Citrus Sinensis ID: 004520

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------

MEISSMGDLLVKNLMTKDNRRYSTSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRSLSSPSEAENEIDEILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKENKLSKEECLPNDSTPDEQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKAAENRSTEALETG

ccccccccccHHccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEccccccccccccccccHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEccccccccccccccccEEEEEEccEEEEEEEEEEEEEEcccEEEEEEcccEEEcccccccccEEEEEccccccccccccEEccEEEcccccEEEEccccccccccccccEEEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcc

cccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEEcccccccHHHHHHccccEEEccccccccccEEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHHcHHHHHHEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEccccccccccccccccEHHHHHEHHccccEEEEEEEEcccccEEEEEEEEEEEEccccccEEEEEEEccccccEEEEEcccccEcccccccEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEccEEEccccEEEccEEEEEEcccccccccccEEEEEEEEHccccEEEEEccccccEcccccEEEEEEEEccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccHcccc

MEISSMGDLLVKNlmtkdnrrystsqqvpvedpsphnqntddkmmdpLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREqeatgipdldfSIRILVLGktgvgksatINSIFdqtktetdafqpatDCIRevkgsvngikvtfidtpgflpscvrnVKRNRKIMLSVKKfirrsppdIVLYFERLDlismgfsdfpLLKLMTEVFGTAIWFNTILVMThssstlpegssgypfsyesyVTQCTDLVQQRIHQAVSDARLENQVLLVENhpqcrrnvkgeqilpngqiWKSRFLLLCICTKVLGDANallgfrdsielgplgntrvpsmphLLSSFlrhrslsspseaenEIDEILAseideedeydqlppikilKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKenklskeeclpndstpdeqtsseavmlpdmvvppsfdpdclayryrclvtsdqwlvrpvldlqgwdhdvgfdgINLETAVEIKSNVFASIAgqitkdkhdfnihsesaaayvdpegptycigldvqssgkdmiytvhgntklrnfkhnvtdcgvsltsfgnknyvgakledSLLVGKRLKLVMNagrmggsgqvayggsfeailrgadypvrndnisLTMTALSFNKEvvltggfqsefrpirglnMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKAAENRSTEALETG

MEISSMGDLLVKNLMTkdnrrystsqqvpvedpsphnqntddKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLiragesdmkmvNLRSDRTRAIAReqeatgipdldfsIRILVLGKTGVGKSATINsifdqtktetdafQPATDCIREVKGSVNGIKVtfidtpgflpscvrnvkrnRKIMlsvkkfirrsppDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPqcrrnvkgeqilpngqIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRslsspseaeNEIDEILASeideedeydqlppikilkksqferlsksqkksyldeldyrEILYFkkqlkeesrrrkenklskeeclpndstpdeqtsseavmLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESaaayvdpegpTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLtsfgnknyvgakledsllVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGfqsefrpiRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLrrkaaenrstealetg

MEISSMGDLLVKNLMTKDNRRYSTSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMphllssflrhrslsspsEAENEIDEILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKENKLSKEECLPNDSTPDEQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKAAENRSTEALETG

***********************************************LVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDM*MV**************EATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHS********SGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNT******************************************************************YLDELDYREILYFK****************************************MVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLR***************

*************************************************KIEDLQVKFLRLLQRFGQSQDNILAVKVLYRL*******************************************ILVLGKTGVGKSATINSIFDQTKTE***********REVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEG*SGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICT****************************MPHL***************************************************************************************************************DMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRP*R**NMS**ANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLR***************

MEISSMGDLLVKNLMTKDNR*****************QNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHR**********EIDEILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLK****************************SEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKA************

***SSMGDLLVKNLMTK***********************DDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAG*******NLRSDR*R**AREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRS******************IDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKENKLSK*****************AVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKA************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		747	2.2.26 [Sep-21-2011]
Q6S5G3		793	Translocase of chloroplas	yes	no	0.943	0.889	0.617	0.0
Q9SLF3		1206	Translocase of chloroplas	no	no	0.908	0.563	0.433	1e-160
Q9LUS2		1089	Translocase of chloroplas	no	no	0.943	0.647	0.426	1e-157
O81283		1503	Translocase of chloroplas	no	no	0.907	0.451	0.428	1e-156
O23680		297	Translocase of chloroplas	no	no	0.253	0.636	0.305	4e-20
Q38906		313	Translocase of chloroplas	no	no	0.309	0.738	0.284	2e-19
Q41009		310	Translocase of chloroplas	N/A	no	0.327	0.790	0.295	2e-19
Q552Z6		449	GTP-binding protein A OS=	yes	no	0.253	0.420	0.279	2e-12
Q96F15		307	GTPase IMAP family member	no	no	0.165	0.403	0.305	6e-06
Q8K3L6		326	GTPase IMAP family member	yes	no	0.214	0.490	0.262	7e-05

>sp\|Q6S5G3\|TOC90_ARATH Translocase of chloroplast 90, chloroplastic OS=Arabidopsis thaliana GN=TOC90 PE=1 SV=1	Back alignment and function desciption

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/711 (61%), Positives = 548/711 (77%), Gaps = 6/711 (0%)

Query: 24  TSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHL 83
           + QQVP+E     + + + K  +PL KI  LQV+FLRL+QRFGQSQ+NIL  KVLYR+HL
Sbjct: 68  SQQQVPLESLYQSSIDLNGKKHNPLAKIGGLQVQFLRLVQRFGQSQNNILVSKVLYRVHL 127

Query: 84  ATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIF 143
           A LIRA ES++K V LR DR +A+AREQE++GIP+LDFS+RILVLGKTGVGKSATINSIF
Sbjct: 128 AMLIRAEESELKNVKLRQDRAKALAREQESSGIPELDFSLRILVLGKTGVGKSATINSIF 187

Query: 144 DQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIR 203
            Q K+ETDAF+P TD I EV G+V+G+KVTFIDTPGF P    + ++NRKI+LS+K++++
Sbjct: 188 GQPKSETDAFRPGTDRIEEVMGTVSGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVK 247

Query: 204 RSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYP 263
           + PPD+VLY +RLD+I M +SDF LL+L+TE+FG AIW NTILVMTHS++T  EG +G  
Sbjct: 248 KRPPDVVLYLDRLDMIDMRYSDFSLLQLITEIFGAAIWLNTILVMTHSAATT-EGRNGQS 306

Query: 264 FSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRF 323
            +YESYV Q  D+VQ  IHQAVSD +LEN VLLVENHP C++N+ GE +LPNG +WK +F
Sbjct: 307 VNYESYVGQRMDVVQHYIHQAVSDTKLENPVLLVENHPSCKKNLAGEYVLPNGVVWKPQF 366

Query: 324 LLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRSLSSPSEAENEID 383
           + LC+CTKVLGD  +LL FRDSI LG   +TR  S+PHLLS FLR R  S   E E EID
Sbjct: 367 MFLCVCTKVLGDVQSLLRFRDSIGLGQPSSTRTASLPHLLSVFLRRRLSSGADETEKEID 426

Query: 384 EILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRR 443
           ++L  +++EEDEYDQLP I+IL KS+FE+LSKSQKK YLDELDYRE LY KKQLKEE RR
Sbjct: 427 KLLNLDLEEEDEYDQLPTIRILGKSRFEKLSKSQKKEYLDELDYRETLYLKKQLKEECRR 486

Query: 444 RKENKLSKEECLPNDSTPDEQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRP 503
           R++ KL +EE L +     EQ    AV LPDM  P SFD D  A+RYRC+   DQWLVRP
Sbjct: 487 RRDEKLVEEENLED----TEQRDQAAVPLPDMAGPDSFDSDFPAHRYRCVSAGDQWLVRP 542

Query: 504 VLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYV-DPEGP 562
           V D QGWD DVGFDGIN+ETA +I  N+FAS  GQ+++DK  F I SE+ AAY  +    
Sbjct: 543 VYDPQGWDRDVGFDGINIETAAKINRNLFASATGQVSRDKQRFTIQSETNAAYTRNFREQ 602

Query: 563 TYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGK 622
           T+ + +D+QSSG+D++Y+  G TKL+ FKHN TD GV LTSFG K YVG KLED+LLVGK
Sbjct: 603 TFSVAVDLQSSGEDLVYSFQGGTKLQTFKHNTTDVGVGLTSFGGKYYVGGKLEDTLLVGK 662

Query: 623 RLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQS 682
           R+KL  NAG+M GSGQ A GGSFEA +RG DYPVRN+ I LTMTALSF +E+VL  G Q+
Sbjct: 663 RVKLTANAGQMRGSGQTANGGSFEACIRGRDYPVRNEQIGLTMTALSFKRELVLNYGLQT 722

Query: 683 EFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRR 733
           +FRP RG N+ VN N+N+RKMG++ +KLNSS H EIAL++  ++F+ L+RR
Sbjct: 723 QFRPARGTNIDVNINMNNRKMGKINVKLNSSEHWEIALISALTMFKALVRR 773

GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Probably specialized in the import of nuclear encoded photosynthetic preproteins from the cytoplasm to the chloroplast.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -

>sp\|Q9SLF3\|TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana GN=TOC132 PE=1 SV=1	Back alignment and function description

>sp\|Q9LUS2\|TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana GN=TOC120 PE=1 SV=1	Back alignment and function description

>sp\|O81283\|TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana GN=TOC159 PE=1 SV=1	Back alignment and function description

>sp\|O23680\|TOC33_ARATH Translocase of chloroplast 33, chloroplastic OS=Arabidopsis thaliana GN=TOC33 PE=1 SV=1	Back alignment and function description

>sp\|Q38906\|TOC34_ARATH Translocase of chloroplast 34, chloroplastic OS=Arabidopsis thaliana GN=TOC34 PE=1 SV=2	Back alignment and function description

>sp\|Q41009\|TOC34_PEA Translocase of chloroplast 34 OS=Pisum sativum GN=TOC34 PE=1 SV=1	Back alignment and function description

>sp\|Q552Z6\|GTPA_DICDI GTP-binding protein A OS=Dictyostelium discoideum GN=gtpA PE=3 SV=1	Back alignment and function description

>sp\|Q96F15\|GIMA5_HUMAN GTPase IMAP family member 5 OS=Homo sapiens GN=GIMAP5 PE=1 SV=1	Back alignment and function description

>sp\|Q8K3L6\|GIMA5_RAT GTPase IMAP family member 5 OS=Rattus norvegicus GN=Gimap5 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		747
147771670		802	hypothetical protein VITISV_030236 [Viti	0.973	0.906	0.706	0.0
225446224		798	PREDICTED: translocase of chloroplast 90	0.973	0.911	0.707	0.0
255579853		743	protein translocase, putative [Ricinus c	0.947	0.952	0.706	0.0
224120330		789	predicted protein [Populus trichocarpa]	0.961	0.910	0.701	0.0
356546132		795	PREDICTED: translocase of chloroplast 90	0.965	0.906	0.661	0.0
357478305		835	Translocase of chloroplast [Medicago tru	0.935	0.837	0.692	0.0
224142547		749	predicted protein [Populus trichocarpa]	0.961	0.958	0.683	0.0
356562951		796	PREDICTED: translocase of chloroplast 90	0.982	0.922	0.651	0.0
30687747		793	translocase of chloroplast 90 [Arabidops	0.943	0.889	0.617	0.0
297812213		786	hypothetical protein ARALYDRAFT_910069 [	0.949	0.902	0.618	0.0

>gi\|147771670\|emb\|CAN71551.1\| hypothetical protein VITISV_030236 [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/728 (70%), Positives = 597/728 (82%), Gaps = 1/728 (0%)

Query: 17  KDNRRYSTSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVK 76
           ++N+ +S+ Q VP E     +  TD K MDPL K+EDLQVKFLRLL+R GQSQDN++  K
Sbjct: 71  QENQLHSSPQPVPGEGSYLSHHGTDGKRMDPLSKVEDLQVKFLRLLRRIGQSQDNLVVAK 130

Query: 77  VLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKS 136
           VLYRL LATLI AGESD+K  NLRS + RAIA EQEA G+P+LDFS RILVLGKTGVGKS
Sbjct: 131 VLYRLQLATLIGAGESDLKRANLRSGKARAIAEEQEAAGLPELDFSFRILVLGKTGVGKS 190

Query: 137 ATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIML 196
           ATINSIFDQ K  TBAFQPATD IREV G+VNGIK+TFIDTPG LPS   NV+RNRKI+L
Sbjct: 191 ATINSIFDQAKAVTBAFQPATDRIREVVGTVNGIKITFIDTPGLLPSNTSNVRRNRKILL 250

Query: 197 SVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLP 256
           SVK+FIR+ PPDIVLYFERLDLI+MG+SDFPLLKL+TEVFG AIWF+TILVMTH SS LP
Sbjct: 251 SVKRFIRKFPPDIVLYFERLDLINMGYSDFPLLKLITEVFGPAIWFSTILVMTHCSSDLP 310

Query: 257 EGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNG 316
           EG +G+P +YESYVTQCTDLVQ  + QAVSD RLEN VLLVENHP CR NV G++ILPNG
Sbjct: 311 EGPNGFPVNYESYVTQCTDLVQHYVQQAVSDTRLENPVLLVENHPYCRTNVMGKKILPNG 370

Query: 317 QIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRSLSSPS 376
           Q+W S+FLLLC+CTKVL DANALL F+ SI+LGP  NTR+PS+PHLLSSFLRHR+   PS
Sbjct: 371 QVWISQFLLLCLCTKVLNDANALLRFQHSIQLGPSSNTRLPSLPHLLSSFLRHRTTLDPS 430

Query: 377 EAENEIDEILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQ 436
           E +NEIDEIL  E +E DEYDQLPPI+IL KSQFERL+ SQKK YLDELDYRE LY KKQ
Sbjct: 431 ETDNEIDEILFLEEEEVDEYDQLPPIRILTKSQFERLTSSQKKDYLDELDYRETLYLKKQ 490

Query: 437 LKEESRRRKENKLSKEECLPNDSTPD-EQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVT 495
           +KEE++RR+E+KLS+E  L +   PD ++   EAVMLPDM VP SFD DC A+RYRCLV 
Sbjct: 491 VKEEAQRRRESKLSREVSLADSDNPDNKEAYPEAVMLPDMAVPLSFDSDCPAHRYRCLVM 550

Query: 496 SDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAA 555
           SDQWLVRPVLD  GWDHDVGFDGINLET +++K N+ AS+ GQ++KDK DF+I SE AA 
Sbjct: 551 SDQWLVRPVLDPHGWDHDVGFDGINLETTMDLKGNLIASVTGQMSKDKQDFSIQSECAAV 610

Query: 556 YVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLE 615
           Y DP GP Y +GLDVQS+GKD+IYTVH NTK+RN KHN+T+CG S+TSF NK  VGAKLE
Sbjct: 611 YTDPRGPNYFVGLDVQSAGKDLIYTVHSNTKMRNLKHNLTECGFSMTSFRNKYCVGAKLE 670

Query: 616 DSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVV 675
           D++ +GKRLK VMN G+MGG  QVAYGGSF A LRG DYP R D+ SL M  LS NKE+V
Sbjct: 671 DTISIGKRLKFVMNVGQMGGLEQVAYGGSFGATLRGRDYPARKDSASLNMALLSLNKEMV 730

Query: 676 LTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKA 735
           ++G  QS+FR  RG  MS+NANLNSRKMGQ+CIK +SS HMEIAL+A FSIFR LLRR+A
Sbjct: 731 MSGSIQSDFRSSRGTRMSINANLNSRKMGQICIKTSSSEHMEIALVAFFSIFRALLRRRA 790

Query: 736 AENRSTEA 743
           A+  S EA
Sbjct: 791 ADGPSIEA 798

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225446224\|ref\|XP_002263521.1\| PREDICTED: translocase of chloroplast 90, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255579853\|ref\|XP_002530763.1\| protein translocase, putative [Ricinus communis] gi\|223529679\|gb\|EEF31623.1\| protein translocase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224120330\|ref\|XP_002331021.1\| predicted protein [Populus trichocarpa] gi\|222872951\|gb\|EEF10082.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356546132\|ref\|XP_003541485.1\| PREDICTED: translocase of chloroplast 90, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|357478305\|ref\|XP_003609438.1\| Translocase of chloroplast [Medicago truncatula] gi\|355510493\|gb\|AES91635.1\| Translocase of chloroplast [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224142547\|ref\|XP_002324617.1\| predicted protein [Populus trichocarpa] gi\|222866051\|gb\|EEF03182.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356562951\|ref\|XP_003549731.1\| PREDICTED: translocase of chloroplast 90, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi|30687747|ref|NP_197530.2| translocase of chloroplast 90 [Arabidopsis thaliana] gi|79328224|ref|NP_001031911.1| translocase of chloroplast 90 [Arabidopsis thaliana] gi|75291915|sp|Q6S5G3.1|TOC90_ARATH RecName: Full=Translocase of chloroplast 90, chloroplastic; Short=AtToc90; AltName: Full=90 kDa chloroplast outer envelope protein; AltName: Full=Plastid protein import 4 gi|42718957|gb|AAS38569.1| chloroplast import receptor Toc90 [Arabidopsis thaliana] gi|332005443|gb|AED92826.1| translocase of chloroplast 90 [Arabidopsis thaliana] gi|332005444|gb|AED92827.1| translocase of chloroplast 90 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297812213\|ref\|XP_002873990.1\| hypothetical protein ARALYDRAFT_910069 [Arabidopsis lyrata subsp. lyrata] gi\|297319827\|gb\|EFH50249.1\| hypothetical protein ARALYDRAFT_910069 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		747
TAIR\|locus:2149204		793	Toc90 "translocon at the outer	0.949	0.894	0.602	2.9e-229
TAIR\|locus:2089348		1089	TOC120 "translocon outer compl	0.943	0.647	0.425	1.6e-150
TAIR\|locus:2059929		1206	TOC132 "multimeric translocon	0.946	0.586	0.430	6.9e-150
TAIR\|locus:2132298		1503	TOC159 "translocon at the oute	0.556	0.276	0.389	5.3e-139
UNIPROTKB\|Q41009		310	TOC34 "Translocase of chloropl	0.298	0.719	0.298	1.7e-20
TAIR\|locus:2204923		297	TOC33 "translocon at the outer	0.248	0.626	0.330	2.2e-20
TAIR\|locus:2175259		313	TOC34 "translocon at the outer	0.295	0.706	0.286	1.6e-19
DICTYBASE\|DDB_G0275441		449	gtpA "GTP-binding protein, HSR	0.253	0.420	0.279	8.8e-12
ZFIN\|ZDB-GENE-081031-58		530	si:ch1073-181h11.2 "si:ch1073-	0.204	0.288	0.298	6.9e-07
ZFIN\|ZDB-GENE-091204-426		1079	si:ch1073-181h11.4 "si:ch1073-	0.203	0.140	0.284	2.3e-06

TAIR\|locus:2149204 Toc90 "translocon at the outer envelope membrane of chloroplasts 90" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2212 (783.7 bits), Expect = 2.9e-229, P = 2.9e-229
 Identities = 431/715 (60%), Positives = 540/715 (75%)

Query:    24 TSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHL 83
             + QQVP+E     + + + K  +PL KI  LQV+FLRL+QRFGQSQ+NIL  KVLYR+HL
Sbjct:    68 SQQQVPLESLYQSSIDLNGKKHNPLAKIGGLQVQFLRLVQRFGQSQNNILVSKVLYRVHL 127

Query:    84 ATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIF 143
             A LIRA ES++K V LR DR +A+AREQE++GIP+LDFS+RILVLGKTGVGKSATINSIF
Sbjct:   128 AMLIRAEESELKNVKLRQDRAKALAREQESSGIPELDFSLRILVLGKTGVGKSATINSIF 187

Query:   144 DQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIR 203
              Q K+ETDAF+P TD I EV G+V+G+KVTFIDTPGF P    + ++NRKI+LS+K++++
Sbjct:   188 GQPKSETDAFRPGTDRIEEVMGTVSGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVK 247

Query:   204 RSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYP 263
             + PPD+VLY +RLD+I M +SDF LL+L+TE+FG AIW NTILVMTHS++T  EG +G  
Sbjct:   248 KRPPDVVLYLDRLDMIDMRYSDFSLLQLITEIFGAAIWLNTILVMTHSAATT-EGRNGQS 306

Query:   264 FSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRF 323
              +YESYV Q  D+VQ  IHQAVSD +LEN VLLVENHP C++N+ GE +LPNG +WK +F
Sbjct:   307 VNYESYVGQRMDVVQHYIHQAVSDTKLENPVLLVENHPSCKKNLAGEYVLPNGVVWKPQF 366

Query:   324 LLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMXXXXXXXXXXXXXXXXXEAENEID 383
             + LC+CTKVLGD  +LL FRDSI LG   +TR  S+                 E E EID
Sbjct:   367 MFLCVCTKVLGDVQSLLRFRDSIGLGQPSSTRTASLPHLLSVFLRRRLSSGADETEKEID 426

Query:   384 EILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRR 443
             ++L  +++EEDEYDQLP I+IL KS+FE+LSKSQKK YLDELDYRE LY KKQLKEE RR
Sbjct:   427 KLLNLDLEEEDEYDQLPTIRILGKSRFEKLSKSQKKEYLDELDYRETLYLKKQLKEECRR 486

Query:   444 RKENKLSKEECLPNDSTPDEQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRP 503
             R++ KL +EE L  D+   EQ    AV LPDM  P SFD D  A+RYRC+   DQWLVRP
Sbjct:   487 RRDEKLVEEENL-EDT---EQRDQAAVPLPDMAGPDSFDSDFPAHRYRCVSAGDQWLVRP 542

Query:   504 VLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYV-DPEGP 562
             V D QGWD DVGFDGIN+ETA +I  N+FAS  GQ+++DK  F I SE+ AAY  +    
Sbjct:   543 VYDPQGWDRDVGFDGINIETAAKINRNLFASATGQVSRDKQRFTIQSETNAAYTRNFREQ 602

Query:   563 TYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGK 622
             T+ + +D+QSSG+D++Y+  G TKL+ FKHN TD GV LTSFG K YVG KLED+LLVGK
Sbjct:   603 TFSVAVDLQSSGEDLVYSFQGGTKLQTFKHNTTDVGVGLTSFGGKYYVGGKLEDTLLVGK 662

Query:   623 RLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQS 682
             R+KL  NAG+M GSGQ A GGSFEA +RG DYPVRN+ I LTMTALSF +E+VL  G Q+
Sbjct:   663 RVKLTANAGQMRGSGQTANGGSFEACIRGRDYPVRNEQIGLTMTALSFKRELVLNYGLQT 722

Query:   683 EFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKAAE 737
             +FRP RG N+ VN N+N+RKMG++ +KLNSS H EIAL++  ++F+ L+RR   E
Sbjct:   723 QFRPARGTNIDVNINMNNRKMGKINVKLNSSEHWEIALISALTMFKALVRRSKTE 777

GO:0005525 "GTP binding" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

GO:0009707 "chloroplast outer membrane" evidence=ISS

GO:0045036 "protein targeting to chloroplast" evidence=IMP

TAIR\|locus:2089348 TOC120 "translocon outer complex protein 120" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2059929 TOC132 "multimeric translocon complex in the outer envelope membrane 132" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132298 TOC159 "translocon at the outer envelope membrane of chloroplasts 159" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q41009 TOC34 "Translocase of chloroplast 34" [Pisum sativum (taxid:3888)]	Back alignment and assigned GO terms

TAIR\|locus:2204923 TOC33 "translocon at the outer envelope membrane of chloroplasts 33" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175259 TOC34 "translocon at the outer envelope membrane of chloroplasts 34" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0275441 gtpA "GTP-binding protein, HSR1-related domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-081031-58 si:ch1073-181h11.2 "si:ch1073-181h11.2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-091204-426 si:ch1073-181h11.4 "si:ch1073-181h11.4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6S5G3	TOC90_ARATH	3, ., 6, ., 5, ., -	0.6174	0.9437	0.8890	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.5	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pm.C_scaffold_152000031	hypothetical protein (789 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		747
TIGR00993		763	TIGR00993, 3a0901s04IAP86, chloroplast protein imp	0.0
pfam11886		275	pfam11886, DUF3406, Domain of unknown function (DU	1e-118
cd01853		248	cd01853, Toc34_like, Translocon at the Outer-envel	1e-114
TIGR00991		313	TIGR00991, 3a0901s02IAP34, GTP-binding protein (Ch	6e-25
pfam04548		211	pfam04548, AIG1, AIG1 family	4e-16
cd01852		201	cd01852, AIG1, AvrRpt2-Induced Gene 1 (AIG1)	5e-10
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	2e-06
pfam01926		117	pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	3e-06
cd01850		275	cd01850, CDC_Septin, CDC/Septin GTPase family	2e-05
cd11383		140	cd11383, YfjP, YfjP GTPase	9e-05
pfam00735		280	pfam00735, Septin, Septin	9e-05
COG3596		296	COG3596, COG3596, Predicted GTPase [General functi	2e-04
cd00880		161	cd00880, Era_like, E	2e-04
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	3e-04
COG5019		373	COG5019, CDC3, Septin family protein [Cell divisio	0.002
cd01849		146	cd01849, YlqF_related_GTPase, Circularly permuted	0.004

>gnl\|CDD\|233224 TIGR00993, 3a0901s04IAP86, chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

 Score =  660 bits (1704), Expect = 0.0
 Identities = 316/739 (42%), Positives = 443/739 (59%), Gaps = 39/739 (5%)

Query: 26  QQVPVEDPSPHNQ---------NTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVK 76
           +Q  V      NQ            ++  + L K++ ++VKFLRL QR GQ+ +N +A +
Sbjct: 19  RQSRVNGFGSSNQFQQAEDSTTTLSEEHKEKLEKLQLIRVKFLRLAQRLGQTPENSIAAQ 78

Query: 77  VLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKS 136
           VLYRL L     AG       +L  D  +A+A + EA G   LDFS+ ILVLGK+GVGKS
Sbjct: 79  VLYRLGLL----AGRQGGGAFSL--DAAKAMAEQLEAEGQDPLDFSLNILVLGKSGVGKS 132

Query: 137 ATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIML 196
           ATINSIF + K  TDAF   T  ++E++G V G+K+  IDTPG   S     K N KI+ 
Sbjct: 133 ATINSIFGEVKFSTDAFGMGTTSVQEIEGLVQGVKIRVIDTPGLKSSASDQSK-NEKILS 191

Query: 197 SVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLP 256
           SVKKFI+++PPDIVLY +RLD+ +   +D PLL+ +T+V G +IWFN I+ +TH++S  P
Sbjct: 192 SVKKFIKKNPPDIVLYVDRLDMQTRDSNDLPLLRTITDVLGPSIWFNAIVTLTHAASAPP 251

Query: 257 EGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVL-----LVENHPQCRRNVKGEQ 311
           +G +G P SY+ +V Q + +VQQ I QAV D RL N  L     LVENHP CR+N  G++
Sbjct: 252 DGPNGTPLSYDVFVAQRSHIVQQAIGQAVGDLRLMNPNLMNPVSLVENHPACRKNRAGQK 311

Query: 312 ILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIE-LGPLG-NTRVPSMPHLLSSFLRH 369
           +LPNGQ+WK   LLLC  +K+L +ANALL  +++I+   P G  +R P +P+LLS  L+ 
Sbjct: 312 VLPNGQVWKPHLLLLCYSSKILSEANALLKLQENIDGRRPFGFRSRAPPLPYLLSWLLQS 371

Query: 370 RSLSS-PSEA-------ENEIDEILASEIDE-EDEYDQLPPIKILKKSQFERLSKSQKKS 420
           R+    P +        + E+++   S+ +  EDEYDQLPP K L K+Q  +LSK Q+K+
Sbjct: 372 RAHPKLPEQQGGDEEDSDIELEDSSDSDEESGEDEYDQLPPFKPLTKAQMAKLSKEQRKA 431

Query: 421 YLDELDYREILYFKKQLKEESRRRKENKLSKEECLPNDS----TPDEQTSSEA---VMLP 473
           YL+E DYR  L  KKQ +EE +R K  K   +E            DE+    A   V LP
Sbjct: 432 YLEEYDYRVKLLQKKQWREELKRMKMMKKFGKEIGELPDGYSEEVDEENGGPAAVPVPLP 491

Query: 474 DMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFA 533
           DMV+P SFD D  AYRYR L  S Q L RPVLD  GWDHD G+DG+N E +  +K    A
Sbjct: 492 DMVLPASFDSDNPAYRYRYLEPSSQLLTRPVLDTHGWDHDCGYDGVNAERSFAVKEKFPA 551

Query: 534 SIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHN 593
           S+  Q+TKDK DFNIH +S+ +    E  +   G D+Q+ GK + YTV G TK +NF+ N
Sbjct: 552 SVTVQVTKDKKDFNIHLDSSVSAKHGENGSTMAGFDIQNVGKQLAYTVRGETKFKNFRRN 611

Query: 594 VTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGAD 653
            T  G+S+T  G     G KLED + +GKRL LV + G M   G  AYG + E  LR AD
Sbjct: 612 KTAAGLSVTFLGENVSTGVKLEDQIALGKRLVLVGSTGTMRSQGDSAYGANLEVRLREAD 671

Query: 654 YPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSS 713
           +P+  D  SL ++ + +  ++ L    QS+    R   ++  A LN++  GQ+ ++ +SS
Sbjct: 672 FPLGQDQSSLGLSLVDWRGDLALGANIQSQVSIGRSSKLAARAGLNNKGSGQISVRTSSS 731

Query: 714 AHMEIALLAVFSIFRGLLR 732
             ++IAL+A+  + + + +
Sbjct: 732 DQLQIALVAILPLAKKIYK 750

The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M [Transport and binding proteins, Amino acids, peptides and amines]. Length = 763

>gnl\|CDD\|192864 pfam11886, DUF3406, Domain of unknown function (DUF3406)	Back alignment and domain information

>gnl\|CDD\|206652 cd01853, Toc34_like, Translocon at the Outer-envelope membrane of Chloroplasts 34-like (Toc34-like)	Back alignment and domain information

>gnl\|CDD\|130064 TIGR00991, 3a0901s02IAP34, GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>gnl\|CDD\|218141 pfam04548, AIG1, AIG1 family	Back alignment and domain information

>gnl\|CDD\|206651 cd01852, AIG1, AvrRpt2-Induced Gene 1 (AIG1)	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase	Back alignment and domain information

>gnl\|CDD\|206649 cd01850, CDC_Septin, CDC/Septin GTPase family	Back alignment and domain information

>gnl\|CDD\|206743 cd11383, YfjP, YfjP GTPase	Back alignment and domain information

>gnl\|CDD\|201420 pfam00735, Septin, Septin	Back alignment and domain information

>gnl\|CDD\|226124 COG3596, COG3596, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206646 cd00880, Era_like, E	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		747
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	100.0
PF11886		273	DUF3406: Domain of unknown function (DUF3406); Int	100.0
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	100.0
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	100.0
COG1160		444	Predicted GTPases [General function prediction onl	99.94
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	99.89
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.87
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.76
PRK00093		435	GTP-binding protein Der; Reviewed	99.75
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.73
PRK03003		472	GTP-binding protein Der; Reviewed	99.73
COG1159		298	Era GTPase [General function prediction only]	99.7
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.7
COG0486		454	ThdF Predicted GTPase [General function prediction	99.68
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.67
COG1160		444	Predicted GTPases [General function prediction onl	99.65
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.58
COG0218		200	Predicted GTPase [General function prediction only	99.54
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	99.54
PRK00089		292	era GTPase Era; Reviewed	99.52
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	99.51
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.5
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.5
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.5
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	99.5
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.49
COG3596		296	Predicted GTPase [General function prediction only	99.48
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.48
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	99.48
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.47
PRK09563		287	rbgA GTPase YlqF; Reviewed	99.47
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.46
KOG1547		336	consensus Septin CDC10 and related P-loop GTPases	99.46
COG1084		346	Predicted GTPase [General function prediction only	99.46
COG1161		322	Predicted GTPases [General function prediction onl	99.46
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	99.45
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	99.44
PRK15494		339	era GTPase Era; Provisional	99.44
PRK12298		390	obgE GTPase CgtA; Reviewed	99.43
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	99.41
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.41
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.4
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	99.39
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	99.39
PRK00093		435	GTP-binding protein Der; Reviewed	99.39
PRK12299		335	obgE GTPase CgtA; Reviewed	99.39
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.38
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.38
PRK03003		472	GTP-binding protein Der; Reviewed	99.37
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.37
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	99.36
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.36
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.34
COG5019		373	CDC3 Septin family protein [Cell division and chro	99.34
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	99.34
PRK12297		424	obgE GTPase CgtA; Reviewed	99.33
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	99.32
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.32
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.32
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	99.32
PRK04213		201	GTP-binding protein; Provisional	99.31
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.31
PRK12296		500	obgE GTPase CgtA; Reviewed	99.3
KOG2655		366	consensus Septin family protein (P-loop GTPase) [C	99.29
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.29
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.29
PRK11058		426	GTPase HflX; Provisional	99.28
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.28
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	99.27
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.27
KOG2423		572	consensus Nucleolar GTPase [General function predi	99.26
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	99.26
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.22
KOG2484		435	consensus GTPase [General function prediction only	99.21
cd00881		189	GTP_translation_factor GTP translation factor fami	99.2
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.19
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.18
cd01896		233	DRG The developmentally regulated GTP-binding prot	99.18
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.18
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.16
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.16
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.16
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.16
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.15
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.14
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.13
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.13
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.12
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.12
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	99.11
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.11
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.11
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.1
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.1
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.1
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.09
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.09
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.08
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.08
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.08
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.07
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.07
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	99.07
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.07
PLN03118		211	Rab family protein; Provisional	99.07
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.07
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.07
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.06
COG2262		411	HflX GTPases [General function prediction only]	99.06
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.05
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.05
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	99.05
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.05
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.05
CHL00071		409	tufA elongation factor Tu	99.05
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.05
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.04
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.04
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.04
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.04
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.04
COG0536		369	Obg Predicted GTPase [General function prediction	99.04
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.03
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.03
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.03
KOG1424		562	consensus Predicted GTP-binding protein MMR1 [Gene	99.03
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.03
PRK12317		425	elongation factor 1-alpha; Reviewed	99.03
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.03
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.02
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.02
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.02
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.01
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.01
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.01
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	99.01
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.0
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.99
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	98.98
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.98
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	98.98
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	98.98
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	98.98
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	98.97
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	98.97
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	98.97
PRK12289		352	GTPase RsgA; Reviewed	98.97
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.96
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	98.96
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	98.96
PRK09601		364	GTP-binding protein YchF; Reviewed	98.95
PTZ00258		390	GTP-binding protein; Provisional	98.95
COG1163		365	DRG Predicted GTPase [General function prediction	98.95
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	98.95
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.94
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.94
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	98.94
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	98.94
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.94
PTZ00133		182	ADP-ribosylation factor; Provisional	98.94
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	98.93
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.93
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	98.93
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	98.93
PLN03127		447	Elongation factor Tu; Provisional	98.93
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.93
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	98.93
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.93
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	98.92
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	98.91
PRK12735		396	elongation factor Tu; Reviewed	98.91
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	98.91
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.91
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	98.91
PTZ00369		189	Ras-like protein; Provisional	98.9
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	98.9
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	98.9
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	98.89
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	98.89
PRK15467		158	ethanolamine utilization protein EutP; Provisional	98.89
PRK13796		365	GTPase YqeH; Provisional	98.89
PRK00007		693	elongation factor G; Reviewed	98.88
cd04105		203	SR_beta Signal recognition particle receptor, beta	98.88
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	98.88
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.87
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	98.86
PRK12736		394	elongation factor Tu; Reviewed	98.86
PRK00049		396	elongation factor Tu; Reviewed	98.86
TIGR00485		394	EF-Tu translation elongation factor TU. This align	98.86
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	98.85
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	98.85
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.85
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	98.85
PLN03110		216	Rab GTPase; Provisional	98.85
PRK12739		691	elongation factor G; Reviewed	98.85
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	98.84
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	98.84
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	98.84
PLN00223		181	ADP-ribosylation factor; Provisional	98.83
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	98.82
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	98.82
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	98.81
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	98.81
PRK09866		741	hypothetical protein; Provisional	98.81
PLN03126		478	Elongation factor Tu; Provisional	98.81
PLN03108		210	Rab family protein; Provisional	98.81
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	98.81
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	98.8
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	98.8
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	98.8
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	98.78
PRK12288		347	GTPase RsgA; Reviewed	98.77
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.77
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	98.77
PRK05306		787	infB translation initiation factor IF-2; Validated	98.77
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	98.77
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.77
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	98.76
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	98.76
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	98.74
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	98.73
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	98.73
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	98.72
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	98.72
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	98.72
CHL00189		742	infB translation initiation factor 2; Provisional	98.72
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	98.71
PRK00098		298	GTPase RsgA; Reviewed	98.7
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	98.69
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	98.68
PRK09602		396	translation-associated GTPase; Reviewed	98.68
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	98.67
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	98.66
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	98.64
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	98.64
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	98.64
PLN00023		334	GTP-binding protein; Provisional	98.62
COG1162		301	Predicted GTPases [General function prediction onl	98.61
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	98.61
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	98.6
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	98.6
PRK10218		607	GTP-binding protein; Provisional	98.59
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	98.59
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	98.58
PTZ00141		446	elongation factor 1- alpha; Provisional	98.57
TIGR00503		527	prfC peptide chain release factor 3. This translat	98.57
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	98.56
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.56
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	98.56
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	98.56
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	98.55
KOG3859		406	consensus Septins (P-loop GTPases) [Cell cycle con	98.54
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	98.54
COG1100		219	GTPase SAR1 and related small G proteins [General	98.54
PTZ00416		836	elongation factor 2; Provisional	98.52
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	98.52
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	98.52
PRK13351		687	elongation factor G; Reviewed	98.51
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	98.51
KOG2486		320	consensus Predicted GTPase [General function predi	98.5
PRK00741		526	prfC peptide chain release factor 3; Provisional	98.5
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	98.49
PRK04004		586	translation initiation factor IF-2; Validated	98.46
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	98.46
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	98.46
PLN00116		843	translation elongation factor EF-2 subunit; Provis	98.43
PRK04000		411	translation initiation factor IF-2 subunit gamma;	98.39
COG0012		372	Predicted GTPase, probable translation factor [Tra	98.37
PRK05433		600	GTP-binding protein LepA; Provisional	98.37
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	98.34
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	98.32
PRK12740		668	elongation factor G; Reviewed	98.31
PRK07560		731	elongation factor EF-2; Reviewed	98.3
TIGR00092		368	GTP-binding protein YchF. This predicted GTP-bindi	98.29
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	98.28
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	98.24
PF09439		181	SRPRB: Signal recognition particle receptor beta s	98.23
KOG0395		196	consensus Ras-related GTPase [General function pre	98.2
KOG0073		185	consensus GTP-binding ADP-ribosylation factor-like	98.16
KOG0410		410	consensus Predicted GTP binding protein [General f	98.15
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.13
PLN00043		447	elongation factor 1-alpha; Provisional	98.12
PRK13768		253	GTPase; Provisional	98.1
KOG1491		391	consensus Predicted GTP-binding protein (ODN super	98.1
KOG0078		207	consensus GTP-binding protein SEC4, small G protei	98.09
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	98.01
PRK14974		336	cell division protein FtsY; Provisional	97.99
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	97.99
KOG0084		205	consensus GTPase Rab1/YPT1, small G protein superf	97.99
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.98
PRK01889		356	GTPase RsgA; Reviewed	97.98
PRK09435		332	membrane ATPase/protein kinase; Provisional	97.96
KOG1954		532	consensus Endocytosis/signaling protein EHD1 [Sign	97.96
KOG1486		364	consensus GTP-binding protein DRG2 (ODN superfamil	97.95
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	97.93
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	97.93
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	97.9
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	97.9
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.86
TIGR00064		272	ftsY signal recognition particle-docking protein F	97.85
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	97.83
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	97.81
COG2229		187	Predicted GTPase [General function prediction only	97.81
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	97.8
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	97.79
KOG0394		210	consensus Ras-related GTPase [General function pre	97.78
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	97.77
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.76
KOG1145		683	consensus Mitochondrial translation initiation fac	97.76
KOG0087		222	consensus GTPase Rab11/YPT3, small G protein super	97.75
PRK10416		318	signal recognition particle-docking protein FtsY;	97.75
KOG0092		200	consensus GTPase Rab5/YPT51 and related small G pr	97.72
KOG3883		198	consensus Ras family small GTPase [Signal transduc	97.67
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	97.66
PRK00771		437	signal recognition particle protein Srp54; Provisi	97.61
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	97.58
cd03112		158	CobW_like The function of this protein family is u	97.58
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.58
KOG0080		209	consensus GTPase Rab18, small G protein superfamil	97.57
KOG0098		216	consensus GTPase Rab2, small G protein superfamily	97.54
PRK10867		433	signal recognition particle protein; Provisional	97.54
COG3523		1188	IcmF Type VI protein secretion system component Va	97.53
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	97.52
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	97.49
KOG0079		198	consensus GTP-binding protein H-ray, small G prote	97.46
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	97.45
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.44
KOG0447		980	consensus Dynamin-like GTP binding protein [Genera	97.43
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.43
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	97.42
TIGR00959		428	ffh signal recognition particle protein. This mode	97.42
KOG0095		213	consensus GTPase Rab30, small G protein superfamil	97.4
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	97.35
cd03115		173	SRP The signal recognition particle (SRP) mediates	97.31
KOG0458		603	consensus Elongation factor 1 alpha [Translation,	97.29
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	97.27
KOG0075		186	consensus GTP-binding ADP-ribosylation factor-like	97.24
KOG0090		238	consensus Signal recognition particle receptor, be	97.19
KOG0781		587	consensus Signal recognition particle receptor, al	97.14
COG1217		603	TypA Predicted membrane GTPase involved in stress	97.12
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.99
PRK14845		1049	translation initiation factor IF-2; Provisional	96.97
KOG1487		358	consensus GTP-binding protein DRG1 (ODN superfamil	96.89
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	96.88
KOG0461		522	consensus Selenocysteine-specific elongation facto	96.87
KOG0093		193	consensus GTPase Rab3, small G protein superfamily	96.85
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	96.8
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	96.78
PF00004		132	AAA: ATPase family associated with various cellula	96.75
cd03114		148	ArgK-like The function of this protein family is u	96.75
KOG0462		650	consensus Elongation factor-type GTP-binding prote	96.71
KOG0780		483	consensus Signal recognition particle, subunit Srp	96.51
COG3276		447	SelB Selenocysteine-specific translation elongatio	96.4
KOG0074		185	consensus GTP-binding ADP-ribosylation factor-like	96.3
KOG0077		193	consensus Vesicle coat complex COPII, GTPase subun	96.3
KOG0070		181	consensus GTP-binding ADP-ribosylation factor Arf1	96.19
KOG0086		214	consensus GTPase Rab4, small G protein superfamily	96.1
KOG3886		295	consensus GTP-binding protein [Signal transduction	96.08
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	96.03
KOG0091		213	consensus GTPase Rab39, small G protein superfamil	95.93
KOG0468		971	consensus U5 snRNP-specific protein [Translation,	95.79
KOG0393		198	consensus Ras-related small GTPase, Rho type [Gene	95.75
KOG0071		180	consensus GTP-binding ADP-ribosylation factor Arf6	95.68
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	95.63
COG0050		394	TufB GTPases - translation elongation factors [Tra	95.59
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	95.57
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	95.57
KOG1144		1064	consensus Translation initiation factor 5B (eIF-5B	95.54
PRK14737		186	gmk guanylate kinase; Provisional	95.52
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	95.44
KOG0088		218	consensus GTPase Rab21, small G protein superfamil	95.42
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	95.39
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	95.32
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	95.32
KOG2749		415	consensus mRNA cleavage and polyadenylation factor	95.3
PRK14738		206	gmk guanylate kinase; Provisional	95.28
KOG0076		197	consensus GTP-binding ADP-ribosylation factor-like	95.27
PRK08472		434	fliI flagellum-specific ATP synthase; Validated	95.26
KOG0446		657	consensus Vacuolar sorting protein VPS1, dynamin,	95.2
PF00005		137	ABC_tran: ABC transporter This structure is on hol	95.19
PRK00300		205	gmk guanylate kinase; Provisional	95.18
KOG4252		246	consensus GTP-binding protein [Signal transduction	95.17
KOG0467		887	consensus Translation elongation factor 2/ribosome	95.13
PF02263		260	GBP: Guanylate-binding protein, N-terminal domain;	95.11
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	95.09
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	94.97
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	94.96
COG5258		527	GTPBP1 GTPase [General function prediction only]	94.91
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	94.89
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.88
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	94.82
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	94.81
KOG1533		290	consensus Predicted GTPase [General function predi	94.8
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	94.73
PTZ00099		176	rab6; Provisional	94.73
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	94.67
COG1341		398	Predicted GTPase or GTP-binding protein [General f	94.6
cd03110		179	Fer4_NifH_child This protein family's function is	94.52
KOG0464		753	consensus Elongation factor G [Translation, riboso	94.5
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.44
PRK11537		318	putative GTP-binding protein YjiA; Provisional	94.44
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	94.27
PF13555		62	AAA_29: P-loop containing region of AAA domain	94.2
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	94.2
KOG4181		491	consensus Uncharacterized conserved protein [Funct	94.11
PF09547		492	Spore_IV_A: Stage IV sporulation protein A (spore_	94.09
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	94.09
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	94.03
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	94.02
smart00382		148	AAA ATPases associated with a variety of cellular	93.94
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	93.83
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	93.81
PRK13695		174	putative NTPase; Provisional	93.8
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	93.8
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	93.79
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	93.79
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	93.78
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	93.73
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	93.73
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	93.69
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	93.63
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	93.63
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	93.63
PRK07261		171	topology modulation protein; Provisional	93.62
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	93.62
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	93.59
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	93.58
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	93.58
KOG1534		273	consensus Putative transcription factor FET5 [Tran	93.58
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	93.56
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	93.55
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	93.54
KOG0066		807	consensus eIF2-interacting protein ABC50 (ABC supe	93.52
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	93.51
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	93.5
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	93.48
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	93.44
cd03269		210	ABC_putative_ATPase This subfamily is involved in	93.43
cd03216		163	ABC_Carb_Monos_I This family represents the domain	93.42
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	93.41
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	93.4
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	93.37
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	93.36
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	93.35
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	93.3
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	93.26
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	93.24
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	93.24
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	93.23
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	93.22
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	93.21
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	93.21
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	93.21
PRK08118		167	topology modulation protein; Reviewed	93.21
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	93.2
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	93.2
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	93.17
TIGR02533		486	type_II_gspE general secretory pathway protein E.	93.16
KOG0097		215	consensus GTPase Rab14, small G protein superfamil	93.16
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	93.15
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	93.12
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	93.12
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	93.12
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	93.1
TIGR00235		207	udk uridine kinase. Model contains a number of lon	93.1
cd03215		182	ABC_Carb_Monos_II This family represents domain II	93.09
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	93.07
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	93.07
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	93.06
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	93.04
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	93.03
PRK10908		222	cell division protein FtsE; Provisional	93.02
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	93.02
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	93.0
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	93.0
PRK05480		209	uridine/cytidine kinase; Provisional	93.0
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	92.99
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	92.98
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	92.98
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	92.98
cd03111		106	CpaE_like This protein family consists of proteins	92.97
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	92.96
COG0410		237	LivF ABC-type branched-chain amino acid transport	92.95
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	92.95
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	92.94
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	92.94
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	92.92
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	92.9
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	92.89
PRK13851		344	type IV secretion system protein VirB11; Provision	92.88
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	92.86
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	92.86
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	92.84
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	92.84
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	92.83
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	92.8
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	92.78
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	92.77
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	92.76
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	92.74

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

Probab=100.00  E-value=3.2e-218  Score=1818.05  Aligned_cols=712  Identities=43%  Similarity=0.708  Sum_probs=659.1

Q ss_pred             cccccccccCCCCCCCCCCCchHhhhchHhhcccccEEEEEEeccCCCCCCCHHHHHHHHhccccccccccchhHHHHhh
Q 004520           20 RRYSTSQQVPVEDPSPHNQNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNL   99 (747)
Q Consensus        20 r~~~~~~~~~~~~~~~~~~~~~~eek~~~~kle~~dVillvLDaR~gls~~d~~vaqvL~rl~lad~~~~~~~~~~~~~l   99 (747)
                      |-.++..+......+.++.+++++++++.+||+.++|+|++|..|+|++|+|.+++|||||+++++.....      ..+
T Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~rvkflrl~~Rlg~s~~~~vvaqVlyrl~l~~~~~~~------~~~   95 (763)
T TIGR00993        22 RVNGFGSSNQFQQAEDSTTTLSEEHKEKLEKLQLIRVKFLRLAQRLGQTPENSIAAQVLYRLGLLAGRQGG------GAF   95 (763)
T ss_pred             CcccCCCcccccCCCCCCCCcchhhhHHHHHHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHhhccCcc------ccc
Confidence            33333333333444455689999999999999999999999999999999999999999999998754332      224


Q ss_pred             cchhHHHHHhhcccCCCCCCCCCeEEEEEcCCCCcHHHHHHHHhCCCCceecCCCCceeeEEEEEeEEcCeEEEEEeCCC
Q 004520          100 RSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPG  179 (747)
Q Consensus       100 g~~~~~~iA~~~~~~~~~~~~~~lrIlVVGk~GvGKSSLINsLlG~~~a~vs~~~~tT~~~~~~~~~~~G~~v~LIDTPG  179 (747)
                      +++.+..+|.+.++.+.+++.+.++|+|+|+||||||||||+|+|+..+.++...+.|+.+..+...++|..+.||||||
T Consensus        96 s~d~a~~~a~~~ea~g~~~LdfslrIvLVGKTGVGKSSLINSILGekvf~vss~~~~TTr~~ei~~~idG~~L~VIDTPG  175 (763)
T TIGR00993        96 SLDAAKAMAEQLEAEGQDPLDFSLNILVLGKSGVGKSATINSIFGEVKFSTDAFGMGTTSVQEIEGLVQGVKIRVIDTPG  175 (763)
T ss_pred             cchhhHHHHhhhhhhhccccCcceEEEEECCCCCCHHHHHHHHhccccccccCCCCCceEEEEEEEEECCceEEEEECCC
Confidence            57999999999999999999999999999999999999999999999998887777788887777788999999999999


Q ss_pred             CCCcccchhhhhHHHHHHHHHHHhcCCCCEEEEEEeccCccCCCCcHHHHHHHHHHhCCcccccEEEEEeccCCCCCCCC
Q 004520          180 FLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGS  259 (747)
Q Consensus       180 l~~~~~~~~~~~~~il~~ik~~I~~~~~DvVL~V~~ld~~t~~~~D~~lLk~L~e~fG~~i~k~vIIVLTK~D~l~pd~~  259 (747)
                      +.+..... ..+.++++.+.+++..+++|+||||++++..+.+..+..+++.|++.||.++|+++||||||+|.++|+++
T Consensus       176 L~dt~~dq-~~neeILk~Ik~~Lsk~gpDVVLlV~RLd~~~~D~eD~~aLr~Iq~lFG~~Iwk~tIVVFThgD~lppdg~  254 (763)
T TIGR00993       176 LKSSASDQ-SKNEKILSSVKKFIKKNPPDIVLYVDRLDMQTRDSNDLPLLRTITDVLGPSIWFNAIVTLTHAASAPPDGP  254 (763)
T ss_pred             CCccccch-HHHHHHHHHHHHHHhcCCCCEEEEEEeCCCccccHHHHHHHHHHHHHhCHHhHcCEEEEEeCCccCCCCCC
Confidence            99875432 45678888898898888899999999998776555688999999999999999999999999999999999


Q ss_pred             CCCCcchhhhhhhChHHHHHHHHHHhcccCCcc-----hhhhhhcCCcccccccCcccCCCccchHHHHHhhhhhhhhhh
Q 004520          260 SGYPFSYESYVTQCTDLVQQRIHQAVSDARLEN-----QVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLG  334 (747)
Q Consensus       260 ~g~~~s~e~~i~q~~~~Lqe~I~q~~~d~~l~~-----pv~lVEn~p~c~~N~~ge~vLP~~~~W~~~L~~~C~s~ki~~  334 (747)
                      ++.+.+|++|+.++.+.+|+.|++|.++++++|     |+.+|||+|.|.+|..||++||+++.|+++|+++|++.|++.
T Consensus       255 ng~~~tye~fv~~rs~~Lq~~Irq~~g~~~l~n~~~~~Pv~lvEN~~~C~~N~~gekVLPnG~~W~p~llllc~~~k~l~  334 (763)
T TIGR00993       255 NGTPLSYDVFVAQRSHIVQQAIGQAVGDLRLMNPNLMNPVSLVENHPACRKNRAGQKVLPNGQVWKPHLLLLCYSSKILS  334 (763)
T ss_pred             CCCCcCHHHHHhhChHHHHHHHHHhcCcceecccCCCCCEEEEecCCcccCCCCCceeCCCCchhHHHHHHHHHHhhhhc
Confidence            999999999999999999999999999999888     999999999999999999999999999999999999999999


Q ss_pred             hHHhhhcccccccc-CCCCC-CCCCChhHHHHHhhhccCCCCCcc--------cchhhhhhhccc-CCcccccCCCCCCc
Q 004520          335 DANALLGFRDSIEL-GPLGN-TRVPSMPHLLSSFLRHRSLSSPSE--------AENEIDEILASE-IDEEDEYDQLPPIK  403 (747)
Q Consensus       335 ea~~~lk~~~~~~~-~~~~~-~~~~plp~l~~~ll~~~~~~~~~~--------~~~~~~~~~~~~-~~~~~~yd~lp~~~  403 (747)
                      +|+++++.|+.+.. .||+. .|+|||||||||||++|+|+|+++        +|.|+||++|+| ||+|||||||||||
T Consensus       335 ~a~~l~~~q~~~~~~~~~~~~~~~~plp~~ls~ll~~r~~~k~~~~~~~~~~d~d~~~~~~~d~~~ed~e~eydqlppf~  414 (763)
T TIGR00993       335 EANALLKLQENIDGRRPFGFRSRAPPLPYLLSWLLQSRAHPKLPEQQGGDEEDSDIELEDSSDSDEESGEDEYDQLPPFK  414 (763)
T ss_pred             cccccccccccccCCCcccccccCCchHHHHHHHhhcCCCCCChhhhcCccccccchhhhccccccccccccccccCCCc
Confidence            99999999998774 34543 499999999999999999999998        455667776655 44488999999999


Q ss_pred             ccchHHHHHhhHHhhhhhhhhhhHHHHHHHHhhhHHHHHHHHHhhhccccC------CCCCCC-CCCCCCccccccCCCC
Q 004520          404 ILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKENKLSKEEC------LPNDST-PDEQTSSEAVMLPDMV  476 (747)
Q Consensus       404 ~l~k~~~~~l~~~~~~~y~~e~~~r~~l~~kkq~~~~~~~~~~~~~~~~~~------~~~~~~-~~~~~~~~~~~~~d~~  476 (747)
                      ||+|+|++||||||||+||||||||||||||||||||+||+|||||++++.      ++++++ ++++|++||||||||+
T Consensus       415 ~l~ksq~~kl~k~q~k~y~de~dyr~kl~~kkq~ke~~~r~k~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~vp~pd~~  494 (763)
T TIGR00993       415 PLTKAQMAKLSKEQRKAYLEEYDYRVKLLQKKQWREELKRMKMMKKFGKEIGELPDGYSEEVDEENGGPAAVPVPLPDMV  494 (763)
T ss_pred             cccHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCCccCcccccccccCCCccccccCcccc
Confidence            999999999999999999999999999999999999999999999999865      333333 6778999999999999


Q ss_pred             CCCCCCCCCcccceeeeccCCceeeeeecCCCCCCccCCCCcccchhhhhhccccceeEEEEEeecccceeeeeeceeEE
Q 004520          477 VPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAY  556 (747)
Q Consensus       477 ~p~sfd~d~~~~ryr~l~~~~~~~~rpv~~~~gwdhd~g~dg~~~e~~~~~~~~~~~~~~~q~~kdk~~~~~~~~~~~~~  556 (747)
                      ||||||||||+||||||++++|||||||||||||||||||||||+|++++|+++|||+++||||||||||+||+|||+||
T Consensus       495 lp~sFDsD~p~~rYr~l~~~~q~l~rpvl~~~gWDhd~g~dg~~~e~~~~~~~~~p~s~~~q~~kdkk~~~i~~e~~~s~  574 (763)
T TIGR00993       495 LPASFDSDNPAYRYRYLEPSSQLLTRPVLDTHGWDHDCGYDGVNAERSFAVKEKFPASVTVQVTKDKKDFNIHLDSSVSA  574 (763)
T ss_pred             CCCccCCCCccceeecccCccceeEeecccCCCCccccCcCcccHHHHHHHHhcCcceEEEEEeechhhceeeeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCCeeeeeeeeeccCcceeEEEecceecccccccccccceeEeeeCCeeeeeceeeeeeeecceeEEEEeccceeec
Q 004520          557 VDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGS  636 (747)
Q Consensus       557 ~~~~~~~~~~g~d~q~~~~~~~y~~~~~t~~~~~~~n~~~~g~~~t~~g~~~~~g~k~ed~~~~~~~~~~~~~~g~~~~~  636 (747)
                      ||++++|+|+||||||+|||||||+||||||||||+|||+||+|+||||++|++|+||||+|+|||||+||+|+|+|+++
T Consensus       575 kh~~~~s~~~g~diQ~~gk~l~yt~r~etk~kn~~~n~t~~g~s~t~lg~~~~~G~K~Ed~~~~gkr~~lv~~~G~~~~~  654 (763)
T TIGR00993       575 KHGENGSTMAGFDIQNVGKQLAYTVRGETKFKNFRRNKTAAGLSVTFLGENVSTGVKLEDQIALGKRLVLVGSTGTMRSQ  654 (763)
T ss_pred             ecCCCcceeeeeehhhhchheEEEEeccceecccccccccceeEEEEecceeeeeeeehheeeeccceEEEEecceeecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccceeEEEecCCCCCCcCccceeeeeeeccccceEEeecccceecccCCceeEEEEeeCCCcceeEEEEecCchhh
Q 004520          637 GQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHM  716 (747)
Q Consensus       637 ~~~ayg~~~e~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~n~~~~g~~~~~~~s~~~~  716 (747)
                      ||+||||||||+||++|||++++++|||||+|+|||||||||||||||++||+|+|++|||||||++||||||+|||||+
T Consensus       655 gd~Ayg~~~e~~lr~~dyp~~~~~~tl~~s~~~w~~~~~l~~n~qsq~~~gr~s~~~~~~~lnn~~~Gqi~ir~~sse~~  734 (763)
T TIGR00993       655 GDSAYGANLEVRLREADFPLGQDQSSLGLSLVDWRGDLALGANIQSQVSIGRSSKLAARAGLNNKGSGQISVRTSSSDQL  734 (763)
T ss_pred             CcccccceeEEEeecCcCCCCCCcchhceeeeccccceeeeccceeeecccCCceEEEEecccCcccceEEEEeccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhcccC
Q 004520          717 EIALLAVFSIFRGLLRRKAAEN  738 (747)
Q Consensus       717 ~~a~~~~~~~~~~~~~~~~~~~  738 (747)
                      ||||+|+|||+++||+|++|+.
T Consensus       735 ~ial~~~~~~~~~l~~~~~~~~  756 (763)
T TIGR00993       735 QIALVAILPLAKKIYKYYYPQT  756 (763)
T ss_pred             HHHHHHHHHHHHHHHHhcCcCC
Confidence            9999999999999999999973

>PF11886 DUF3406: Domain of unknown function (DUF3406); InterPro: IPR024283 This C-terminal domain is found in chloroplast protein import component Toc86/159 [] and homologue Toc90 [], and in some uncharacterised proteins	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2423 consensus Nucleolar GTPase [General function prediction only]	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>KOG2484 consensus GTPase [General function prediction only]	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only]	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>KOG2486 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>TIGR00092 GTP-binding protein YchF	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG0395 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0394 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms]	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only]	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]	Back alignment and domain information

>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]	Back alignment and domain information

>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only]	Back alignment and domain information

>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only]	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification]	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK08472 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG5258 GTPBP1 GTPase [General function prediction only]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK11537 putative GTP-binding protein YjiA; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>KOG4181 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		747
3def_A		262	Crystal Structure Of Toc33 From Arabidopsis Thalian		1e-21
2j3e_A		249	Dimerization Is Important For The Gtpase Activity O		2e-21
3bb3_A		262	Crystal Structure Of Toc33 From Arabidopsis Thalian		3e-21
3bb4_A		262	Crystal Structure Of Toc33 From Arabidopsis Thalian		3e-21
3bb1_A		274	Crystal Structure Of Toc34 From Pisum Sativum In Co		2e-20
1h65_A		270	Crystal Structure Of Pea Toc34-A Novel Gtpase Of Th		3e-20
2xtp_A		260	Crystal Structure Of Nucleotide-Free Human Gimap2,		2e-04
2xtm_A		234	Crystal Structure Of Gdp-Bound Human Gimap2, Amino		2e-04
2xto_A		240	Crystal Structure Of Gdp-Bound Human Gimap2, Amino		3e-04
3p1j_A		209	Crystal Structure Of Human Gtpase Imap Family Membe		3e-04

>pdb|3DEF|A Chain A, Crystal Structure Of Toc33 From Arabidopsis Thaliana, Dimerization Deficient Mutant R130a Length = 262