Citrus Sinensis ID: 004649

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740
MARFPRSPAPRLLYTLFSSSRTTPTKSSPQSPSAALLQGNFHLQSRQFSAGGNLARAKDDKEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE
ccccccccccHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEccccccccccccccccccccccHHHHcccccHHHcHHcccccccccEEEcccccccccEEEEEEEccccccEEEEEEccccccccHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHcccccEEEEccccccccEEEEEEEEEEEEEEccccccEEEEccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHcccccccccccccccccccEEEEEccccccccEEEEEEccccccccEEEEEEEccEEccccEEEEcccccEEcccEEEEccccccccccccccccEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHccccEEccEEEEcccccccccEEEEEEEEEcccccccccEEEEcccccccccccHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccEEEcccEEEEEEccccccccccccccccccEEEccccccccEEEEEEccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHcccccc
ccccccccccHHHHHHHccccccccccccccccHHHHccccEEEEccccccHHHHHHHHcccccccccHHHHHcEEEEEEEEcccccccEEEEEEcccEEEEcEEcccccHHHHHHHHHHHHHcccEEEEcHHEEcccccEEEEEcccccEEEEEEEEEEEEEcccEEEEEEcccccccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEEEEEEEEEcccccccEEEEcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHccEcEEEEcHHHHcccHHHHHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHEEccccccEEEEEEEEEEEEccccEEEcccccccHHHHHHHHHHcccHHHHHHHHcccHEHEEccccccEEEEEEccccHccHHHHHHHHHHHHHccccEEEEcccccccEEEEcccHHHHHHHHHHHHHHcEEEEccccccEEEEEEEEccEEEccEEEEEccccccccEEEEEEEcccccccccEEEEEcEEcccccHHHcHHHHHHHHHHHHcccEEccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccEEEccEEEEEEEccHHHccccEcccccccccEcccccccccEEEEEEccHHHHHccccHHHHcccccEEEEEEEccHHHccHHHHHHHHHHHccccccc
marfprspaprlLYTLFsssrttptksspqspsaallqgnfhlqsrqfsaggnlarakddkepwWKESMERLRNIGIsahidsgkttLTERILFYTGRIHeihevrgrdgvgakmdsmdleREKGITIQSAATscawkdyqiniidtpghvdfTVEVERALRVLDGAILVLCSvggvqsqsitvdrqmrryevprlAFINKldrmgadpwkVLDQARSKLRHHCaavqvpmgledqFQGLVDLVQLTAYyfhgsngekivtgevpadMETFVAEKRRELIELVSEVDdklgdmflsdepissgdLEEAIRRATVARKFIPvfmgsafknkgvqplldgvlsylpcptevsnyaldqknneekvilsgnpdgpLVALAFKleegrfgqlTYLRIYEGvirkgdfiinvntgkkikvprlvrmhSNEMEDIQEAHAGQIVAVFGVDCASVMslavqpvskdsggQFSKALNRfqkedptfrvgldaesgQTIISGMGELHLDIYVERIRREYKvdatvgkprvnfREAVTKRAEFdylhkkqsggqgqygrvigyieplplgspakfefenllvgqaipsnfiPAIEKGFKEAansgslighpvEYLRVVLTdgashavdssELAFKMAAIYAFRQCYAaakpvilepvmlvelkvptefqgsvagdinkrkgmivgndqegddsvitahvplnnmfgySTALRSmtqgkgeftmeykehapvsqDVQLQLVKThnagrgae
marfprspaprlLYTLFSSSRTTPTKSSPQSPSAALLQGNFHLQSRqfsaggnlarakddkepwWKESMERLRNIgisahidsgkttLTERILFYTGriheihevrgrdgvgaKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCsvggvqsqsitvdrqmrryeVPRLAFinkldrmgadPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSngekivtgevPADMETFVAEKRRELIELVSEVDDKLGDMFLsdepissgdleEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEgvirkgdfiinvntgkkikvprLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREykvdatvgkprvnfreavtkraefdylhkkqsggqgqygRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTefqgsvagdinkrKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE
MARFPRSPAPRLLYTLFsssrttptksspqspsAALLQGNFHLQSRQFSAGGNLARAKDDKEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE
***************************************************************WWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVG***********KGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLS********LEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQ***********************FRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGND**GDDSVITAHVPLNNMFGYSTALR**************************************
******************************************************************ESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQK**********NPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIV**DQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQL*************
********APRLLYTLFSS***************ALLQGNFHLQSRQFSAG*********KEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE
******SPAPRL********************SAALLQGNFHLQSRQFSAGGNLARAKDDKEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHN******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARFPRSPAPRLLYTLFSSSRTTPTKSSPQSPSAALLQGNFHLQSRQFSAGGNLARAKDDKEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCASVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query740 2.2.26 [Sep-21-2011]
Q9C641754 Elongation factor G, mito yes no 0.990 0.972 0.809 0.0
Q9FE64757 Elongation factor G, mito yes no 0.925 0.904 0.811 0.0
Q1D9P5704 Elongation factor G 1 OS= yes no 0.908 0.954 0.595 0.0
P0CN33811 Elongation factor G, mito N/A no 0.972 0.887 0.544 0.0
P0CN32811 Elongation factor G, mito yes no 0.974 0.889 0.538 0.0
B6K286763 Elongation factor G, mito N/A no 0.895 0.868 0.574 0.0
Q9USZ1770 Elongation factor G, mito yes no 0.902 0.867 0.561 0.0
A7RR04735 Elongation factor G, mito N/A no 0.897 0.903 0.585 0.0
Q55E94734 Elongation factor G, mito yes no 0.905 0.912 0.58 0.0
A8P1W0818 Elongation factor G, mito N/A no 0.886 0.801 0.582 0.0
>sp|Q9C641|EFGM_ARATH Elongation factor G, mitochondrial OS=Arabidopsis thaliana GN=At1g45332 PE=1 SV=1 Back     alignment and function desciption
 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/761 (80%), Positives = 678/761 (89%), Gaps = 28/761 (3%)

Query: 1   MARFPRSPAPRLLYTLFSSSRTTPTKSSPQSPSAALLQGNFHLQSRQFSAGGNLARAKDD 60
           MARFP SPAP  L  LFSS++ +       SP+AALL G+F L  R FSAG     AKD+
Sbjct: 1   MARFPTSPAPNRLLRLFSSNKRS------SSPTAALLTGDFQL-IRHFSAGTAARVAKDE 53

Query: 61  KEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDL 120
           KEPWWKESM++LRNIGISAHIDSGKTTLTER+LFYTGRIHEIHEVRGRDGVGAKMDSMDL
Sbjct: 54  KEPWWKESMDKLRNIGISAHIDSGKTTLTERVLFYTGRIHEIHEVRGRDGVGAKMDSMDL 113

Query: 121 EREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQ 180
           EREKGITIQSAAT C WKDY++NIIDTPGHVDFT+EVERALRVLDGAILVLCSVGGVQSQ
Sbjct: 114 EREKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQ 173

Query: 181 SITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGL 240
           SITVDRQMRRYEVPR+AFINKLDRMGADPWKVL+QAR+KLRHH AAVQVP+GLE+ FQGL
Sbjct: 174 SITVDRQMRRYEVPRVAFINKLDRMGADPWKVLNQARAKLRHHSAAVQVPIGLEENFQGL 233

Query: 241 VDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPI 300
           +DL+ + AY+FHGS+GE +V G++PADME  VAEKRRELIE VSEVDD L + FL+DEP+
Sbjct: 234 IDLIHVKAYFFHGSSGENVVAGDIPADMEGLVAEKRRELIETVSEVDDVLAEKFLNDEPV 293

Query: 301 SSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNE 360
           S+ +LEEAIRRAT+A+ F+PVFMGSAFKNKGVQPLLDGV+S+LP P EV+NYALDQ NNE
Sbjct: 294 SASELEEAIRRATIAQTFVPVFMGSAFKNKGVQPLLDGVVSFLPSPNEVNNYALDQNNNE 353

Query: 361 EKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVR 420
           E+V L+G+PDGPLVALAFKLEEGRFGQLTYLR+YEGVI+KGDFIINVNTGK+IKVPRLVR
Sbjct: 354 ERVTLTGSPDGPLVALAFKLEEGRFGQLTYLRVYEGVIKKGDFIINVNTGKRIKVPRLVR 413

Query: 421 MHSNEMEDIQEAHAGQIVAVFGVDCAS---------------------VMSLAVQPVSKD 459
           MHSN+MEDIQEAHAGQIVAVFG++CAS                     VMSLAVQPVSKD
Sbjct: 414 MHSNDMEDIQEAHAGQIVAVFGIECASGDTFTDGSVKYTMTSMNVPEPVMSLAVQPVSKD 473

Query: 460 SGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKP 519
           SGGQFSKALNRFQKEDPTFRVGLD ESGQTIISGMGELHLDIYVER+RREYKVDATVGKP
Sbjct: 474 SGGQFSKALNRFQKEDPTFRVGLDPESGQTIISGMGELHLDIYVERMRREYKVDATVGKP 533

Query: 520 RVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSN 579
           RVNFRE +T+RAEFDYLHKKQSGG GQYGRV GY+EPLP GS  KFEFEN++VGQAIPS 
Sbjct: 534 RVNFRETITQRAEFDYLHKKQSGGAGQYGRVTGYVEPLPPGSKEKFEFENMIVGQAIPSG 593

Query: 580 FIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAA 639
           FIPAIEKGFKEAANSGSLIGHPVE LR+VLTDGASHAVDSSELAFKMAAIYAFR CY AA
Sbjct: 594 FIPAIEKGFKEAANSGSLIGHPVENLRIVLTDGASHAVDSSELAFKMAAIYAFRLCYTAA 653

Query: 640 KPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYST 699
           +PVILEPVMLVELKVPTEFQG+VAGDINKRKG+IVGNDQEGDDSVITA+VPLNNMFGYST
Sbjct: 654 RPVILEPVMLVELKVPTEFQGTVAGDINKRKGIIVGNDQEGDDSVITANVPLNNMFGYST 713

Query: 700 ALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE 740
           +LRSMTQGKGEFTMEYKEH+ VS +VQ QLV  ++A +  E
Sbjct: 714 SLRSMTQGKGEFTMEYKEHSAVSNEVQAQLVNAYSASKATE 754
Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FE64|EFGM_ORYSJ Elongation factor G, mitochondrial OS=Oryza sativa subsp. japonica GN=Os03g0565500 PE=2 SV=2 Back     alignment and function description
>sp|Q1D9P5|EFG1_MYXXD Elongation factor G 1 OS=Myxococcus xanthus (strain DK 1622) GN=fusA1 PE=3 SV=1 Back     alignment and function description
>sp|P0CN33|EFGM_CRYNB Elongation factor G, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MEF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CN32|EFGM_CRYNJ Elongation factor G, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MEF1 PE=3 SV=1 Back     alignment and function description
>sp|B6K286|EFGM_SCHJY Elongation factor G, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mef1 PE=3 SV=1 Back     alignment and function description
>sp|Q9USZ1|EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mef1 PE=3 SV=2 Back     alignment and function description
>sp|A7RR04|EFGM_NEMVE Elongation factor G, mitochondrial OS=Nematostella vectensis GN=v1g236547 PE=3 SV=1 Back     alignment and function description
>sp|Q55E94|EFGM_DICDI Elongation factor G, mitochondrial OS=Dictyostelium discoideum GN=gfm1 PE=3 SV=1 Back     alignment and function description
>sp|A8P1W0|EFGM_COPC7 Elongation factor G, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MEF1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query740
356495893751 PREDICTED: elongation factor G, mitochon 0.986 0.972 0.835 0.0
225453494746 PREDICTED: elongation factor G, mitochon 0.977 0.969 0.840 0.0
147800081746 hypothetical protein VITISV_032323 [Viti 0.977 0.969 0.842 0.0
297824539754 hypothetical protein ARALYDRAFT_483634 [ 0.990 0.972 0.816 0.0
449445507753 PREDICTED: elongation factor G, mitochon 0.989 0.972 0.827 0.0
15225397754 elongation factor EF-G [Arabidopsis thal 0.990 0.972 0.809 0.0
15220073754 Elongation factor G [Arabidopsis thalian 0.990 0.972 0.809 0.0
356541316746 PREDICTED: elongation factor G, mitochon 0.979 0.971 0.830 0.0
357504475751 Elongation factor G [Medicago truncatula 0.982 0.968 0.810 0.0
224125052693 predicted protein [Populus trichocarpa] 0.908 0.969 0.857 0.0
>gi|356495893|ref|XP_003516805.1| PREDICTED: elongation factor G, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
 Score = 1306 bits (3379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/761 (83%), Positives = 679/761 (89%), Gaps = 31/761 (4%)

Query: 1   MARFPRSPAPRLLYTLFSSSRTTPTKSSPQSPSAALLQGNFHLQSRQFSAGGNLARAKDD 60
           MAR  RS  PRLLY+L  ++       + +SP+++L+ G FHL  R FSAG N AR K D
Sbjct: 1   MARVSRSSPPRLLYSLCCTT-------ASRSPASSLIGGAFHL--RHFSAG-NAARTKPD 50

Query: 61  KEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDL 120
           KEPWWKESMERLRNIGISAHIDSGKTTLTER+L+YTGRIHEIHEVRGRDGVGAKMDSMDL
Sbjct: 51  KEPWWKESMERLRNIGISAHIDSGKTTLTERVLYYTGRIHEIHEVRGRDGVGAKMDSMDL 110

Query: 121 EREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQ 180
           EREKGITIQSAAT C WKDY+INIIDTPGHVDFT+EVERALRVLDGAILVLCSVGGVQSQ
Sbjct: 111 EREKGITIQSAATYCTWKDYKINIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQ 170

Query: 181 SITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGL 240
           SITVDRQMRRYEVPRLAFINKLDRMGADPWKVL+QARSKLRHH AA+QVP+GLED F+GL
Sbjct: 171 SITVDRQMRRYEVPRLAFINKLDRMGADPWKVLNQARSKLRHHSAAIQVPIGLEDDFKGL 230

Query: 241 VDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPI 300
           VDLVQL A+YFHGSNGE +V  EVPADME  V EKRRELIE VSEVDDKL + FL DE I
Sbjct: 231 VDLVQLKAFYFHGSNGENVVAEEVPADMEALVEEKRRELIETVSEVDDKLAEAFLGDETI 290

Query: 301 SSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNE 360
           S+ DLEEA+RRAT+A+KFIPVFMGSAFKNKGVQPLLDGV+SYLPCP EVSNYALDQ  NE
Sbjct: 291 SAADLEEAVRRATIAQKFIPVFMGSAFKNKGVQPLLDGVISYLPCPIEVSNYALDQAKNE 350

Query: 361 EKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVR 420
           +KV L G+PDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVR
Sbjct: 351 DKVELRGSPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVR 410

Query: 421 MHSNEMEDIQEAHAGQIVAVFGVDCAS---------------------VMSLAVQPVSKD 459
           MHS+EMEDIQEAHAGQIVAVFGV+CAS                     VMSLAVQPVSKD
Sbjct: 411 MHSDEMEDIQEAHAGQIVAVFGVECASGDTFTDGSVKYTMTSMNVPEPVMSLAVQPVSKD 470

Query: 460 SGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKP 519
           SGGQFSKALNRFQKEDPTFRVGLD ESGQTIISGMGELHLDIYVERIRREYKVDA+VGKP
Sbjct: 471 SGGQFSKALNRFQKEDPTFRVGLDPESGQTIISGMGELHLDIYVERIRREYKVDASVGKP 530

Query: 520 RVNFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSN 579
           RVNFRE VT+RA+FDYLHKKQSGGQGQYGRVIGYIEPLP GS  KF FENLLVGQAIPSN
Sbjct: 531 RVNFRETVTQRADFDYLHKKQSGGQGQYGRVIGYIEPLPAGSSTKFAFENLLVGQAIPSN 590

Query: 580 FIPAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAA 639
           FIPAIEKGFKEAANSG+LIGHPVE LRVVLTDGA+HAVDSSELAFK+A+IYAFRQCYAA+
Sbjct: 591 FIPAIEKGFKEAANSGALIGHPVENLRVVLTDGAAHAVDSSELAFKLASIYAFRQCYAAS 650

Query: 640 KPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYST 699
           +PVILEPVMLVELKVPTEFQG+VAGDINKRKG+IVGNDQEGDDSVITAHVPLNNMFGYST
Sbjct: 651 RPVILEPVMLVELKVPTEFQGAVAGDINKRKGVIVGNDQEGDDSVITAHVPLNNMFGYST 710

Query: 700 ALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTHNAGRGAE 740
           ALRSMTQGKGEFTMEYKEH PVS DVQ QL+ T+   +  E
Sbjct: 711 ALRSMTQGKGEFTMEYKEHLPVSHDVQTQLINTYKGNKEGE 751

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225453494|ref|XP_002275162.1| PREDICTED: elongation factor G, mitochondrial [Vitis vinifera] gi|297734553|emb|CBI16604.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147800081|emb|CAN77652.1| hypothetical protein VITISV_032323 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297824539|ref|XP_002880152.1| hypothetical protein ARALYDRAFT_483634 [Arabidopsis lyrata subsp. lyrata] gi|297325991|gb|EFH56411.1| hypothetical protein ARALYDRAFT_483634 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449445507|ref|XP_004140514.1| PREDICTED: elongation factor G, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15225397|ref|NP_182029.1| elongation factor EF-G [Arabidopsis thaliana] gi|330255404|gb|AEC10498.1| elongation factor EF-G [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15220073|ref|NP_175135.1| Elongation factor G [Arabidopsis thaliana] gi|27923772|sp|Q9C641.1|EFGM_ARATH RecName: Full=Elongation factor G, mitochondrial; Short=EF-Gmt; AltName: Full=Elongation factor G 1, mitochondrial; Short=mEF-G 1; AltName: Full=Elongation factor G1; Flags: Precursor gi|12321017|gb|AAG50635.1|AC083835_20 mitochondrial elongation factor, putative [Arabidopsis thaliana] gi|332193994|gb|AEE32115.1| Elongation factor G [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356541316|ref|XP_003539124.1| PREDICTED: elongation factor G, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357504475|ref|XP_003622526.1| Elongation factor G [Medicago truncatula] gi|355497541|gb|AES78744.1| Elongation factor G [Medicago truncatula] Back     alignment and taxonomy information
>gi|224125052|ref|XP_002329879.1| predicted protein [Populus trichocarpa] gi|222871116|gb|EEF08247.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query740
TAIR|locus:2055611754 AT2G45030 [Arabidopsis thalian 0.593 0.582 0.799 0.0
TAIR|locus:2825721754 AT1G45332 [Arabidopsis thalian 0.594 0.583 0.794 0.0
UNIPROTKB|A7RR04735 v1g236547 "Elongation factor G 0.509 0.512 0.646 2.4e-212
DICTYBASE|DDB_G0270482734 gfm1 "mitochondrial translatio 0.512 0.516 0.639 8.3e-212
POMBASE|SPBC1306.01c770 SPBC1306.01c "mitochondrial tr 0.418 0.402 0.598 9.5e-212
UNIPROTKB|B0WGM1744 CPIJ005834 "Elongation factor 0.522 0.520 0.639 2e-208
CGD|CAL0006276761 orf19.4932 [Candida albicans ( 0.514 0.500 0.602 6.1e-207
UNIPROTKB|B3N6A5745 ico "Elongation factor G, mito 0.566 0.562 0.596 4.2e-206
UNIPROTKB|Q7Q1K8744 AGAP009737 "Elongation factor 0.525 0.522 0.646 1.4e-205
SGD|S000004059761 MEF1 "Mitochondrial elongation 0.509 0.495 0.619 1.8e-205
TAIR|locus:2055611 AT2G45030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1865 (661.6 bits), Expect = 0., Sum P(2) = 0.
 Identities = 358/448 (79%), Positives = 400/448 (89%)

Query:     1 MARFPRSPAPRLLYTLFXXXXXXXXXXXXXXXXAALLQGNFHLQSRQFSAGGNLARA-KD 59
             MARFP SPAP LL  LF                AALL G+FHL  R FSAG   ARA KD
Sbjct:     1 MARFPTSPAPNLLLRLFSSNKRASSPT------AALLTGDFHL-IRHFSAG-TAARAVKD 52

Query:    60 DKEPWWKESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMD 119
             +KEPWWKESM++LRNIGISAHIDSGKTTLTER+LFYTGRIHEIHEVRGRDGVGAKMDSMD
Sbjct:    53 EKEPWWKESMDKLRNIGISAHIDSGKTTLTERVLFYTGRIHEIHEVRGRDGVGAKMDSMD 112

Query:   120 LEREKGITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQS 179
             LEREKGITIQSAAT C WKDY++NIIDTPGHVDFT+EVERALRVLDGAILVLCSVGGVQS
Sbjct:   113 LEREKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQS 172

Query:   180 QSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQG 239
             QSITVDRQMRRYEVPR+AFINKLDRMGADPWKVL+QAR+KLRHH AAVQVP+GLE+ FQG
Sbjct:   173 QSITVDRQMRRYEVPRVAFINKLDRMGADPWKVLNQARAKLRHHSAAVQVPIGLEENFQG 232

Query:   240 LVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEP 299
             L+DL+ + AY+FHGS+GE +V G++PADME  V +KRRELIE VSEVDD L + FL+DEP
Sbjct:   233 LIDLIHVKAYFFHGSSGENVVAGDIPADMEGLVGDKRRELIETVSEVDDVLAEKFLNDEP 292

Query:   300 ISSGDLEEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNN 359
             +S+ +LEEAIRRAT+A+KF+PVFMGSAFKNKGVQPLLDGV+S+LP P EV+NYALDQ NN
Sbjct:   293 VSAAELEEAIRRATIAQKFVPVFMGSAFKNKGVQPLLDGVVSFLPSPNEVNNYALDQNNN 352

Query:   360 EEKVILSGNPDGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLV 419
             EE+V L+G+PDGPLVALAFKLEEGRFGQLTYLR+YEGVI+KGDFIINVNTGK+IKVPRLV
Sbjct:   353 EERVTLTGSPDGPLVALAFKLEEGRFGQLTYLRVYEGVIKKGDFIINVNTGKRIKVPRLV 412

Query:   420 RMHSNEMEDIQEAHAGQIVAVFGVDCAS 447
             RMHSN+MEDIQEAHAGQIVAVFG++CAS
Sbjct:   413 RMHSNDMEDIQEAHAGQIVAVFGIECAS 440
GO:0003746 "translation elongation factor activity" evidence=IEA;ISS
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006414 "translational elongation" evidence=IEA
GO:0008135 "translation factor activity, nucleic acid binding" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2825721 AT1G45332 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A7RR04 v1g236547 "Elongation factor G, mitochondrial" [Nematostella vectensis (taxid:45351)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270482 gfm1 "mitochondrial translation elongation factor G" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC1306.01c SPBC1306.01c "mitochondrial translation elongation factor G (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|B0WGM1 CPIJ005834 "Elongation factor G, mitochondrial" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
CGD|CAL0006276 orf19.4932 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|B3N6A5 ico "Elongation factor G, mitochondrial" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Q1K8 AGAP009737 "Elongation factor G, mitochondrial" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
SGD|S000004059 MEF1 "Mitochondrial elongation factor involved in translational elongation" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B4NZM7EFGM_DROYANo assigned EC number0.54180.94860.9422N/Ano
B4HY41EFGM_DROSENo assigned EC number0.54320.94860.9422N/Ano
A7TFN8EFGM_VANPONo assigned EC number0.55000.89450.8530N/Ano
Q2LTB9EFG1_SYNASNo assigned EC number0.56150.88910.9467yesno
P0CN32EFGM_CRYNJNo assigned EC number0.53830.97430.8890yesno
P0CN33EFGM_CRYNBNo assigned EC number0.54400.97290.8877N/Ano
Q6ASC7EFG1_DESPSNo assigned EC number0.56430.90.9582yesno
B0DSK4EFGM_LACBSNo assigned EC number0.58580.88640.8888N/Ano
Q6FUQ6EFGM_CANGANo assigned EC number0.55120.90.8797yesno
Q1DLM0EFGM_COCIMNo assigned EC number0.54370.91350.845N/Ano
Q73NV3EFG2_TREDENo assigned EC number0.54250.90270.9611yesno
Q9USZ1EFGM_SCHPONo assigned EC number0.56160.90270.8675yesno
Q7Q1K8EFGM_ANOGANo assigned EC number0.56730.90810.9032yesno
B4LS49EFGM_DROVINo assigned EC number0.55170.90540.8969N/Ano
B3N6A5EFGM_DROERNo assigned EC number0.54320.94860.9422N/Ano
Q16S14EFGM_AEDAENo assigned EC number0.55450.90540.8957N/Ano
B4Q5D5EFGM_DROSINo assigned EC number0.54320.94860.9422N/Ano
B3LT39EFGM_YEAS1No assigned EC number0.56020.89450.8699N/Ano
B4KKD5EFGM_DROMONo assigned EC number0.53420.950.9410N/Ano
P25039EFGM_YEASTNo assigned EC number0.56200.88910.8646yesno
A1CHC3EFGM_ASPCLNo assigned EC number0.54240.90940.8401N/Ano
Q5AL45EFGM_CANALNo assigned EC number0.55930.89860.8738N/Ano
B3MK91EFGM_DROANNo assigned EC number0.55170.90540.8993N/Ano
Q1D9P5EFG1_MYXXDNo assigned EC number0.59590.90810.9545yesno
Q29N77EFGM_DROPSNo assigned EC number0.54800.90670.9018yesno
B6QHL4EFGM_PENMQNo assigned EC number0.54820.90540.8343N/Ano
Q9FE64EFGM_ORYSJNo assigned EC number0.81180.92560.9048yesno
Q6CRY5EFGM_KLULANo assigned EC number0.55820.90810.8900yesno
B6K286EFGM_SCHJYNo assigned EC number0.57420.89590.8689N/Ano
A5DK38EFGM_PICGUNo assigned EC number0.54890.89320.8697N/Ano
Q55E94EFGM_DICDINo assigned EC number0.580.90540.9128yesno
B4JQM7EFGM_DROGRNo assigned EC number0.54870.90810.8995N/Ano
Q9VM33EFGM_DROMENo assigned EC number0.54320.94860.9422yesno
A8P1W0EFGM_COPC7No assigned EC number0.58260.88640.8019N/Ano
A8PXR7EFGM_MALGONo assigned EC number0.55970.89590.8532N/Ano
Q04Y01EFG_LEPBLNo assigned EC number0.56540.90940.9532yesno
B4MZW9EFGM_DROWINo assigned EC number0.55600.90540.8993N/Ano
Q8F983EFG_LEPINNo assigned EC number0.56540.90940.9532yesno
Q72VM5EFG_LEPICNo assigned EC number0.56540.90940.9532yesno
Q6MP77EFG2_BDEBANo assigned EC number0.56520.91210.9615yesno
B9W9T4EFGM_CANDCNo assigned EC number0.55790.89860.8738yesno
Q9C641EFGM_ARATHNo assigned EC number0.80940.99050.9721yesno
Q04VH3EFG_LEPBJNo assigned EC number0.56540.90940.9532yesno
A7A0X4EFGM_YEAS7No assigned EC number0.56020.89450.8699N/Ano
Q5B6J8EFGM_EMENINo assigned EC number0.54670.90940.8423yesno
B0WGM1EFGM_CULQUNo assigned EC number0.57470.90540.9005N/Ano
A7RR04EFGM_NEMVENo assigned EC number0.58570.89720.9034N/Ano
B5VN01EFGM_YEAS6No assigned EC number0.56020.89450.8699N/Ano
Q75CZ5EFGM_ASHGONo assigned EC number0.55420.89720.8771yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query740
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 0.0
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 0.0
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 0.0
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 0.0
COG0480697 COG0480, FusA, Translation elongation factors (GTP 0.0
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 0.0
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 1e-177
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 2e-76
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 4e-72
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 7e-61
cd01434116 cd01434, EFG_mtEFG1_IV, EFG_mtEFG1_IV: domains sim 9e-59
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 2e-52
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 2e-50
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 1e-47
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 3e-47
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Pr 8e-45
cd00881183 cd00881, GTP_translation_factor, GTP translation f 8e-45
cd0409181 cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of m 2e-44
cd0409778 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho 2e-43
smart00889120 smart00889, EFG_IV, Elongation factor G, domain IV 3e-40
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 7e-39
pfam03764120 pfam03764, EFG_IV, Elongation factor G, domain IV 6e-38
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 5e-36
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 6e-36
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar 2e-35
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 2e-35
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 5e-34
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 4e-33
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 2e-31
smart0083885 smart00838, EFG_C, Elongation factor G C-terminus 3e-31
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 4e-31
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 1e-30
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 2e-30
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 9e-29
pfam0067989 pfam00679, EFG_C, Elongation factor G C-terminus 1e-27
cd0408883 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamil 2e-27
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 3e-27
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 3e-26
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G 6e-26
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 1e-25
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provision 7e-24
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 5e-23
PLN00116 843 PLN00116, PLN00116, translation elongation factor 2e-21
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 3e-19
PLN00116843 PLN00116, PLN00116, translation elongation factor 5e-16
cd01680116 cd01680, EFG_like_IV, Elongation Factor G-like dom 9e-16
cd0409283 cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of m 7e-15
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 2e-13
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 1e-12
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 2e-12
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 1e-11
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 2e-11
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 2e-11
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 1e-10
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 2e-10
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 2e-09
COG0050394 COG0050, TufB, GTPases - translation elongation fa 8e-09
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 1e-08
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 1e-08
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 2e-08
cd0371079 cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal po 2e-08
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 3e-08
cd0371178 cd03711, Tet_C, Tet_C: C-terminus of ribosomal pro 3e-08
cd0409680 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: thi 3e-08
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 3e-08
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 4e-08
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 4e-08
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 5e-08
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 5e-08
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 9e-08
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 1e-07
CHL00189742 CHL00189, infB, translation initiation factor 2; P 2e-07
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 4e-07
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 5e-07
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 7e-07
cd0369085 cd03690, Tet_II, Tet_II: This subfamily represents 8e-07
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-06
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 3e-06
CHL00071409 CHL00071, tufA, elongation factor Tu 3e-06
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 3e-06
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 5e-06
cd0370093 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th 8e-06
cd0369186 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of 2e-05
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 2e-05
COG3276447 COG3276, SelB, Selenocysteine-specific translation 2e-05
cd01684115 cd01684, Tet_like_IV, EF-G_domain IV_RPP domain is 3e-05
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 6e-05
TIGR00491590 TIGR00491, aIF-2, translation initiation factor aI 9e-05
COG1217 603 COG1217, TypA, Predicted membrane GTPase involved 3e-04
TIGR01394 594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 3e-04
PRK04004586 PRK04004, PRK04004, translation initiation factor 3e-04
cd01681177 cd01681, aeEF2_snRNP_like_IV, This family represen 3e-04
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 4e-04
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 7e-04
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 0.002
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 0.002
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 0.002
PRK148451049 PRK14845, PRK14845, translation initiation factor 0.002
cd01683178 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain 0.003
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information 
 Score =  892 bits (2309), Expect = 0.0
 Identities = 328/677 (48%), Positives = 445/677 (65%), Gaps = 32/677 (4%)

Query: 78  SAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAW 137
             H  +GKTTLTE ILFYTG IH I EV         MD M  ERE+GI+I SAAT+C W
Sbjct: 1   VGHSGAGKTTLTEAILFYTGAIHRIGEVEDGT---TTMDFMPEERERGISITSAATTCEW 57

Query: 138 KDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLA 197
           K ++IN+IDTPGHVDFT EVERALRVLDGA++V+C+VGGV+ Q+ TV RQ  +Y VPR+ 
Sbjct: 58  KGHKINLIDTPGHVDFTGEVERALRVLDGAVVVVCAVGGVEPQTETVWRQAEKYGVPRII 117

Query: 198 FINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTAYYFHGSNGE 257
           F+NK+DR GAD ++VL Q + KL      +Q+P+G  D F G+VDL+ + AY +    G 
Sbjct: 118 FVNKMDRAGADFFRVLAQLQEKLGAPVVPLQLPIGEGDDFTGVVDLLSMKAYRYD--EGG 175

Query: 258 KIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEAIRRATVARK 317
                E+PA++     E R EL+E ++E DD+L + +L  E +S  +++  +R+AT+A +
Sbjct: 176 PSEEIEIPAELLDRAEEAREELLEALAEFDDELMEKYLEGEELSEEEIKAGLRKATLAGE 235

Query: 318 FIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVILSGNPDGPLVALA 377
            +PVF GSA KNKGVQ LLD V+ YLP P EV    +D ++ EE   L+ +PDGPLVAL 
Sbjct: 236 IVPVFCGSALKNKGVQRLLDAVVDYLPSPLEVP--PVDGEDGEEGAELAPDPDGPLVALV 293

Query: 378 FKLEEGRF-GQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQ 436
           FK  +  F G+L+ +R+Y G ++KGD + N  TGKK +V RL RMH  + E++ EA AG 
Sbjct: 294 FKTMDDPFVGKLSLVRVYSGTLKKGDTLYNSGTGKKERVGRLYRMHGKQREEVDEAVAGD 353

Query: 437 IVAVFGVD--------CAS--------------VMSLAVQPVSKDSGGQFSKALNRFQKE 474
           IVAV  +         C                V+SLA++P  K    + S+AL +  +E
Sbjct: 354 IVAVAKLKDAATGDTLCDKGDPILLEPMEFPEPVISLAIEPKDKGDEEKLSEALGKLAEE 413

Query: 475 DPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNFREAVTKRAEFD 534
           DPT RV  D E+GQTI+SGMGELHLD+ +ER++REY V+   G P+V +RE + K+AE  
Sbjct: 414 DPTLRVERDEETGQTILSGMGELHLDVALERLKREYGVEVETGPPQVPYRETIRKKAEGH 473

Query: 535 YLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANS 594
             HKKQSGG GQ+G V   +EPLP G    FEF + +VG A+P  +IPA+EKG +EA   
Sbjct: 474 GRHKKQSGGHGQFGDVWLEVEPLPRGEG--FEFVDKVVGGAVPRQYIPAVEKGVREALEK 531

Query: 595 GSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKV 654
           G L G+PV  ++V LTDG+ H+VDSSE+AFK+AA  AFR+    AKPV+LEP+M VE+ V
Sbjct: 532 GVLAGYPVVDVKVTLTDGSYHSVDSSEMAFKIAARLAFREALPKAKPVLLEPIMKVEVSV 591

Query: 655 PTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRSMTQGKGEFTME 714
           P EF G V GD++ R+G I+G +  G   V+ A VPL  MFGY+T LRS+TQG+G F+ME
Sbjct: 592 PEEFVGDVIGDLSSRRGRILGMESRGGGDVVRAEVPLAEMFGYATDLRSLTQGRGSFSME 651

Query: 715 YKEHAPVSQDVQLQLVK 731
           +  +  V  +V  +++ 
Sbjct: 652 FSHYEEVPGNVAEKVIA 668

Length = 668
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|238715 cd01434, EFG_mtEFG1_IV, EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|239758 cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|214887 smart00889, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|202760 pfam03764, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|197906 smart00838, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|201388 pfam00679, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|239755 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|238838 cd01680, EFG_like_IV, Elongation Factor G-like domain IV Back     alignment and domain information
>gnl|CDD|239759 cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|239681 cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|239682 cd03711, Tet_C, Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>gnl|CDD|239763 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|239661 cd03690, Tet_II, Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|239662 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238841 cd01684, Tet_like_IV, EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|238839 cd01681, aeEF2_snRNP_like_IV, This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|237833 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information
>gnl|CDD|238840 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 740
KOG0465721 consensus Mitochondrial elongation factor [Transla 100.0
COG0480697 FusA Translation elongation factors (GTPases) [Tra 100.0
PRK00007693 elongation factor G; Reviewed 100.0
PRK12739691 elongation factor G; Reviewed 100.0
TIGR00484689 EF-G translation elongation factor EF-G. After pep 100.0
PRK13351687 elongation factor G; Reviewed 100.0
PRK12740668 elongation factor G; Reviewed 100.0
PLN00116843 translation elongation factor EF-2 subunit; Provis 100.0
PTZ00416836 elongation factor 2; Provisional 100.0
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 100.0
PRK07560731 elongation factor EF-2; Reviewed 100.0
KOG0464753 consensus Elongation factor G [Translation, riboso 100.0
KOG0469842 consensus Elongation factor 2 [Translation, riboso 100.0
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
KOG0468971 consensus U5 snRNP-specific protein [Translation, 100.0
PRK10218 607 GTP-binding protein; Provisional 100.0
PRK05433600 GTP-binding protein LepA; Provisional 100.0
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
TIGR00503527 prfC peptide chain release factor 3. This translat 100.0
KOG0467887 consensus Translation elongation factor 2/ribosome 100.0
KOG0462650 consensus Elongation factor-type GTP-binding prote 100.0
COG1217 603 TypA Predicted membrane GTPase involved in stress 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 100.0
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 100.0
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 100.0
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 100.0
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
PRK05306787 infB translation initiation factor IF-2; Validated 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
KOG0460449 consensus Mitochondrial translation elongation fac 100.0
CHL00189742 infB translation initiation factor 2; Provisional 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.98
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.98
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.97
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.97
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.97
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.97
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.97
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.97
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.96
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.96
KOG1145683 consensus Mitochondrial translation initiation fac 99.96
COG3276447 SelB Selenocysteine-specific translation elongatio 99.96
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.95
COG5258527 GTPBP1 GTPase [General function prediction only] 99.95
KOG0459501 consensus Polypeptide release factor 3 [Translatio 99.95
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.95
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.94
PRK04004586 translation initiation factor IF-2; Validated 99.94
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.93
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.93
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.93
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.93
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.92
KOG0461522 consensus Selenocysteine-specific elongation facto 99.92
PF03764120 EFG_IV: Elongation factor G, domain IV; InterPro: 99.92
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of 99.91
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.91
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.91
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.9
cd01434116 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do 99.89
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.88
PRK148451049 translation initiation factor IF-2; Provisional 99.88
cd01680116 EFG_like_IV Elongation Factor G-like domain IV. Th 99.88
cd01693120 mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i 99.87
cd00881189 GTP_translation_factor GTP translation factor fami 99.87
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 99.87
cd01683178 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part 99.86
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 99.86
smart0083885 EFG_C Elongation factor G C-terminus. This domain 99.85
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 99.84
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.84
cd0409778 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo 99.83
cd0371178 Tet_C Tet_C: C-terminus of ribosomal protection pr 99.82
cd0371378 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C- 99.81
cd01681177 aeEF2_snRNP_like_IV This family represents domain 99.81
cd0409680 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r 99.81
cd0371079 BipA_TypA_C BipA_TypA_C: a C-terminal portion of B 99.81
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.8
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.79
cd0151479 Elongation_Factor_C Elongation factor G C-terminus 99.79
cd0370980 lepA_C lepA_C: This family represents the C-termin 99.78
COG1160444 Predicted GTPases [General function prediction onl 99.78
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.77
PF1449275 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_ 99.76
KOG1143591 consensus Predicted translation elongation factor 99.76
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.75
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.75
KOG0463641 consensus GTP-binding protein GP-1 [General functi 99.74
PRK15494339 era GTPase Era; Provisional 99.74
COG1159298 Era GTPase [General function prediction only] 99.74
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.74
PRK00093435 GTP-binding protein Der; Reviewed 99.73
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.73
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.73
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.72
COG1160444 Predicted GTPases [General function prediction onl 99.72
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.71
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.7
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.69
PRK03003472 GTP-binding protein Der; Reviewed 99.69
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.69
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.69
PRK03003472 GTP-binding protein Der; Reviewed 99.69
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.69
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.69
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.68
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.68
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.68
PRK00089292 era GTPase Era; Reviewed 99.68
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.67
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.67
PRK04213201 GTP-binding protein; Provisional 99.67
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.67
KOG0466466 consensus Translation initiation factor 2, gamma s 99.67
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.66
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.66
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.66
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.66
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.66
COG2229187 Predicted GTPase [General function prediction only 99.66
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.66
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.66
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.65
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.65
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.65
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.65
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.65
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.65
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.65
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.65
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.64
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.64
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.64
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.64
PRK00093435 GTP-binding protein Der; Reviewed 99.64
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.64
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.64
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.64
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.64
PLN00223181 ADP-ribosylation factor; Provisional 99.64
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.64
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.64
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.63
PTZ00369189 Ras-like protein; Provisional 99.63
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.63
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.63
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.63
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.63
COG0218200 Predicted GTPase [General function prediction only 99.63
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.63
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.63
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.63
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.63
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.63
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.63
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.62
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.62
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.62
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.62
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.62
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.62
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.61
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.61
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.61
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.61
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.61
PTZ00133182 ADP-ribosylation factor; Provisional 99.61
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.6
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.6
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.6
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.6
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.6
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.6
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.6
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.6
PRK12299335 obgE GTPase CgtA; Reviewed 99.6
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.6
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.6
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.6
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.59
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.59
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.59
cd0369085 Tet_II Tet_II: This subfamily represents domain II 99.59
PLN03110216 Rab GTPase; Provisional 99.59
PLN03118211 Rab family protein; Provisional 99.58
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.58
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.58
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.58
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.58
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.58
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.58
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.58
PRK12298390 obgE GTPase CgtA; Reviewed 99.58
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.58
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.57
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.57
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.57
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.57
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.57
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.57
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.56
PRK12297424 obgE GTPase CgtA; Reviewed 99.56
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.56
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.55
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.55
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.55
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.55
PLN03108210 Rab family protein; Provisional 99.55
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.55
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.55
COG0486454 ThdF Predicted GTPase [General function prediction 99.55
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.54
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.54
PRK12296500 obgE GTPase CgtA; Reviewed 99.54
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.53
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.53
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.53
PRK11058426 GTPase HflX; Provisional 99.53
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.53
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.53
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.53
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 99.52
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.52
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.52
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.51
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.51
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 99.5
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 99.49
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.48
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.48
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.48
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.48
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.47
cd0368985 RF3_II RF3_II: this subfamily represents the domai 99.47
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.46
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.46
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.46
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.45
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.44
cd04105203 SR_beta Signal recognition particle receptor, beta 99.44
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.42
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.42
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.42
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.42
cd01896233 DRG The developmentally regulated GTP-binding prot 99.42
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.41
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.41
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 99.4
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 99.38
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 99.38
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.37
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.36
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.36
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.35
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.35
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.35
cd0369986 lepA_II lepA_II: This subfamily represents the dom 99.34
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.33
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.33
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.32
COG3596296 Predicted GTPase [General function prediction only 99.32
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.3
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.29
PRK13768253 GTPase; Provisional 99.29
COG2262411 HflX GTPases [General function prediction only] 99.28
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.27
PRK09866741 hypothetical protein; Provisional 99.26
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.24
KOG0394210 consensus Ras-related GTPase [General function pre 99.24
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.23
COG1084346 Predicted GTPase [General function prediction only 99.23
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.22
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.22
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.22
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.2
PLN00023334 GTP-binding protein; Provisional 99.2
COG1163365 DRG Predicted GTPase [General function prediction 99.18
KOG0090238 consensus Signal recognition particle receptor, be 99.17
PRK09435332 membrane ATPase/protein kinase; Provisional 99.14
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.14
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.13
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.12
COG0536369 Obg Predicted GTPase [General function prediction 99.09
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.09
COG1100219 GTPase SAR1 and related small G proteins [General 99.08
PTZ00099176 rab6; Provisional 99.08
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.07
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.06
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.05
KOG0052391 consensus Translation elongation factor EF-1 alpha 99.05
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.02
KOG0395196 consensus Ras-related GTPase [General function pre 99.02
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.01
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.99
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.95
KOG0088218 consensus GTPase Rab21, small G protein superfamil 98.89
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.88
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.87
PRK09602396 translation-associated GTPase; Reviewed 98.87
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.87
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.86
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.85
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.85
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.84
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.83
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.8
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.76
PRK09601364 GTP-binding protein YchF; Reviewed 98.69
PTZ00258390 GTP-binding protein; Provisional 98.69
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.67
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 98.65
KOG0097215 consensus GTPase Rab14, small G protein superfamil 98.64
KOG0081219 consensus GTPase Rab27, small G protein superfamil 98.59
KOG0091213 consensus GTPase Rab39, small G protein superfamil 98.57
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.57
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.56
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.55
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.51
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.48
KOG4252246 consensus GTP-binding protein [Signal transduction 98.47
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.46
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 98.43
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.4
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.37
KOG2486320 consensus Predicted GTPase [General function predi 98.37
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.36
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.35
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.34
KOG0410410 consensus Predicted GTP binding protein [General f 98.27
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 98.23
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 98.21
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.21
COG5019373 CDC3 Septin family protein [Cell division and chro 98.21
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.2
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.19
cd03110179 Fer4_NifH_child This protein family's function is 98.18
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.17
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.13
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 98.11
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.11
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.11
PRK00771437 signal recognition particle protein Srp54; Provisi 98.1
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.1
cd03115173 SRP The signal recognition particle (SRP) mediates 98.08
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.07
COG0012372 Predicted GTPase, probable translation factor [Tra 98.06
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 98.05
PRK10867433 signal recognition particle protein; Provisional 98.04
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.01
cd02036179 MinD Bacterial cell division requires the formatio 98.0
TIGR00959428 ffh signal recognition particle protein. This mode 97.94
KOG1673205 consensus Ras GTPases [General function prediction 97.93
cd03114148 ArgK-like The function of this protein family is u 97.92
PRK09563287 rbgA GTPase YlqF; Reviewed 97.88
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.87
TIGR00064272 ftsY signal recognition particle-docking protein F 97.85
cd03112158 CobW_like The function of this protein family is u 97.85
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 97.84
PRK10416318 signal recognition particle-docking protein FtsY; 97.84
cd0369683 selB_II selB_II: this subfamily represents the dom 97.83
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.83
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.81
KOG3886295 consensus GTP-binding protein [Signal transduction 97.81
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.79
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.77
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.76
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.76
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.73
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 97.73
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 97.72
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 97.72
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 97.71
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.69
PRK12289352 GTPase RsgA; Reviewed 97.64
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.64
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.64
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.63
PRK14974336 cell division protein FtsY; Provisional 97.63
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.62
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 97.61
PRK12288347 GTPase RsgA; Reviewed 97.59
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.57
PRK13849231 putative crown gall tumor protein VirC1; Provision 97.57
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.53
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.52
COG1162301 Predicted GTPases [General function prediction onl 97.51
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.5
PRK00098298 GTPase RsgA; Reviewed 97.48
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.47
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.46
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.46
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.42
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.41
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.39
PHA02518211 ParA-like protein; Provisional 97.37
PRK12289352 GTPase RsgA; Reviewed 97.36
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.35
PRK13796365 GTPase YqeH; Provisional 97.33
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.32
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.28
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.27
cd03111106 CpaE_like This protein family consists of proteins 97.26
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.25
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.24
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.23
COG0523323 Putative GTPases (G3E family) [General function pr 97.21
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.19
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.19
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.16
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.16
PRK09563287 rbgA GTPase YlqF; Reviewed 97.13
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 97.1
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 97.09
COG1161322 Predicted GTPases [General function prediction onl 97.09
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.08
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 97.07
PRK01889356 GTPase RsgA; Reviewed 97.07
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.07
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 97.06
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.05
PRK11537318 putative GTP-binding protein YjiA; Provisional 97.05
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 97.03
cd02117212 NifH_like This family contains the NifH (iron prot 97.01
PRK00098298 GTPase RsgA; Reviewed 96.99
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 96.99
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.97
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.95
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 96.94
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.93
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.93
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.92
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 96.9
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.88
KOG3905473 consensus Dynein light intermediate chain [Cell mo 96.86
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 96.86
PRK12288347 GTPase RsgA; Reviewed 96.85
PRK13796365 GTPase YqeH; Provisional 96.84
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.83
PRK13232273 nifH nitrogenase reductase; Reviewed 96.8
TIGR01968261 minD_bact septum site-determining protein MinD. Th 96.77
cd02032267 Bchl_like This family of proteins contains bchL an 96.75
CHL00072290 chlL photochlorophyllide reductase subunit L 96.74
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.73
KOG1491391 consensus Predicted GTP-binding protein (ODN super 96.69
cd02040270 NifH NifH gene encodes component II (iron protein) 96.66
KOG0780483 consensus Signal recognition particle, subunit Srp 96.59
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.52
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 96.52
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 96.5
cd0370295 IF2_mtIF2_II This family represents the domain II 96.41
KOG3887347 consensus Predicted small GTPase involved in nucle 96.34
TIGR01287275 nifH nitrogenase iron protein. This model describe 96.33
CHL00175281 minD septum-site determining protein; Validated 96.31
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 96.3
PRK13695174 putative NTPase; Provisional 96.24
KOG1533290 consensus Predicted GTPase [General function predi 96.24
TIGR00257204 IMPACT_YIGZ uncharacterized protein, YigZ family. 96.16
PRK13230279 nitrogenase reductase-like protein; Reviewed 96.15
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.12
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 96.06
PRK11568204 hypothetical protein; Provisional 95.9
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 95.85
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 95.81
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 95.73
PRK01889356 GTPase RsgA; Reviewed 95.72
COG1162301 Predicted GTPases [General function prediction onl 95.68
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 95.67
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 95.55
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.54
KOG2423572 consensus Nucleolar GTPase [General function predi 95.48
COG3523 1188 IcmF Type VI protein secretion system component Va 95.38
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 95.24
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 95.15
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 95.04
KOG4181491 consensus Uncharacterized conserved protein [Funct 95.04
PRK13233275 nifH nitrogenase reductase; Reviewed 94.97
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 94.95
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 94.95
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 94.92
COG1192259 Soj ATPases involved in chromosome partitioning [C 94.88
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penulti 94.87
cd03116159 MobB Molybdenum is an essential trace element in t 94.86
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-154  Score=1236.83  Aligned_cols=664  Identities=63%  Similarity=1.015  Sum_probs=644.0

Q ss_pred             hccCCceEEEEEeCCCCChHHHHHHHHHHcCCceeeeeeccCCcccccccChhhhhhhCceeeeceEEEEecCeEEEEEe
Q 004649           67 ESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIID  146 (740)
Q Consensus        67 ~~~~~irnI~iiG~~~~GKTTL~~~Ll~~~g~i~~~~~~~~~~~~~~~~d~~~~e~~~giTi~~~~~~~~~~~~~i~liD  146 (740)
                      .+.+++|||+|++|.|+||||+++++||++|.+..+++++++   ...||+++.||+||||++++.+++.|+++++|+||
T Consensus        34 ~~~~k~RNIgi~AhidsgKTT~tEr~Lyy~G~~~~i~ev~~~---~a~md~m~~er~rgITiqSAAt~~~w~~~~iNiID  110 (721)
T KOG0465|consen   34 IPLNKIRNIGISAHIDAGKTTLTERMLYYTGRIKHIGEVRGG---GATMDSMELERQRGITIQSAATYFTWRDYRINIID  110 (721)
T ss_pred             CchhhhcccceEEEEecCCceeeheeeeecceeeeccccccC---ceeeehHHHHHhcCceeeeceeeeeeccceeEEec
Confidence            455789999999999999999999999999999999999999   88999999999999999999999999999999999


Q ss_pred             CCCCCCcHHHHHHHHHhcCEEEEEEeCCCccchhHHHHHHHHHHcCCCEEEEEecCCCCCCChHHHHHHHHHHhccccce
Q 004649          147 TPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAA  226 (740)
Q Consensus       147 TPGh~df~~~~~~al~~~D~ailVvda~~g~~~qt~~~~~~~~~~~ip~ivviNKiD~~~~~~~~~l~~i~~~l~~~~~~  226 (740)
                      ||||.||.-++++||++.||||+|+|++.|++.||..+|+|++++++|.|.|+||||+.++++++++++++.+|+++++.
T Consensus       111 TPGHvDFT~EVeRALrVlDGaVlvl~aV~GVqsQt~tV~rQ~~ry~vP~i~FiNKmDRmGa~~~~~l~~i~~kl~~~~a~  190 (721)
T KOG0465|consen  111 TPGHVDFTFEVERALRVLDGAVLVLDAVAGVESQTETVWRQMKRYNVPRICFINKMDRMGASPFRTLNQIRTKLNHKPAV  190 (721)
T ss_pred             CCCceeEEEEehhhhhhccCeEEEEEcccceehhhHHHHHHHHhcCCCeEEEEehhhhcCCChHHHHHHHHhhcCCchhe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccCCCCCccceeEeceeeeeEEEeCCCCCeEEecCCchhHHHHHHHHHHHHHHHHhcCChHHHhhhhcCCCCChhHHH
Q 004649          227 VQVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLE  306 (740)
Q Consensus       227 ~~~pi~~~~~~~g~vdl~~~~~~~~~~~~g~~~~~~~i~~~~~~~~~~~~~~l~e~~~~~dd~l~e~~l~~~~~~~~~l~  306 (740)
                      +|+|++.++.|.|++|++++++++|++++|..+...+||+++.+.+.+.|.+|+|.+++.||+|.|.||++.+++.++|+
T Consensus       191 vqiPig~e~~f~GvvDlv~~kai~~~g~~g~~i~~~eIP~~l~~~~~e~R~~LIE~lad~DE~l~e~fLee~~ps~~~l~  270 (721)
T KOG0465|consen  191 VQIPIGSESNFKGVVDLVNGKAIYWDGENGEIVRKDEIPEDLEELAEEKRQALIETLADVDETLAEMFLEEEEPSAQQLK  270 (721)
T ss_pred             eEccccccccchhHHhhhhceEEEEcCCCCceeEeccCCHHHHHHHHHHHHHHHHHHhhhhHHHHHHHhccCCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcccceeeeccccCCCcchHHHHHHHHhhCCCCcccccccccc-CCccchhhccCCCCC-CeEEEEEEEeecC
Q 004649          307 EAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQ-KNNEEKVILSGNPDG-PLVALAFKLEEGR  384 (740)
Q Consensus       307 ~~l~~~~~~~~~~Pv~~gSA~~~~Gi~~Lld~i~~~lP~p~~~~~~~~~~-~~~~~~~~~~~~~~~-p~~~~V~k~~~~~  384 (740)
                      .++|+.++.+.|+|||||||++|.|||+|||++++|||+|.|..+++++. .+.++.+.+....++ ||++++||+..++
T Consensus       271 ~aIRr~Ti~r~fvPVl~GSAlKNkGVQPlLDAVvdYLPsP~Ev~n~a~~ke~~~~ekv~l~~~~d~~Pfv~LAFKle~g~  350 (721)
T KOG0465|consen  271 AAIRRATIKRSFVPVLCGSALKNKGVQPLLDAVVDYLPSPSEVENYALNKETNSKEKVTLSPSRDKDPFVALAFKLEEGR  350 (721)
T ss_pred             HHHHHHHhhcceeeEEechhhcccCcchHHHHHHHhCCChhhhcccccccCCCCccceEeccCCCCCceeeeEEEeeecC
Confidence            99999999999999999999999999999999999999999999998873 333334555544444 9999999999999


Q ss_pred             CccEEEEEEEeeeeccCCEEEEecCCceeecCeEEEeecCcccccceecCCCEEEEcccceee-----------------
Q 004649          385 FGQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEMEDIQEAHAGQIVAVFGVDCAS-----------------  447 (740)
Q Consensus       385 ~G~l~~~RV~sG~l~~g~~v~~~~~~~~~~i~~l~~~~g~~~~~v~~a~aGdIv~i~gl~~~~-----------------  447 (740)
                      +|.++|+|||+|+|++||.|+|.++++++|+.+|++||++.+++|+++.|||||++.|++|.+                 
T Consensus       351 fGqLTyvRvYqG~L~kG~~iyN~rtgKKvrv~RL~rmHa~~medV~~v~AG~I~alfGidcasGDTftd~~~~~~~m~si  430 (721)
T KOG0465|consen  351 FGQLTYVRVYQGTLSKGDTIYNVRTGKKVRVGRLVRMHANDMEDVNEVLAGDICALFGIDCASGDTFTDKQNLALSMESI  430 (721)
T ss_pred             ccceEEEEEeeeeecCCcEEEecCCCceeEhHHHhHhcccccchhhhhhccceeeeeccccccCceeccCccccceeeee
Confidence            999999999999999999999999999999999999999999999999999999999998765                 


Q ss_pred             -----EEEEEEEeCCCCChhHHHHHHHHHHHcCCceEEEEcCCCCcEEEEecchhhHHHHHHHHHhhcCceeEEcCceee
Q 004649          448 -----VMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVN  522 (740)
Q Consensus       448 -----v~~~aIep~~~~d~~kl~~aL~kL~~eDpsl~v~~~~etge~il~g~GelHLei~~~rL~~~~~v~v~~~~p~V~  522 (740)
                           |++++|+|.+.+|.++|.+||.++.+|||+|++..|+|++|++|+|||||||||..+||++|||+++.+|+|+|+
T Consensus       431 ~vPePVis~aikP~~k~d~~~fskaL~rf~~EDPtFrv~~d~E~kqTvIsGMGELHLEIy~eRl~rEy~~~~~~Gkp~Va  510 (721)
T KOG0465|consen  431 HIPEPVISVAIKPVNKKDADNFSKALNRFTKEDPTFRVSLDPEMKQTVISGMGELHLEIYVERLVREYKVDAELGKPQVA  510 (721)
T ss_pred             ecCCCeeEEEecccccccHHHHHHHHHhhcccCCceEEEeccccccchhhccchhhHHHHHHHHHHHhCCccccCCceee
Confidence                 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeecccceeeeeeeccCCCCCceEEEEEEEeeCCCCCCCcceeeecccccCCCcchHHHHHHHHHHHHhcCCccCCce
Q 004649          523 FREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPAIEKGFKEAANSGSLIGHPV  602 (740)
Q Consensus       523 yrEti~~~~~~~~~~~~~~gg~~~~~~v~~~~eP~~~~~~~~~~f~~~~~~~~~~~~~~~~i~~g~~~a~~~Gpl~g~pv  602 (740)
                      |||||.+++++.+.||||+||.|||+++...++|++.+....++|.++++|+.+|++|++++++||.++++.|||.|+|+
T Consensus       511 yRETi~~~~~f~~~hKkqSgG~gqy~kv~g~~epl~~~~~~~~eF~~~~~g~~~P~~f~pa~ekg~~e~~~~G~L~ghpl  590 (721)
T KOG0465|consen  511 YRETITSPVEFDYTHKKQSGGAGQYGKVEGVIEPLPPGSNEKFEFSDEIVGGNVPKQFIPAVEKGFEEIVAKGPLIGHPL  590 (721)
T ss_pred             ehhhcCCcccceeeeccccCCCccccceeeEEeecCCCCCceEEEEecccCCCCchhHHHHHHHHHHHHHhcCCccCCcc
Confidence            99999999999999999999999999999999999988777789999999999999999999999999999999999999


Q ss_pred             eeEEEEEEecccccCCCcHHHHHHHHHHHHHHHHHhcCCeeeeceEEEEEEecCcchhhHHHHHhcCCceeeccccCCCe
Q 004649          603 EYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDD  682 (740)
Q Consensus       603 ~~v~v~l~~~~~~~~~s~~~~~~~a~~~a~~~a~~~a~p~LlEPi~~~eI~~p~~~~g~v~~~l~~Rrg~i~~~~~~~~~  682 (740)
                      .|+++.|.||.+|++||++.+|+.|++.||++|+.+|+|+||||||+|+|++|+|++|.|+++|++|+|.|.+.+..++.
T Consensus       591 ~~~r~~l~Dga~h~vds~elaf~~at~~a~r~a~~~a~p~iLEPIM~Vevt~P~EfqG~Vi~~L~kR~a~I~~~d~~~~~  670 (721)
T KOG0465|consen  591 SNLRIVLQDGAHHPVDSSELAFMKATRNAFREAFKRAPPRILEPIMNVEVTTPEEFQGTVIGDLNKRKAQITGIDSSEDY  670 (721)
T ss_pred             cceEEEEecCCcCcccccHHHHHHHHHHHHHHHHHhCCcceeecceeeEEecchhhhhhhhhhhhhcccEEecccCCCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEechhhhcChHHHHhcccCCceEEEEEeCceecCChhHHHHHHHHh
Q 004649          683 SVITAHVPLNNMFGYSTALRSMTQGKGEFTMEYKEHAPVSQDVQLQLVKTH  733 (740)
Q Consensus       683 ~~i~a~vP~~e~~gy~~~Lrs~T~G~~~~~~~f~~y~~v~~~~~~~~~~~~  733 (740)
                      ++|.|.+||++||||+++|||+|+|+|.|+|+|++|+|+|.+.|++++.++
T Consensus       671 ~ti~A~VPL~~mfgYss~LRslTqGkgeftMEys~y~p~~~~vq~~~~~~~  721 (721)
T KOG0465|consen  671 KTIKAEVPLNEMFGYSSELRSLTQGKGEFTMEYSRYSPVPPDVQDQLVHKY  721 (721)
T ss_pred             EEEEecccHHHHhhhhhhhhhhhcCcceEEEeecccCCCchHHHHHhhccC
Confidence            999999999999999999999999999999999999999999999998653

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01680 EFG_like_IV Elongation Factor G-like domain IV Back     alignment and domain information
>cd01693 mtEFG2_like_IV mtEF-G2 domain IV Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01514 Elongation_Factor_C Elongation factor G C-terminus Back     alignment and domain information
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00257 IMPACT_YIGZ uncharacterized protein, YigZ family Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PRK11568 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query740
1ktv_A691 Crystal Structure Of Elongation Factor G Dimer With 1e-174
1efg_A691 The Crystal Structure Of Elongation Factor G Comple 1e-174
2bm0_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 1e-174
2j7k_A691 Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com 1e-173
2bm1_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 1e-173
1fnm_A691 Structure Of Thermus Thermophilus Ef-G H573a Length 1e-173
3izp_E688 Conformation Of Ef-G During Translocation Length = 1e-173
2bv3_A691 Crystal Structure Of A Mutant Elongation Factor G T 1e-170
2rdo_7704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 1e-163
3j0e_H702 Models For The T. Thermophilus Ribosome Recycling F 1e-162
1zn0_B655 Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map 1e-161
2xex_A693 Crystal Structure Of Staphylococcus Aureus Elongati 1e-158
3zz0_A693 Crystal Structure Of Ribosomal Elongation Factor (E 1e-158
3zzt_A693 Crystal Structure Of Staphylococcus Aureus Elongati 1e-157
3zzu_A693 Crystal Structure Of Staphylococcus Aureus Elongati 1e-157
4fn5_A709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 1e-150
1wdt_A665 Crystal Structure Of Ttk003000868 From Thermus Ther 1e-86
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 8e-51
3tr5_A528 Structure Of A Peptide Chain Release Factor 3 (Prfc 6e-41
2h5e_A529 Crystal Structure Of E.Coli Polypeptide Release Fac 5e-40
3uoq_W534 Crystal Structure Of Release Factor Rf3 Trapped In 5e-40
3vqt_A548 Crystal Structure Analysis Of The Translation Facto 6e-37
3cb4_D599 The Crystal Structure Of Lepa Length = 599 9e-24
3cb4_D599 The Crystal Structure Of Lepa Length = 599 5e-04
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 1e-23
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 5e-04
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 7e-22
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 1e-04
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 8e-22
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 2e-06
1n0v_C842 Crystal Structure Of Elongation Factor 2 Length = 8 1e-20
1u2r_A842 Crystal Structure Of Adp-Ribosylated Ribosomal Tran 1e-20
1jqs_C68 Fitting Of L11 Protein And Elongation Factor G (Dom 2e-13
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 3e-10
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 3e-10
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 7e-10
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 8e-10
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 1e-09
2lkc_A178 Free B.St If2-G2 Length = 178 2e-09
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 3e-09
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 3e-09
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 3e-09
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 3e-09
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 3e-09
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 3e-09
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 2e-08
4ac9_A482 Crystal Structure Of Translation Elongation Factor 3e-08
3vmf_A440 Archaeal Protein Length = 440 3e-08
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 3e-08
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 5e-08
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 6e-08
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 6e-08
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 6e-08
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 6e-08
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 6e-08
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 7e-08
3izy_P537 Mammalian Mitochondrial Translation Initiation Fact 2e-07
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 4e-07
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 1e-06
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 2e-06
1zun_B434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 2e-06
3mca_A592 Structure Of The Dom34-Hbs1 Complex And Implication 2e-06
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 3e-06
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 1e-05
3izq_1611 Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To 1e-05
2d74_A419 Crystal Structure Of Translation Initiation Factor 1e-05
3p26_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap 2e-05
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 2e-05
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 2e-05
3p27_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd 5e-05
1zo1_I501 If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col 9e-05
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 1e-04
1s0u_A408 Eif2gamma Apo Length = 408 3e-04
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 4e-04
>pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 Back     alignment and structure 
Iteration: 1

 Score =  608 bits (1568), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 320/688 (46%), Positives = 448/688 (65%), Gaps = 32/688 (4%)
Query: 69  MERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITI 128
           ++RLRNIGI+AHID+GKTT TERIL+YTGRIH+I EV   +G  A MD M+ ERE+GITI
Sbjct: 9   LKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVH--EG-AATMDFMEQERERGITI 65
Query: 129 QSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQM 188
            +A T+C WKD++INIIDTPGHVDFT+EVER++RVLDGAI+V  S  GV+ QS TV RQ 
Sbjct: 66  TAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQA 125
Query: 189 RRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTA 248
            +Y+VPR+AF NK+D+ GAD W V+   + +L      +Q+P+G ED F G++D++++ A
Sbjct: 126 EKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKA 185
Query: 249 YYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEA 308
           Y +    G  I    +P +      E   +L+E+ ++ D+ +   +L  E  +  +L  A
Sbjct: 186 YTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAA 245
Query: 309 IRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNYALDQKNNEEKVI-LSG 367
           IR+ T+  K  PVF+GSA KNKGVQ LLD V+ YLP P ++    +     E +V+ +  
Sbjct: 246 IRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIP--PIKGTTPEGEVVEIHP 303
Query: 368 NPDGPLVALAFKLEEGRF-GQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHSNEM 426
           +P+GPL ALAFK+    + G+LT++R+Y G +  G ++ N   G+K +V RL+RMH+N  
Sbjct: 304 DPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHR 363
Query: 427 EDIQEAHAGQIVAVFGVDCA-----------------------SVMSLAVQPVSKDSGGQ 463
           E+++E  AG + AV G+                           V+ +A++P +K    +
Sbjct: 364 EEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKADQEK 423
Query: 464 FSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRVNF 523
            S+AL R  +EDPTFRV    E+GQTIISGMGELHL+I V+R++RE+KVDA VGKP+V +
Sbjct: 424 LSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQVAY 483
Query: 524 REAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFIPA 583
           RE +TK  + +    +Q+GG+GQYG V   +EPLP GS   FEF N +VG  IP  +IPA
Sbjct: 484 RETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGS--GFEFVNAIVGGVIPKEYIPA 541
Query: 584 IEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKPVI 643
           ++KG +EA  SG LIG PV  ++V L DG+ H VDSSE+AFK+A   A ++      PVI
Sbjct: 542 VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVI 601
Query: 644 LEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTALRS 703
           LEP+M VE+  P E+ G V GD+N R+G I+G +  G+  VI A VPL  MFGY+T LRS
Sbjct: 602 LEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRS 661
Query: 704 MTQGKGEFTMEYKEHAPVSQDVQLQLVK 731
            TQG+G F M +  +  V + VQ +L+K
Sbjct: 662 KTQGRGSFVMFFDHYQEVPKQVQEKLIK 689
>pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 Back     alignment and structure
>pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 Back     alignment and structure
>pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 Back     alignment and structure
>pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 Back     alignment and structure
>pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 Back     alignment and structure
>pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|1ZN0|B Chain B, Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map Of The 50s Subunit Bound With Both Ef-G (Gdpnp) And Rrf Length = 655 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure
>pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 Back     alignment and structure
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure
>pdb|1WDT|A Chain A, Crystal Structure Of Ttk003000868 From Thermus Thermophilus Hb8 Length = 665 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 Back     alignment and structure
>pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 Back     alignment and structure
>pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|1N0V|C Chain C, Crystal Structure Of Elongation Factor 2 Length = 842 Back     alignment and structure
>pdb|1U2R|A Chain A, Crystal Structure Of Adp-Ribosylated Ribosomal Translocase From Saccharomyces Cerevisiae Length = 842 Back     alignment and structure
>pdb|1JQS|C Chain C, Fitting Of L11 Protein And Elongation Factor G (Domain G' And V) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G And Gmppcp, A Nonhydrolysable Gtp Analog Length = 68 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure
>pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure
>pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|3IZQ|1 Chain 1, Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To A Translating Ribosome Length = 611 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|3P26|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Apo-Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|3P27|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gdp-Bound Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query740
2xex_A693 Elongation factor G; GTPase, translation, biosynth 0.0
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 0.0
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 0.0
2dy1_A665 Elongation factor G; translocation, GTP complex, s 0.0
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 1e-141
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 8e-56
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 1e-55
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 4e-32
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 3e-06
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 5e-32
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 1e-06
1f60_A458 Elongation factor EEF1A; protein-protein complex, 5e-17
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 1e-14
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 2e-14
1wb1_A482 Translation elongation factor SELB; selenocysteine 5e-13
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 6e-11
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 8e-11
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 9e-11
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 2e-10
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 8e-09
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 2e-08
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 8e-08
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 1e-07
3e3x_A 332 BIPA; MCSG,PSI2, structural genomics, protein stru 8e-05
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 5e-04
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 5e-04
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
 Score =  911 bits (2358), Expect = 0.0
 Identities = 299/690 (43%), Positives = 438/690 (63%), Gaps = 29/690 (4%)

Query: 66  KESMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKG 125
           + S+E+ RNIGI AHID+GKTT TERIL+YTGRIH+I E    +G  ++MD M+ E+++G
Sbjct: 4   EFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETH--EG-ASQMDWMEQEQDRG 60

Query: 126 ITIQSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVD 185
           ITI SAAT+ AW+ +++NIIDTPGHVDFTVEVER+LRVLDGA+ VL +  GV+ Q+ TV 
Sbjct: 61  ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW 120

Query: 186 RQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQ 245
           RQ   Y VPR+ F+NK+D++GA+    +     +L+ + A +Q+P+G ED+F+ ++DLV+
Sbjct: 121 RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE 180

Query: 246 LTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDL 305
           +  + +    G +I   E+P D      E R  LIE V+E  D+L + +L DE IS  +L
Sbjct: 181 MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL 240

Query: 306 EEAIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPCPTEVSNY-ALDQKNNEEKVI 364
           +EAIR+AT   +F PV  G+AFKNKGVQ +LD V+ YLP P +V         N EE+VI
Sbjct: 241 KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI 300

Query: 365 LSGNPDGPLVALAFKLEEGRF-GQLTYLRIYEGVIRKGDFIINVNTGKKIKVPRLVRMHS 423
              +      ALAFK+    + G+LT+ R+Y G +  G ++ N   GK+ +V RL++MH+
Sbjct: 301 AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA 360

Query: 424 NEMEDIQEAHAGQIVAVFGV------D--CAS--------------VMSLAVQPVSKDSG 461
           N  ++I   ++G I A  G+      D  C                V+ L+V+P SK   
Sbjct: 361 NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ 420

Query: 462 GQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGELHLDIYVERIRREYKVDATVGKPRV 521
            + ++AL + Q+EDPTF    D E+GQ II GMGELHLDI V+R+++E+ V+  VG P V
Sbjct: 421 DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV 480

Query: 522 NFREAVTKRAEFDYLHKKQSGGQGQYGRVIGYIEPLPLGSPAKFEFENLLVGQAIPSNFI 581
           ++RE     A+      +QSGG+GQYG V     P   G+   FEFEN +VG  +P  +I
Sbjct: 481 SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAG--FEFENAIVGGVVPREYI 538

Query: 582 PAIEKGFKEAANSGSLIGHPVEYLRVVLTDGASHAVDSSELAFKMAAIYAFRQCYAAAKP 641
           P++E G K+A  +G L G+P+  ++  L DG+ H VDSSE+AFK+AA  A ++      P
Sbjct: 539 PSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDP 598

Query: 642 VILEPVMLVELKVPTEFQGSVAGDINKRKGMIVGNDQEGDDSVITAHVPLNNMFGYSTAL 701
           VILEP+M V +++P E+ G + GD+  R+G + G +  G+  V+ A+VPL+ MFGY+T+L
Sbjct: 599 VILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSL 658

Query: 702 RSMTQGKGEFTMEYKEHAPVSQDVQLQLVK 731
           RS TQG+G +TM +  +A V + +   ++K
Sbjct: 659 RSNTQGRGTYTMYFDHYAEVPKSIAEDIIK 688
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Length = 332 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 740
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 3e-94
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 3e-66
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 5e-45
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 1e-44
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 4e-42
d2bv3a3121 d.14.1.1 (A:479-599) Elongation factor G (EF-G), d 1e-35
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 8e-34
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 6e-32
d2bv3a589 d.58.11.1 (A:600-688) Elongation factor G (EF-G) { 5e-29
d2dy1a3115 d.14.1.1 (A:455-569) Elongation factor G (EF-G), d 9e-29
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 1e-26
d2dy1a596 d.58.11.1 (A:570-665) Elongation factor G (EF-G) { 7e-26
d2bv3a475 d.58.11.1 (A:404-478) Elongation factor G (EF-G) { 1e-24
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 2e-20
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 3e-20
d1n0ua5117 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) 7e-20
d1n0ua3165 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), 2e-18
d2dy1a477 d.58.11.1 (A:378-454) Elongation factor G (EF-G) { 1e-17
d1n0ua479 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) 3e-17
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 1e-16
d2bv3a1121 b.43.3.1 (A:283-403) Elongation factor G (EF-G), d 7e-16
d1n0ua1138 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), 3e-13
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 7e-13
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 1e-12
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 8e-12
d2dy1a1103 b.43.3.1 (A:275-377) Elongation factor G (EF-G), d 2e-11
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-05
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 9e-04
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 0.002
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 0.003
d1r5ba195 b.43.3.1 (A:460-554) Eukaryotic peptide chain rele 0.003
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 0.003
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 0.004
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

 Score =  292 bits (748), Expect = 3e-94
 Identities = 138/276 (50%), Positives = 189/276 (68%), Gaps = 3/276 (1%)

Query: 69  MERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITI 128
           ++RLRNIGI+AHID+GKTT TERIL+YTGRIH+I EV       A MD M+ ERE+GITI
Sbjct: 3   LKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEG---AATMDFMEQERERGITI 59

Query: 129 QSAATSCAWKDYQINIIDTPGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQM 188
            +A T+C WKD++INIID PGHVDFT+EVER++RVLDGAI+V  S  GV+ QS TV RQ 
Sbjct: 60  TAAVTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQA 119

Query: 189 RRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAVQVPMGLEDQFQGLVDLVQLTA 248
            +Y+VPR+AF NK+D+ GAD W V+   + +L      +Q+P+G ED F G++D++++ A
Sbjct: 120 EKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKA 179

Query: 249 YYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEEA 308
           Y +    G  I    +P +      E   +L+E+ ++ D+ +   +L  E  +  +L  A
Sbjct: 180 YTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVAA 239

Query: 309 IRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLP 344
           IR+ T+  K  PVF+GSA KNKGVQ LLD V+ YLP
Sbjct: 240 IRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLP 275
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Length = 121 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 115 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 75 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 77 Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Length = 121 Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 138 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 103 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query740
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 100.0
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 100.0
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 100.0
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 100.0
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 100.0
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 100.0
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 100.0
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 100.0
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.97
d2bv3a3121 Elongation factor G (EF-G), domain IV {Thermus the 99.97
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 99.95
d2dy1a596 Elongation factor G (EF-G) {Thermus thermophilus, 99.93
d2bv3a589 Elongation factor G (EF-G) {Thermus thermophilus [ 99.92
d1n0ua3165 Elongation factor 2 (eEF-2), domain IV {Baker's ye 99.91
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.87
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.87
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.83
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.81
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.8
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 99.79
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.78
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.78
d2dy1a477 Elongation factor G (EF-G) {Thermus thermophilus, 99.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.77
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.77
d1n0ua479 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.76
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.76
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.74
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.73
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.73
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.72
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.71
d2bv3a475 Elongation factor G (EF-G) {Thermus thermophilus [ 99.7
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.68
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.67
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.66
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.66
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.65
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.63
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.62
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.62
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.62
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.6
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.6
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.58
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.58
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.57
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.55
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.55
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.54
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.54
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.53
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.49
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.45
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.36
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.35
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.29
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.22
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.19
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.19
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.18
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.83
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.8
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.8
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.69
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 98.64
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.58
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 98.53
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 98.51
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 98.46
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 98.43
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 98.42
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 98.38
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 98.37
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.37
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 98.26
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 98.14
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 98.14
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.09
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 98.07
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 98.05
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.02
d1okkd2207 GTPase domain of the signal recognition particle r 97.96
d1vmaa2213 GTPase domain of the signal recognition particle r 97.95
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 97.94
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.83
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.8
d2qy9a2211 GTPase domain of the signal recognition particle r 97.79
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.73
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.6
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 97.55
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 97.47
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 97.47
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.91
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.83
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 96.83
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.73
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.65
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.22
d1vi7a271 Hypothetical protein YigZ, C-terminal domain {Esch 96.12
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.02
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 95.78
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.62
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.52
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.46
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.96
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.96
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.9
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.78
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.71
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.37
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.28
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.2
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.09
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.02
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.93
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.93
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.86
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.82
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.73
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.7
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.68
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.66
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.96
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.92
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.8
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 92.78
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.71
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.69
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.68
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.67
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.66
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.55
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.4
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.37
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.3
d1t95a373 Hypothetical protein AF0491, C-terminal domain {Ar 92.29
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.15
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.86
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.82
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.77
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.72
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.4
d2awna2232 Maltose transport protein MalK, N-terminal domain 91.35
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.35
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.22
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.17
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.08
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.07
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.07
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.97
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.97
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.62
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.47
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.44
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.06
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.04
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.01
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.5
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.41
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.37
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.33
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.27
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.14
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.12
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.03
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 88.99
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.98
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 88.79
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.39
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 88.39
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.29
d1svma_362 Papillomavirus large T antigen helicase domain {Si 88.16
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.11
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 87.84
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.49
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.45
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.06
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.98
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.93
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.14
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 86.07
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.8
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 85.47
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 84.69
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.41
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.05
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.79
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.58
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 83.19
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 83.05
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.03
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.96
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 82.72
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 82.54
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 82.48
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.32
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 82.27
d1tuea_205 Replication protein E1 helicase domain {Human papi 82.25
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.1
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.03
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 81.98
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.88
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 81.87
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.14
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 80.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.26
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.26
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=0  Score=451.54  Aligned_cols=275  Identities=50%  Similarity=0.822  Sum_probs=269.0

Q ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHCCEEEECEEEEEECCEEEEEEEC
Q ss_conf             13891189999189999679999999981994023431268864321267133444172141015998753957999809
Q 004649           68 SMERLRNIGISAHIDSGKTTLTERILFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATSCAWKDYQINIIDT  147 (740)
Q Consensus        68 ~~~~~rnI~iiG~~d~GKSTL~~~Ll~~~g~i~~~~~~~~~~~~~~~~d~~~~e~~~giTi~~~~~~~~~~~~~~~liDT  147 (740)
                      ..+++|||+|+||+|||||||+++|++.+|.+.+.+.++.+   ++.+|+.++|++||+|+..+...+.|+++++||+||
T Consensus         2 ~~~~iRni~i~gh~~~GKTtL~e~ll~~~g~~~~~g~v~~~---~~~~D~~~~E~~r~~si~~~~~~~~~~~~~~n~iDt   78 (276)
T d2bv3a2           2 DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEG---AATMDFMEQERERGITITAAVTTCFWKDHRINIIDA   78 (276)
T ss_dssp             CGGGEEEEEEEECTTSCHHHHHHHHHHHHTSSCC----------------------CCCCCCCSEEEEEETTEEEEEECC
T ss_pred             CHHHCEEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCEECC---CEEEECCHHHHHCCCCCCCCEEEECCCCEEEEEECC
T ss_conf             73020299999589899899999999964853402336518---469856588875188600112343159838999527


Q ss_pred             CCCCCCHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             99788679999999852979999948986404599999999983999799996578999996889999998725641101
Q 004649          148 PGHVDFTVEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEVPRLAFINKLDRMGADPWKVLDQARSKLRHHCAAV  227 (740)
Q Consensus       148 PGh~df~~~~~~~l~~~D~ailVvda~~g~~~qt~~~~~~~~~~~ip~iiviNKiD~~~~~~~~~i~~i~~~l~~~~~~~  227 (740)
                      |||.||..++.++++++|+||+|||+.+|++.||+.+|+++.++++|+++||||||++++++.++++++++.|+.+++++
T Consensus        79 PG~~dF~~e~~~~l~~~D~avlVvda~~Gv~~~T~~~w~~a~~~~lP~i~fINKmDr~~ad~~~~l~ei~~~l~~~~vp~  158 (276)
T d2bv3a2          79 PGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVM  158 (276)
T ss_dssp             CSSSSCSTTHHHHHHHCCEEEEEEETTTSSCHHHHHHHHHHHTTTCCEEEEEECTTSTTCCHHHHHHHHHHTTCCCEEEC
T ss_pred             CCHHHHHHHHHHHHHHHHHEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             86022699999999963005773225677446699999999985999799986445654312126899999859971789


Q ss_pred             ECCCCCCCCCCEEEECEEEEEEEEECCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHH
Q ss_conf             01489778610247610014689708999858933894218999999999999999428958885461389999668999
Q 004649          228 QVPMGLEDQFQGLVDLVQLTAYYFHGSNGEKIVTGEVPADMETFVAEKRRELIELVSEVDDKLGDMFLSDEPISSGDLEE  307 (740)
Q Consensus       228 ~~pi~~~~~~~g~~dl~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~l~e~~~~~d~~l~e~~l~~~~~~~~~l~~  307 (740)
                      |+|++.+.+|.|++|++.+++|.|.+..+..+...++|+++.+.+.+.+.+|+|.+++.||+++++||++..++.+++..
T Consensus       159 ~~Pig~~~~f~GvvDl~~~~a~~~~~~~g~~~~~~~ip~~~~~~~~~~~~~l~e~vae~Dd~L~e~yle~~e~~~eel~~  238 (276)
T d2bv3a2         159 QLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEEELVA  238 (276)
T ss_dssp             EEEESCGGGCCEEEETTTTEEEEESSSSSCCEEEECCCGGGHHHHHHHHHHHHHHHHTTCHHHHHHHHHTCCCCHHHHHH
T ss_pred             EECCCCCCCEEEEEECCCEEEEEECCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHH
T ss_conf             83345787513885056108998558888654002585677777799999876666433678999976679998999999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             99987332341132002457886638899999850999
Q 004649          308 AIRRATVARKFIPVFMGSAFKNKGVQPLLDGVLSYLPC  345 (740)
Q Consensus       308 ~~~~~~~~~~~~Pv~~gSA~~~~Gi~~LL~~i~~~lPs  345 (740)
                      .+++++..++++|||||||+++.||+.|||+|++++||
T Consensus       239 ~l~~a~~~g~i~PV~~GSA~~n~GV~~LLD~i~~~~PS  276 (276)
T d2bv3a2         239 AIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPS  276 (276)
T ss_dssp             HHHHHHHTTSCEEEEECBTTTTBSHHHHHHHHHHHSCC
T ss_pred             HHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             99998865949979973789880989999999985799
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure