIKLLHDGTKEF 67
Query: 591 EEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPA 650
            +           +D    + SS+S        IG +L         + + G L+  +P 
Sbjct: 68  AQ---------NETDSAKYMLSSESI------AIGEKL---------SEIGGRLD--YPR 101
Query: 651 ATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYA 710
            T++ +  +E LWKD AIQ T +R +EL++      Y +E +  +S  +Y P+  D+LYA
Sbjct: 102 LTKDIAEGIETLWKDPAIQETXARGNELQV-PDXTKYLMENLKRLSDINYIPTKEDVLYA 160
Query: 711 EGVTSSNGLACVDFSFPRSASDDS------VDTADQHDSLLRWVPV 750
                + G+  + FS P   +  S       D   Q +   +W+ +
Sbjct: 161 R--VRTTGVVEIQFS-PVGENKKSGEVYRLFDVGGQRNERRKWIHL 203
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure
>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|4FID|A Chain A, Crystal Structure Of A Heterotrimeric G-Protein Subunit From Entamoeba Histolytica, Ehg-Alpha-1 Length = 340 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query750
2xtz_A 354 Guanine nucleotide-binding protein alpha-1 subuni; 3e-27
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 2e-26
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 5e-26
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 1e-23
3ohm_A 327 Guanine nucleotide-binding protein G(Q) subunit A; 3e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
 Score =  112 bits (282), Expect = 3e-27
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 30/197 (15%)

Query: 531 LQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERF 590
           ++KLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G + F
Sbjct: 9   IRKLLLLGAGESGKSTIFKQIKLLFQ-TGFDEGELKSYVPVIHANVYQTIKLLHDGTKEF 67

Query: 591 EEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPA 650
            +      +   SS+                               + +        +P 
Sbjct: 68  AQNETDSAKYMLSSESIAIG--------------------------EKLSEIGGRLDYPR 101

Query: 651 ATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYA 710
            T++ +  +E LWKD AIQ T +R +EL++      Y +E +  +S  +Y P+  D+LYA
Sbjct: 102 LTKDIAEGIETLWKDPAIQETCARGNELQVPDC-TKYLMENLKRLSDINYIPTKEDVLYA 160

Query: 711 EGVTSSNGLACVDFSFP 727
              T   G+  + FS  
Sbjct: 161 RVRT--TGVVEIQFSPV 175
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 750
d1zcba1126 a.66.1.1 (A:76-201) Transducin (alpha subunit), in 3e-19
d1zcaa1122 a.66.1.1 (A:83-204) Transducin (alpha subunit), in 9e-18
d1cipa1121 a.66.1.1 (A:61-181) Transducin (alpha subunit), in 4e-16
d1tada1121 a.66.1.1 (A:57-177) Transducin (alpha subunit), in 2e-15
d1azta1114 a.66.1.1 (A:88-201) Transducin (alpha subunit), in 7e-14
d2bcjq1117 a.66.1.1 (Q:67-183) Transducin (alpha subunit), in 3e-13
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure

class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 82.3 bits (203), Expect = 3e-19
 Identities = 36/151 (23%), Positives = 57/151 (37%), Gaps = 27/151 (17%)

Query: 560 FSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGK 619
           F     E  +  I SN    + +L++ RE+        K +                 G 
Sbjct: 1   FDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQL---------------HGD 45

Query: 620 TIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELE 679
            +     R    +  +++T V             +Y P +  LW+D+ IQ  Y RR E +
Sbjct: 46  KLMAFDTRAPMAAQGMVETRV-----------FLQYLPAIRALWEDSGIQNAYDRRREFQ 94

Query: 680 MLSSVASYFLERVVDISRTDYEPSDLDILYA 710
           +  S   YFL+ +  +   DY PS  DIL A
Sbjct: 95  LGES-VKYFLDNLDKLGVPDYIPSQQDILLA 124
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 121 Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 121 Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 114 Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query750
d1tada1121 Transducin (alpha subunit), insertion domain {Cow 99.95
d1cipa1121 Transducin (alpha subunit), insertion domain {Rat 99.95
d1zcaa1122 Transducin (alpha subunit), insertion domain {Mous 99.94
d2bcjq1117 Transducin (alpha subunit), insertion domain {Mous 99.94
d1zcba1126 Transducin (alpha subunit), insertion domain {Mous 99.94
d1azta1114 Transducin (alpha subunit), insertion domain {Cow 99.9
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.94
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.74
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.31
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.82
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.65
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.53
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.06
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.77
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.62
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.01
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.86
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.33
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.14
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.13
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.69
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.65
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.55
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.49
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.36
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 87.25
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.2
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.14
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.92
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.3
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.26
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 85.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.51
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.44
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.28
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.2
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.19
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 84.86
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 84.58
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.55
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.42
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 84.29
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.01
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.84
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.73
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 83.62
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.54
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.38
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.15
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 82.95
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.54
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.28
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 82.21
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 82.06
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 82.06
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.0
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 81.96
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.83
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 81.65
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.64
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.6
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 81.57
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 81.43
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 80.42
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.95  E-value=1.6e-28  Score=208.44  Aligned_cols=121  Identities=24%  Similarity=0.364  Sum_probs=99.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHH
Q ss_conf             99888755467888879999999996110002568775420279999899999988677621113414688679998553
Q 004481          560 FSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTM  639 (750)
Q Consensus       560 FSeeER~~~K~IIqsNIi~sL~iLLea~E~leie~l~e~~~l~spde~s~~gns~~~ndr~IySi~~~lkafsdwlLe~~  639 (750)
                      ||++|+..||.+||.||+.+|+.||++|+.+++++                +++             .++..++.++...
T Consensus         1 Fs~eE~~~~~~~I~~Nii~~m~~li~a~~~l~i~~----------------~~~-------------~~~~~~~~i~~~~   51 (121)
T d1tada1           1 YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQY----------------GDS-------------ARQDDARKLMHMA   51 (121)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCC----------------SST-------------THHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC----------------CCC-------------HHHHHHHHHHHHH
T ss_conf             99999998188999999999999999999819997----------------870-------------5889999999860


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             059955568756144799999971367799999501002331023756652102124888777932433310356
Q 004481          640 VSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVT  714 (750)
Q Consensus       640 ~~Gdld~~fp~~t~EiAeaI~eLWkDpgIQa~f~RRnEFqlLpDSA~YFLDnIdRIaqpDYiPTDeDILraRvkT  714 (750)
                      .... +   +.++++++++|++||+|++||+||+|++||+ |+|||.|||++++||+++||+||++||||+|++|
T Consensus        52 ~~~~-~---~~~~~e~~~~i~~LW~D~~iq~~~~r~~ef~-L~Dsa~YF~~~l~RI~~~~Y~PT~qDiLr~R~~T  121 (121)
T d1tada1          52 DTIE-E---GTMPKEMSDIIQRLWKDSGIQACFDRASEYQ-LNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKT  121 (121)
T ss_dssp             HHSC-T---TCCCHHHHHHHHHHHHCHHHHHHHHTGGGSC-CCTTHHHHHTTHHHHTSTTCCCCHHHHHHCCCCC
T ss_pred             CCCC-C---CCCCHHHHHHHHHHHCCHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHCCCCCCCCHHHHHHHCCCC
T ss_conf             2356-7---8789999999999967988999998400146-6754478998999971799998888986642798
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure