Citrus Sinensis ID: 004617


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740--
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
cccccccccccEEcccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccEEEcccccccccccHHHccccccccEEEcccccccccccccEEEccccccEEEcccccccccccccEEEccccccEEEcccccccccccccccEEEccccccccccccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccccccEEEccccccEEEEEccccEEEEccccccccccccccEEccccEEEEcccccccccccccEEEccccccEEEcccccccccccEEEccccccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccccccccccccccccEEEEccEEEEEEccEEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHEEEHHHHccccHHHHHHHHHHHHHEEEEEEEEEEEEcccccc
cccEcccccEEEEcccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHEEEcccccccccccHHHHccccccEEEEcccccccccccHHHEEcccccccccccHHHHccccccEEEEcccccccccccHHHcccccccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEcccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEccccccccccccccccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHcccccccEEEccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHccccccccc
minfeitpVSIIFFYFILFAGIERLSRLNNLKmlnlsgnsfnNTILSSLTHLSSlrslnlngnslegsidvkefdslrdleeldigenkidKFVVskelylddtgfkgtldirefdsfnnlevldmsynkidnlvvpqelrlsdnhfripisleplfnhsrLKIFHAknnqmnaeiteshsltapnfqlqslslsssygdgvtfpkflyhqhdleYVRLSHIKmngefpnwllennTKLATLFLVNdslagpfwlpihshkrlgildisnnnirghipveigdvlpsLYVFNIsmnaldgsipssfgnmkFLQLLDlsnnqltgeipehlaVGCVNLQFLMLSNnslkeglyltnnslsgnipgwlgnLTWLIHIImpenhlegpipvefcqlyslqildisdnnisgslpscfhplsieQVHLSKNMLHRQLKRDLsynllngsipdWIGELSQLSHLILghnnlegevpvQLCElnqlqlldlsnnslhgsippcfdnttlyesynnsssldekfeisffiegpqgdfttknIAYIYQGKVLSLLSGLYLSCNKlighippqignltRIQTLNLSynnltglipstfsnlkhiESLDLSYnklngkiphqlVELKTLEVFSVAYNNLSGEILEWTAQFATfnkssyegntflcglplpicrspatmseasignerddnlidmdsFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVdnliptrfch
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDleeldigenkidkfvvskelylddtgfkgtldiREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFnntilsslthlsslrslnlngnslegsiDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFqlqslslsssYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVqlcelnqlqlldlsnnslHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
**NFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKN*******************L*SLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSP************DDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFC*
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYE***********FEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCG****************************DSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFC*
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPT*FCH
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINFEITPVSIIFFYFILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query742 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.827 0.490 0.315 3e-61
C0LGQ5 1249 LRR receptor-like serine/ no no 0.876 0.520 0.313 4e-61
Q9ZPS9 1143 Serine/threonine-protein no no 0.847 0.550 0.292 3e-50
Q8L899 1207 Systemin receptor SR160 O N/A no 0.889 0.546 0.289 1e-49
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.889 0.546 0.289 1e-49
Q9FL28 1173 LRR receptor-like serine/ no no 0.792 0.501 0.312 3e-49
Q9LYN8 1192 Leucine-rich repeat recep no no 0.838 0.521 0.291 1e-48
Q9ZWC8 1166 Serine/threonine-protein no no 0.869 0.553 0.291 3e-47
C0LGS2 1136 Probable LRR receptor-lik no no 0.869 0.567 0.293 4e-47
Q9LVP0 1102 Probable leucine-rich rep no no 0.836 0.563 0.305 1e-46
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  237 bits (604), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 231/733 (31%), Positives = 341/733 (46%), Gaps = 119/733 (16%)

Query: 24  RLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEEL 83
            L+RL NL+ LNL  NSF+  I S L  L S++ LNL GN L+G I  K    L +L+ L
Sbjct: 235 ELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIP-KRLTELANLQTL 293

Query: 84  DIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKID---------NL 134
           D+  N +   +                   EF   N LE L ++ N++          N 
Sbjct: 294 DLSSNNLTGVIH-----------------EEFWRMNQLEFLVLAKNRLSGSLPKTICSNN 336

Query: 135 VVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLS- 193
              ++L LS+      I  E + N   LK+    NN +  +I +S       FQL  L+ 
Sbjct: 337 TSLKQLFLSETQLSGEIPAE-ISNCQSLKLLDLSNNTLTGQIPDSL------FQLVELTN 389

Query: 194 -----------LSSSYGDGVTFPKF-LYHQH-------------DLEYVRLSHIKMNGEF 228
                      LSSS  +     +F LYH +              LE + L   + +GE 
Sbjct: 390 LYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEM 449

Query: 229 PNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSL 288
           P   + N T+L  +    + L+G     I   K L  L +  N + G+IP  +G+    +
Sbjct: 450 P-VEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNC-HQM 507

Query: 289 YVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLK 348
            V +++ N L GSIPSSFG +  L+L  + NN L G +P+ L +   NL  +  S+N   
Sbjct: 508 TVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSL-INLKNLTRINFSSNKFN 566

Query: 349 EGL--------YL----TNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSL 396
             +        YL    T N   G+IP  LG  T L  + + +N   G IP  F ++  L
Sbjct: 567 GSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISEL 626

Query: 397 QILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQL 456
            +LDIS N++SG +P         ++ L K + H     DL+ N L+G IP W+G+L  L
Sbjct: 627 SLLDISRNSLSGIIPV--------ELGLCKKLTHI----DLNNNYLSGVIPTWLGKLPLL 674

Query: 457 SHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEK 516
             L L  N   G +P ++  L  +  L L  NSL+GSIP    N     + N    L+E 
Sbjct: 675 GELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALN----LEEN 730

Query: 517 FEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQT-LN 575
                 + GP      K          LS L  L LS N L G IP +IG L  +Q+ L+
Sbjct: 731 Q-----LSGPLPSTIGK----------LSKLFELRLSRNALTGEIPVEIGQLQDLQSALD 775

Query: 576 LSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILE 635
           LSYNN TG IPST S L  +ESLDLS+N+L G++P Q+ ++K+L   +++YNNL G++  
Sbjct: 776 LSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKL-- 833

Query: 636 WTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTS- 694
              QF+ +   ++ GN  LCG PL  C    + ++ S+  +            I+  +S 
Sbjct: 834 -KKQFSRWQADAFVGNAGLCGSPLSHCNRAGSKNQRSLSPK--------TVVIISAISSL 884

Query: 695 YVIVIFAIVIILY 707
             I +  +VIIL+
Sbjct: 885 AAIALMVLVIILF 897




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query742
224142481781 predicted protein [Populus trichocarpa] 0.950 0.902 0.462 1e-164
255581263 912 serine-threonine protein kinase, plant-t 0.944 0.768 0.451 1e-160
224112245 876 predicted protein [Populus trichocarpa] 0.915 0.775 0.424 1e-145
224123984 1016 predicted protein [Populus trichocarpa] 0.956 0.698 0.405 1e-139
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.946 0.479 0.384 1e-137
224142723 923 predicted protein [Populus trichocarpa] 0.896 0.720 0.398 1e-136
224073436 1014 predicted protein [Populus trichocarpa] 0.946 0.692 0.403 1e-135
224073452710 predicted protein [Populus trichocarpa] 0.822 0.859 0.431 1e-134
224073382 1309 predicted protein [Populus trichocarpa] 0.873 0.495 0.412 1e-134
224134597 947 predicted protein [Populus trichocarpa] 0.814 0.637 0.422 1e-134
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 361/780 (46%), Positives = 478/780 (61%), Gaps = 75/780 (9%)

Query: 16  FILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFD 75
           F    G ER  RLN L++L LS N  N++ LS L  LSSL+ LNL+ N L+GSID+K   
Sbjct: 15  FATSTGFERSLRLNKLEILELSFNKINDSTLSFLEGLSSLKHLNLDNNQLKGSIDMKGLC 74

Query: 76  SLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYN------ 129
            L+ L+ELDI              Y D  G    L      + NNL+VLD+S+N      
Sbjct: 75  ELKQLQELDIS-------------YNDLNGLPSCLT-----NLNNLQVLDISFNNFSGNI 116

Query: 130 ---KIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPN 186
              +I +L   ++L+LSDNHF+IPISL P FN S LK  +  +N++       H+L  P 
Sbjct: 117 SLSRIGSLTSIRDLKLSDNHFQIPISLGPFFNLSNLKNLNGDHNEIYESTELVHNLI-PR 175

Query: 187 FQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVN 246
           FQLQ LSL+  +G G TFPKFLY+QHDL++V LSHIK+ GEFP+WLL+NNTKL  L+LVN
Sbjct: 176 FQLQRLSLAC-HGFGGTFPKFLYYQHDLQFVDLSHIKIIGEFPSWLLQNNTKLEALYLVN 234

Query: 247 DSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSF 306
            SL+G   LP  SH  L  LDIS N+I+  IP +IG   P L   N+S N   GSIPSS 
Sbjct: 235 SSLSGSLQLPNDSHVNLSRLDISRNHIQNQIPTKIGAYFPWLEFLNLSRNYFSGSIPSSI 294

Query: 307 GNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLK-------------EGLYL 353
            NM  L +LDLSNN L+G IPE L  GC++L+ L+LSNN LK               L L
Sbjct: 295 SNMSSLGVLDLSNNGLSGNIPEQLVEGCLSLRGLVLSNNHLKGQFFWRSFNLAYLTDLIL 354

Query: 354 TNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSC 413
           + N L+G +P  L N + L  + +  N+L G IP     + SLQ LD+S+NN+ GSLPS 
Sbjct: 355 SGNQLTGILPNSLSNGSRLEALDVSLNNLSGKIPRWIGYMSSLQYLDLSENNLYGSLPSS 414

Query: 414 F-HPLSIEQVHLSKNMLHRQL-----------KRDLSYNLLNGSIPDWIGELSQLSHLIL 461
           F    ++ +V+LSKN L   L           + DLS+N   G IP+ IG L +LS L+L
Sbjct: 415 FCSSRTMTEVYLSKNKLEGSLIGALDGCLSLNRLDLSHNYFGGGIPESIGSLLELSFLLL 474

Query: 462 GHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISF 521
           G+NNLEG++P QLC+L +L L+DLS+N L G I PC   T+ ++    +S       +  
Sbjct: 475 GYNNLEGKIPSQLCKLEKLSLIDLSHNHLFGHILPCLQPTSKWQRERETSLNPSGNSLGR 534

Query: 522 FIEGPQ----------------GDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQI 565
              GPQ                 +FTTK+I+Y ++G +L  +SG+ LSCN L G IP ++
Sbjct: 535 ENRGPQIVFPVPAVEDPSMNKSVEFTTKSISYSFKGIILKYISGIDLSCNNLTGEIPVEL 594

Query: 566 GNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVA 625
           GNL+ IQ LNLS+N+LTG IP TFSNLK IESLDLSYN LNG+IP QL++L  L  FSVA
Sbjct: 595 GNLSNIQVLNLSHNSLTGPIPPTFSNLKEIESLDLSYNNLNGEIPRQLLDLNFLSAFSVA 654

Query: 626 YNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLP--ICRS--PATMSEASIGNERDDNL 681
           +NNLSG+  E  AQF+TFNKS YEGN  LCG PL     R+  P+ +  +    + ++ +
Sbjct: 655 HNNLSGKTPEMVAQFSTFNKSCYEGNPLLCGPPLARNCTRALPPSPLPRSQTHKKEENGV 714

Query: 682 IDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNL-IPTRF 740
           IDM++F +TF+ +Y++V+  I  +LY+N  WRR WFYF+   I  CYYF+VDNL +P RF
Sbjct: 715 IDMEAFIVTFSVAYIMVLLTIGSVLYINPRWRRAWFYFIGESINNCYYFLVDNLPVPARF 774




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query742
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.663 0.552 0.336 3.4e-62
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.746 0.554 0.315 5.6e-61
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.664 0.542 0.320 1.1e-60
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.904 0.687 0.305 4.3e-57
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.663 0.454 0.318 1.4e-56
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.826 0.655 0.318 1.9e-56
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.760 0.584 0.311 1.4e-55
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.814 0.482 0.292 2.6e-48
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.800 0.475 0.296 2.1e-45
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.830 0.565 0.287 4.9e-45
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 3.4e-62, Sum P(2) = 3.4e-62
 Identities = 177/526 (33%), Positives = 261/526 (49%)

Query:   214 LEYVRLSHIKMNGEFPNWLLE-NNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNN 272
             L ++ LS+ +  G  P+ +    N +   L   N S   P  L    +  L  L +S+N 
Sbjct:   375 LRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYS-LSWLKLSHNR 433

Query:   273 IRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAV 332
               G I  +  D   SL    +  N   G IP +  N++ L ++DLSNN LTG IP  L  
Sbjct:   434 FSGPIIRKSSDET-SLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLG- 491

Query:   333 GCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQ 392
                N  FL        E L ++NN L G IP  L N+ +L  + +  N L G +P+    
Sbjct:   492 ---NF-FL--------EVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSS 539

Query:   393 LYSLQILDISDNNISGSLPSCF----HPLSIEQVHLSKNM-LHRQLKRD----LSYNLLN 443
              Y   ILD+ +NN++GS+P         L +    LS N+ L R         L  N L 
Sbjct:   540 DYGY-ILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLT 598

Query:   444 GSIPDWIGELSQLSHLILGHNNLEGEVP--VXXXXXXXXXXXXXXXXXXHGSIPPCFDNT 501
             G IP  +  LS +  L   HN L   +P  V                    S+   F   
Sbjct:   599 GKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNF--M 656

Query:   502 TLY-ESYNNSSSLDEKFEISFFIE-GPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIG 559
              +Y E Y  S  + ++F + + ++   Q +F  K    +Y    L+ + GL LS N+L G
Sbjct:   657 EIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSG 716

Query:   560 HIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTL 619
             +IP ++G+L R+++LNLS N+L+G IP +FSNL+ IESLDLS+NKL+G IP QL  L++L
Sbjct:   717 NIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSL 776

Query:   620 EVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDD 679
              VF+V+YNNLSG ++    QF TF + SY GN  LCG P        T+S      + D+
Sbjct:   777 VVFNVSYNNLSG-VIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDE 835

Query:   680 N-LIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWI 724
             + L+D+   + +  T+YV V+   ++ L  +S WRR WF  V+ +I
Sbjct:   836 SGLLDIVVLWWSLGTTYVTVMMGFLVFLCFDSPWRRAWFCLVDTFI 881


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query742
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  181 bits (461), Expect = 1e-47
 Identities = 181/571 (31%), Positives = 251/571 (43%), Gaps = 91/571 (15%)

Query: 138 QELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSS 197
           Q + LS+N    PI  +     S L+  +  NN     I      + PN  L++L LS++
Sbjct: 96  QTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG---SIPN--LETLDLSNN 150

Query: 198 YGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPI 257
              G   P  +     L+ + L    + G+ PN L  N T L  L L ++ L G     +
Sbjct: 151 MLSG-EIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPREL 208

Query: 258 HSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDL 317
              K L  + +  NN+ G IP EIG  L SL   ++  N L G IPSS GN+K LQ L L
Sbjct: 209 GQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL 267

Query: 318 SNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIM 377
             N+L+G IP  +     +LQ L+         L L++NSLSG IP  +  L  L  + +
Sbjct: 268 YQNKLSGPIPPSI----FSLQKLI--------SLDLSDNSLSGEIPELVIQLQNLEILHL 315

Query: 378 PENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLK-RD 436
             N+  G IPV    L  LQ+L +  N  SG +P           +L K   H  L   D
Sbjct: 316 FSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK----------NLGK---HNNLTVLD 362

Query: 437 LSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPP 496
           LS N L G IP+ +     L  LIL  N+LEGE+P  L     L+ + L +NS  G +P 
Sbjct: 363 LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS 422

Query: 497 CFDNTTLYE----SYNNSSSL--DEKFEI-----------SFFIEGPQGDFTTKNIAYIY 539
            F    L      S NN        K+++            FF   P   F +K      
Sbjct: 423 EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKR----- 476

Query: 540 QGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLD 599
                  L  L LS N+  G +P ++G+L+ +  L LS N L+G IP   S+ K + SLD
Sbjct: 477 -------LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLD 529

Query: 600 LSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEI-----------------------LEW 636
           LS+N+L+G+IP    E+  L    ++ N LSGEI                       L  
Sbjct: 530 LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS 589

Query: 637 TAQFATFNKSSYEGNTFLCG----LPLPICR 663
           T  F   N S+  GN  LCG      LP C+
Sbjct: 590 TGAFLAINASAVAGNIDLCGGDTTSGLPPCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 742
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
PLN03150623 hypothetical protein; Provisional 99.43
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PLN03150623 hypothetical protein; Provisional 98.98
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.75
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.56
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG4341483 consensus F-box protein containing LRR [General fu 97.49
KOG4341483 consensus F-box protein containing LRR [General fu 97.37
PRK15386426 type III secretion protein GogB; Provisional 97.23
PRK15386426 type III secretion protein GogB; Provisional 97.19
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.51
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.35
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.73
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.76
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.65
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.66
smart0037026 LRR Leucine-rich repeats, outliers. 91.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.71
smart0037026 LRR Leucine-rich repeats, outliers. 90.63
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.63
KOG4308478 consensus LRR-containing protein [Function unknown 90.56
KOG4308478 consensus LRR-containing protein [Function unknown 90.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.83
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.0
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.5
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-57  Score=543.00  Aligned_cols=547  Identities=31%  Similarity=0.439  Sum_probs=453.7

Q ss_pred             eeccChhhhcCCCCCCEEeCCCCcCCccccccccCCCCCCEEeCCCCCCCCcCChhhcCCCCCCCEEECCCCCCCC----
Q 004617           17 ILFAGIERLSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDK----   92 (742)
Q Consensus        17 ~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~i~~~~~~~l~~L~~L~Ls~n~l~~----   92 (742)
                      +.|.++.+- +..+++.||+++|.+++..+.+|..+++|+.|+|++|.+++.+|.+.+..+++|++|+|++|++++    
T Consensus        58 c~w~gv~c~-~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~  136 (968)
T PLN00113         58 CLWQGITCN-NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR  136 (968)
T ss_pred             CcCcceecC-CCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc
Confidence            445555442 346899999999999999999999999999999999999888997777799999999999998863    


Q ss_pred             --CcccceeecCCCcceeccCHhhhcCCCCcCEEEccCCCCCCCCCCCEEecCCCccccccCcccccCCCCCcEEEccCC
Q 004617           93 --FVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNN  170 (742)
Q Consensus        93 --l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~~  170 (742)
                        +++|++|++++|.+.+.+|. .+.++++|++|++++|.+.+                .. ...+.++++|+.|++++|
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p~-~~~~l~~L~~L~L~~n~l~~----------------~~-p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIPN-DIGSFSSLKVLDLGGNVLVG----------------KI-PNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             cccCCCCEEECcCCcccccCCh-HHhcCCCCCEEECccCcccc----------------cC-ChhhhhCcCCCeeeccCC
Confidence              77889999999998888887 78889999999998887753                11 134556666666666666


Q ss_pred             cccccccccccCCCCCccceEEEeecCCCCCCccChhccCCCCCCEEEccCCCCCCCCchhHHhcCCCCCEEecCCcccc
Q 004617          171 QMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLA  250 (742)
Q Consensus       171 ~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~l~~L~~L~l~~~~~~  250 (742)
                      .+....+..   +....+|++|++ +++.+.+.+|..+..+++|++|++++|.+++..|..+ +++++|+.|++++|.+.
T Consensus       199 ~l~~~~p~~---l~~l~~L~~L~L-~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~  273 (968)
T PLN00113        199 QLVGQIPRE---LGQMKSLKWIYL-GYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKNLQYLFLYQNKLS  273 (968)
T ss_pred             CCcCcCChH---HcCcCCccEEEC-cCCccCCcCChhHhcCCCCCEEECcCceeccccChhH-hCCCCCCEEECcCCeee
Confidence            654433322   233456777777 6666677788888888888888888888888888775 78888888888888888


Q ss_pred             ccCccCCCCCCCcCEEEcccCcCcccCCchhhccCCCccEEEccCCcCcccCCccccCCCCCCEEEccccccCCCCchhh
Q 004617          251 GPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHL  330 (742)
Q Consensus       251 ~~~~~~~~~l~~L~~L~l~~n~i~~~i~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~  330 (742)
                      +..|..+..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+
T Consensus       274 ~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~-l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l  352 (968)
T PLN00113        274 GPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL  352 (968)
T ss_pred             ccCchhHhhccCcCEEECcCCeeccCCChhHcC-CCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHH
Confidence            888888888888888999888888777766554 7788899998888888888888888889999999888887777655


Q ss_pred             hhcCCCCcEEEccccccccceecccccccccCCCccCCccccchhcCCCCcccCCCCccccCCCCCcEEEcCCccCcccC
Q 004617          331 AVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSL  410 (742)
Q Consensus       331 ~~~l~~L~~L~L~~n~~~~~l~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~  410 (742)
                      . .+++|+.|++++|.+..           ..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++++..
T Consensus       353 ~-~~~~L~~L~Ls~n~l~~-----------~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~  420 (968)
T PLN00113        353 G-KHNNLTVLDLSTNNLTG-----------EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL  420 (968)
T ss_pred             h-CCCCCcEEECCCCeeEe-----------eCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeEC
Confidence            4 68888888887776553           56777888888888999999888888888888899999999999888877


Q ss_pred             CCCCC-CCCccEEEccCcccccccccccCCcccCCCCChhhhcCCCCCEEEcCCCcCccCCcccccCCCCCCEEEcCCCe
Q 004617          411 PSCFH-PLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNS  489 (742)
Q Consensus       411 ~~~~~-~~~L~~L~l~~n~l~~~~~~~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~  489 (742)
                      +..+. ++.|+.+++++|.+.+             .++..+..+++|+.|++++|++.+..|..+ ..++|+.|++++|+
T Consensus       421 p~~~~~l~~L~~L~Ls~N~l~~-------------~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~  486 (968)
T PLN00113        421 PSEFTKLPLVYFLDISNNNLQG-------------RINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQ  486 (968)
T ss_pred             ChhHhcCCCCCEEECcCCcccC-------------ccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCc
Confidence            77666 7888888777666554             566667778999999999999988877765 45889999999999


Q ss_pred             eeecCCCCcccccccccccCCCCCcccccccccccCCCcccccccchheecccccccccEEEccCCcCCCCCcccccCcC
Q 004617          490 LHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLT  569 (742)
Q Consensus       490 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~  569 (742)
                      +.+..|..+..+                                           +.|+.|+|++|.+.+.+|..+.+++
T Consensus       487 l~~~~~~~~~~l-------------------------------------------~~L~~L~Ls~N~l~~~~p~~~~~l~  523 (968)
T PLN00113        487 FSGAVPRKLGSL-------------------------------------------SELMQLKLSENKLSGEIPDELSSCK  523 (968)
T ss_pred             cCCccChhhhhh-------------------------------------------hccCEEECcCCcceeeCChHHcCcc
Confidence            998888777654                                           4899999999999999999999999


Q ss_pred             CCCEEEcccccCCCCCCccccCCCCCCEEECcCCcccccCCccccCCCCCCeEecCCCcccccccccccccccCCccccc
Q 004617          570 RIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYE  649 (742)
Q Consensus       570 ~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~~~~~~~~  649 (742)
                      +|++|+|++|.+++.+|..|+++++|+.|++++|++++.+|..+..+++|+.+++++|++.+.+|.. .++.++....+.
T Consensus       524 ~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~  602 (968)
T PLN00113        524 KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVA  602 (968)
T ss_pred             CCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhc
Confidence            9999999999999999999999999999999999999999999999999999999999999999974 677888888899


Q ss_pred             CCcCCCCCC
Q 004617          650 GNTFLCGLP  658 (742)
Q Consensus       650 ~n~~~c~~~  658 (742)
                      +|+.+|+.+
T Consensus       603 ~n~~lc~~~  611 (968)
T PLN00113        603 GNIDLCGGD  611 (968)
T ss_pred             CCccccCCc
Confidence            999999743



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query742
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-36
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-22
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-36
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 149 bits (377), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 178/681 (26%), Positives = 275/681 (40%), Gaps = 114/681 (16%) Query: 71 VKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFK------GTLD----IREFDSFNN 120 V F L LD+ N + V + +G K TLD + N+ Sbjct: 90 VSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS 149 Query: 121 LEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESH 180 LEVLD+S N I V + LSD LK N+++ ++ S Sbjct: 150 LEVLDLSANSISGANVVGWV-LSDGC-------------GELKHLAISGNKISGDVDVSR 195 Query: 181 SLTAPNFXXXXXXXXXXYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLA 240 + + G+ FL L+++ +S K++G+F + + T+L Sbjct: 196 CVN----LEFLDVSSNNFSTGI---PFLGDCSALQHLDISGNKLSGDF-SRAISTCTELK 247 Query: 241 TLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDG 300 L + ++ GP +P K L L ++ N G IP + +L ++S N G Sbjct: 248 LLNISSNQFVGP--IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 305 Query: 301 SIPSSFG-------------------------NMKFLQLLDLSNNQLTGEIPEHLAVGCV 335 ++P FG M+ L++LDLS N+ +GE+PE L Sbjct: 306 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 365 Query: 336 NLQFLMLSNNSLK---------------EGLYLTNNSLSGNIPGWLGNLTWLIHIIMPEN 380 +L L LS+N+ + LYL NN +G IP L N + L+ + + N Sbjct: 366 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 425 Query: 381 HLEGPIPVEFCQLYSLQILDISDNNISGSLPS-CFHPLSIEQVHLSKNMLHRQLKR---- 435 +L G IP L L+ L + N + G +P + ++E + L N L ++ Sbjct: 426 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN 485 Query: 436 -------DLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVXXXXXXXXXXXXXXXX 488 LS N L G IP WIG L L+ L L +N+ G +P Sbjct: 486 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 545 Query: 489 XXHGSIPPC-----------FDNTTLYESYNNSSSLDEKFEISFFIE--GPQGD----FT 531 +G+IP F Y N E +E G + + + Sbjct: 546 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 605 Query: 532 TKN----IAYIYQGKVLSLLSG------LYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNL 581 T+N + +Y G L +S N L G+IP +IG++ + LNL +N++ Sbjct: 606 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI 665 Query: 582 TGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFA 641 +G IP +L+ + LDLS NKL+G+IP + L L ++ NNLSG I E QF Sbjct: 666 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFE 724 Query: 642 TFNKSSYEGNTFLCGLPLPIC 662 TF + + N LCG PLP C Sbjct: 725 TFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query742
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-127
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-67
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-59
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-50
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-30
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-24
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-29
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  395 bits (1018), Expect = e-127
 Identities = 172/655 (26%), Positives = 269/655 (41%), Gaps = 119/655 (18%)

Query: 25  LSRLNNLKMLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELD 84
           +SR  NL+ L++S N+F+  I   L   S+L+ L+++GN L G    +   +  +L+ L+
Sbjct: 196 VSRCVNLEFLDVSSNNFSTGI-PFLGDCSALQHLDISGNKLSGDFS-RAISTCTELKLLN 253

Query: 85  IGENK----IDKFVVSK--ELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNK-------- 130
           I  N+    I    +     L L +  F G +      + + L  LD+S N         
Sbjct: 254 ISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF 313

Query: 131 IDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQ 190
             +  + + L LS N+F   + ++ L     LK+     N+ + E+ ES +         
Sbjct: 314 FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT--------- 364

Query: 191 SLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENN-TKLATLFLVNDSL 249
             +LS+S                L  + LS    +G     L +N    L  L+L N+  
Sbjct: 365 --NLSAS----------------LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 406

Query: 250 AGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNM 309
            G     + +   L  L +S N + G IP  +G  L  L    + +N L+G IP     +
Sbjct: 407 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYV 465

Query: 310 KFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNL 369
           K L+ L L  N LTGEIP  L+  C NL ++ LSNN L           +G IP W+G L
Sbjct: 466 KTLETLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRL-----------TGEIPKWIGRL 513

Query: 370 TWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNML 429
             L  + +  N   G IP E     SL  LD++ N  +G++P+                 
Sbjct: 514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM--------------- 558

Query: 430 HRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHN--NLEGEVPVQLCELNQLQLLDLSN 487
             +    ++ N + G    +I             N    +G    QL  L+     ++++
Sbjct: 559 -FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS 617

Query: 488 NSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLL 547
               G   P FDN                                              +
Sbjct: 618 RVYGGHTSPTFDN-------------------------------------------NGSM 634

Query: 548 SGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNG 607
             L +S N L G+IP +IG++  +  LNL +N+++G IP    +L+ +  LDLS NKL+G
Sbjct: 635 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG 694

Query: 608 KIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPIC 662
           +IP  +  L  L    ++ NNLSG I E   QF TF  + +  N  LCG PLP C
Sbjct: 695 RIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 742
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 9e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 90.1 bits (222), Expect = 8e-20
 Identities = 61/377 (16%), Positives = 124/377 (32%), Gaps = 33/377 (8%)

Query: 265 ILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTG 324
              +   N+   +     D + +L    + + ++DG        +  L  ++ SNNQLT 
Sbjct: 26  KTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFSNNQLTD 80

Query: 325 EIPEHLAVGCVNLQFLMLSNNSLKEGLY--------LTNNSLSGNIPGWLGNLTWLIHII 376
             P         L  ++++NN + +                 +             ++ +
Sbjct: 81  ITPLK---NLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRL 137

Query: 377 MPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNM------LH 430
              ++    I          Q+   +       L +      ++      +       L 
Sbjct: 138 ELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLT 197

Query: 431 RQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSL 490
                  + N ++   P  I   + L  L L  N L+      L  L  L  LDL+NN +
Sbjct: 198 NLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQI 253

Query: 491 HGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGL 550
              + P    T L E    ++ +     ++        +     +  I     L  L+ L
Sbjct: 254 SN-LAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYL 312

Query: 551 YLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP 610
            L  N +    P  + +LT++Q L  + N ++    S+ +NL +I  L   +N+++   P
Sbjct: 313 TLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP 368

Query: 611 HQLVELKTLEVFSVAYN 627
             L  L  +    +   
Sbjct: 369 --LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query742
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.96
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.96
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.94
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.87
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.83
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.83
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.8
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.77
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.74
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.74
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.67
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.14
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=100.00  E-value=1.3e-39  Score=192.30  Aligned_cols=76  Identities=24%  Similarity=0.350  Sum_probs=39.8

Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             65279954885888896041376778789832652797898001387988989775880654488132189989868557
Q 004617          546 LLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVA  625 (742)
Q Consensus       546 ~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~l~~L~~L~l~  625 (742)
                      .++.|++++|.+.+..  .+..+++|++|++++|+++++  ..+.++++|++|++++|++++..|  +.++++|+.|+++
T Consensus       308 ~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~l--~~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~  381 (384)
T d2omza2         308 NLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSDV--SSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLN  381 (384)
T ss_dssp             TCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCCC--GGGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECC
T ss_pred             CCCEEECCCCCCCCCC--CCCCCCCCCEEECCCCCCCCC--HHHCCCCCCCEEECCCCCCCCCHH--HCCCCCCCEEECC
T ss_conf             4676777788778984--536689889898989989997--467089999989897995899800--0039999996397


Q ss_pred             CC
Q ss_conf             87
Q 004617          626 YN  627 (742)
Q Consensus       626 ~N  627 (742)
                      +|
T Consensus       382 ~N  383 (384)
T d2omza2         382 DQ  383 (384)
T ss_dssp             CE
T ss_pred             CC
T ss_conf             89



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure