Citrus Sinensis ID: 004657
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VXV7 | 844 | Lysine-specific histone d | yes | no | 0.725 | 0.635 | 0.707 | 0.0 | |
| Q9LID0 | 746 | Lysine-specific histone d | no | no | 0.874 | 0.865 | 0.472 | 1e-163 | |
| Q6Z690 | 849 | Lysine-specific histone d | yes | no | 0.610 | 0.531 | 0.590 | 1e-153 | |
| Q9CAE3 | 789 | Lysine-specific histone d | no | no | 0.580 | 0.543 | 0.597 | 1e-151 | |
| Q6YYZ1 | 763 | Lysine-specific histone d | no | no | 0.814 | 0.788 | 0.438 | 1e-141 | |
| Q01H90 | 811 | Lysine-specific histone d | N/A | no | 0.579 | 0.527 | 0.567 | 1e-131 | |
| Q7XUR2 | 811 | Lysine-specific histone d | no | no | 0.579 | 0.527 | 0.565 | 1e-131 | |
| Q8CIG3 | 826 | Lysine-specific histone d | yes | no | 0.591 | 0.529 | 0.330 | 2e-54 | |
| Q8NB78 | 822 | Lysine-specific histone d | yes | no | 0.598 | 0.537 | 0.330 | 1e-53 | |
| Q6ZQ88 | 853 | Lysine-specific histone d | no | no | 0.309 | 0.268 | 0.360 | 1e-48 |
| >sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 754 bits (1946), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 402/568 (70%), Positives = 453/568 (79%), Gaps = 32/568 (5%)
Query: 8 SDNANDDVVSDESSPETDATLSPSQIETQAETDELQNATETNTA--------------LE 53
+D+ N+ VVSD S+ ETD +LSPSQ E E D QN+ + + +E
Sbjct: 36 ADDVNE-VVSDASATETDFSLSPSQSEQNIEEDG-QNSLDDQSPLTELQPLPLPPPLPVE 93
Query: 54 APVSDSLDDSSDP-IPEDQQPQNPNPSEPGPPPRKRRRRKRFFTEINGNPSLARNRRPRF 112
A +S+SL + + +QQ QNPN +EPGP RKRRRRKRFFTEIN NP+ +RNRR
Sbjct: 94 ARISESLGEEESSDLVTEQQSQNPNAAEPGPRARKRRRRKRFFTEINANPAFSRNRR--- 150
Query: 113 SCLAKEVDTEALIAISVGFPVDSLTEEEIEANVVSKIGGTEQANYIVVRNHILSLWRSNV 172
+ + KEVD+EALIA+SVGFPV SLTEEEIEANVVS IGG +QANYIVVRNHI++LWRSNV
Sbjct: 151 TSVGKEVDSEALIAMSVGFPVYSLTEEEIEANVVSIIGGKDQANYIVVRNHIIALWRSNV 210
Query: 173 SVWLTREQALESIRSEHKTLVDSAYDFLLEHGYINFGLAPPIKEVKLGSFGRVERGNVVI 232
S WLTR+ ALESIR+EHKTLVD+AY+FLLEHGYINFGLAP IKE KL SF VE NVV+
Sbjct: 211 SNWLTRDHALESIRAEHKTLVDTAYNFLLEHGYINFGLAPVIKEAKLRSFDGVEPPNVVV 270
Query: 233 VGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKC-DGVVAAADVGGSVLTGIN 291
VGAGLAGLVAARQL+SMGF+V+VLEGR+RPGGRVKTRKMK DGV A ADVGGSVLTGIN
Sbjct: 271 VGAGLAGLVAARQLLSMGFRVLVLEGRDRPGGRVKTRKMKGGDGVEAMADVGGSVLTGIN 330
Query: 292 GNPLGVLARQLELPLHKVRDICPLYLPNGKAIDADIDSGVEVSFNKLLDRVCKLRHDMIE 351
GNPLGVLARQL LPLHKVRDICPLYLPNG+ DA +DS +E SFNKLLDRVCKLR MIE
Sbjct: 331 GNPLGVLARQLGLPLHKVRDICPLYLPNGELADASVDSKIEASFNKLLDRVCKLRQSMIE 390
Query: 352 EFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEYANASLMSNLSMAYWDQDDP 411
E KSVDVPLG ALE FR VY VAED QERMLL+WHLANLEYANA+L+ NLSMAYWDQDDP
Sbjct: 391 ENKSVDVPLGEALETFRLVYGVAEDQQERMLLDWHLANLEYANATLLGNLSMAYWDQDDP 450
Query: 412 YEMGGDHCFIPGGNEWFVRALAEDLPIFYQRTVQSIRYGVDGVMVYAGGQEFRGDMVLCT 471
YEMGGDHCFIPGGNE FV ALAE+LPIFY TV+SIRYG +GV+VY G +EF DM LCT
Sbjct: 451 YEMGGDHCFIPGGNEIFVHALAENLPIFYGSTVESIRYGSNGVLVYTGNKEFHCDMALCT 510
Query: 472 VPLGVLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWGGEIDTFGHLTEDSS 531
VPLGVLKKG+IEF PELP +KK+AIQRLG+GLLNKVAMLFP NFWG EIDTFG LTED S
Sbjct: 511 VPLGVLKKGSIEFYPELPHKKKEAIQRLGFGLLNKVAMLFPCNFWGEEIDTFGRLTEDPS 570
Query: 532 MRDPVQAICTRWGKDRFSYGSYSYVAVG 559
R + F + SYS V+ G
Sbjct: 571 TR-----------GEFFLFYSYSSVSGG 587
|
Probable histone demethylase that reduces the levels of histone H3 'Lys-4' methylation in chromatin of the floral repressor FLOWERING LOCUS C (FLC) and the sporophytically silenced floral repressor FWA. Seems to act in partial redundancy with FLOWERING LOCUS D (FLD) to repress FLC expression. Required for cytosine methylation of FWA. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: -EC: .EC: -EC: .EC: - |
| >sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | ||||||
| 255577866 | 793 | Flavin-containing amine oxidase domain-c | 0.979 | 0.912 | 0.701 | 0.0 | |
| 224061919 | 795 | predicted protein [Populus trichocarpa] | 0.989 | 0.919 | 0.709 | 0.0 | |
| 356529585 | 1388 | PREDICTED: lysine-specific histone demet | 0.939 | 0.5 | 0.649 | 0.0 | |
| 356522749 | 1336 | PREDICTED: lysine-specific histone demet | 0.895 | 0.495 | 0.588 | 0.0 | |
| 225465741 | 677 | PREDICTED: lysine-specific histone demet | 0.821 | 0.896 | 0.643 | 0.0 | |
| 297837137 | 840 | amine oxidase family protein [Arabidopsi | 0.718 | 0.632 | 0.712 | 0.0 | |
| 296087464 | 669 | unnamed protein product [Vitis vinifera] | 0.756 | 0.835 | 0.615 | 0.0 | |
| 15221606 | 844 | Lysine-specific histone demethylase 1-1 | 0.725 | 0.635 | 0.707 | 0.0 | |
| 6630454 | 1794 | F23N19.18 [Arabidopsis thaliana] | 0.725 | 0.298 | 0.707 | 0.0 | |
| 302760201 | 721 | hypothetical protein SELMODRAFT_79938 [S | 0.841 | 0.862 | 0.516 | 0.0 |
| >gi|255577866|ref|XP_002529806.1| Flavin-containing amine oxidase domain-containing protein, putative [Ricinus communis] gi|223530717|gb|EEF32588.1| Flavin-containing amine oxidase domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1076 bits (2783), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 560/798 (70%), Positives = 633/798 (79%), Gaps = 74/798 (9%)
Query: 2 ETPQEPSDNANDDVVSDESSPETDATLSPSQIETQAETDELQNATET-----NTALEAPV 56
ET + P DN N+ V+S+ESSPETD TLSP+Q ET T++ QN+ ET NT L+APV
Sbjct: 4 ETAEPPPDNLNN-VISEESSPETDLTLSPTQRETHI-TNDPQNSPETQSPPPNTTLDAPV 61
Query: 57 SDSLDDSSDPIPEDQQPQNPNPSEPGPPPRKRRRRKR-FFTEINGNPSLARNRRPRFSCL 115
SDS +D S +QP NPN ++ PP K+RRR++ FFTEIN NPS R+R L
Sbjct: 62 SDSQEDDSS-----EQPLNPNSTDAAAPPPKKRRRRKRFFTEINANPSFRRHRVA--GGL 114
Query: 116 AKEVDTEALIAISVGFPVDSLTEEEIEANVVSKIGGTEQANYIVVRNHILSLWRSNVSVW 175
AKEVD EALIAISVGFPVDSL+EEEIEANVVS IGGTEQ+NYIVVRNHIL+ WR NVS+W
Sbjct: 115 AKEVDVEALIAISVGFPVDSLSEEEIEANVVSTIGGTEQSNYIVVRNHILARWRWNVSIW 174
Query: 176 LTREQALESIRSEHKTLVDSAYDFLLEHGYINFGLAPPIKEVKLGSFGRVERGNVVIVGA 235
LTRE ALESIR+EHK LVDSAYDFLLEHGYINFG+APPIKE ++G RV++ N+V+VGA
Sbjct: 175 LTREHALESIRAEHKNLVDSAYDFLLEHGYINFGVAPPIKEAQMGRCERVQKANIVVVGA 234
Query: 236 GLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVLTGINGNPL 295
GLAGLVAARQL+ MGFKVVVLEGR R GGRVKT KMK DGVVAAAD+GGSVLTGINGNPL
Sbjct: 235 GLAGLVAARQLVGMGFKVVVLEGRARAGGRVKTMKMKGDGVVAAADLGGSVLTGINGNPL 294
Query: 296 GVLARQLELPLHKVRDICPLYLPNGKAIDADIDSGVEVSFNKLLDRVCKLRHDMIEEFKS 355
GVLARQL LPLHKVRDICPLYLP+GKA+D +IDS VEVSFNKLLDRVCKLR MIEE KS
Sbjct: 295 GVLARQLSLPLHKVRDICPLYLPDGKAVDKEIDSSVEVSFNKLLDRVCKLRQAMIEEVKS 354
Query: 356 VDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEYANASLMSNLSMAYWDQDDPYEMG 415
VDV LG ALEAFR+ +KVAED ERMLLNWHLANLEYANASLMSNLSMAYWDQDDPYEMG
Sbjct: 355 VDVNLGTALEAFRHAHKVAEDPIERMLLNWHLANLEYANASLMSNLSMAYWDQDDPYEMG 414
Query: 416 GDHCFIPGGNEWFVRALAEDLPIFYQRTVQSIRYGVDGVMVYAGGQEFRGDMVLCTVPLG 475
GDHCFIPGGN+ FVR LA+DLPIFY+RTV+SIRYGVDG++VYA GQEF GDMVLCTVPLG
Sbjct: 415 GDHCFIPGGNDTFVRELAKDLPIFYERTVESIRYGVDGIIVYASGQEFHGDMVLCTVPLG 474
Query: 476 VLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWGGEIDTFGHLTEDSSMR-- 533
VLKKG+IEF PELPQRKKDAIQRLGYGLLNKVA+LFP+NFWGGEIDTFGHLTEDSSMR
Sbjct: 475 VLKKGSIEFFPELPQRKKDAIQRLGYGLLNKVALLFPYNFWGGEIDTFGHLTEDSSMRGE 534
Query: 534 -------------------------------DPVQAI----------------------- 539
PV+++
Sbjct: 535 FFLFYSYSSVSGGPLLIALVAGEAAVKFETKSPVESVRRVLQILRGIFHPKGIAVPDPVQ 594
Query: 540 --CTRWGKDRFSYGSYSYVAVGSSGDDYDILAETVGDGRVFFAGEATNKQYPATMHGAFL 597
CTRWGKD F+YGSYSYVAVGSSGDDYDILAE+VGDGRVFFAGEATNKQYPATMHGAFL
Sbjct: 595 AVCTRWGKDCFTYGSYSYVAVGSSGDDYDILAESVGDGRVFFAGEATNKQYPATMHGAFL 654
Query: 598 SGMREAASILRVAKRRSLALTNKAYNESEDNGNLDKLFETPDLTFGSFSALFDPKSIDLE 657
SGMREAA+ILR AK+RSLALT+K N+ E++ +L KLF+ PDLTFGSFS LFDP++ DLE
Sbjct: 655 SGMREAANILREAKKRSLALTDKVNNDVEED-DLTKLFDIPDLTFGSFSILFDPRTNDLE 713
Query: 658 SDALLRVKFQGENFDSGHLCLYGLVTRKQAVQLRELDGDGNRMKMLHDNFRVKLVARRGV 717
S +LLRVKFQG DS LCLYGL++RKQA++L ELD DG R+K L+ +F+VKLV R+G+
Sbjct: 714 SLSLLRVKFQGPKLDSCFLCLYGLLSRKQAIELCELDDDGKRLKTLYLSFQVKLVGRKGL 773
Query: 718 CNATESLITRIKATRFSL 735
+ + LI IK R L
Sbjct: 774 SHVGDDLIAHIKEARARL 791
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224061919|ref|XP_002300664.1| predicted protein [Populus trichocarpa] gi|222842390|gb|EEE79937.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356529585|ref|XP_003533370.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356522749|ref|XP_003530008.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225465741|ref|XP_002265069.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297837137|ref|XP_002886450.1| amine oxidase family protein [Arabidopsis lyrata subsp. lyrata] gi|297332291|gb|EFH62709.1| amine oxidase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296087464|emb|CBI34053.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15221606|ref|NP_176471.1| Lysine-specific histone demethylase 1-1 [Arabidopsis thaliana] gi|75161368|sp|Q8VXV7.1|LDL1_ARATH RecName: Full=Lysine-specific histone demethylase 1 homolog 1; AltName: Full=Flavin-containing amine oxidase domain-containing protein 1; AltName: Full=Protein LSD1-LIKE 1 gi|18377829|gb|AAL67101.1| At1g62830/F23N19_19 [Arabidopsis thaliana] gi|23505983|gb|AAN28851.1| At1g62830/F23N19_19 [Arabidopsis thaliana] gi|332195889|gb|AEE34010.1| Lysine-specific histone demethylase 1-1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|6630454|gb|AAF19542.1|AC007190_10 F23N19.18 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|302760201|ref|XP_002963523.1| hypothetical protein SELMODRAFT_79938 [Selaginella moellendorffii] gi|300168791|gb|EFJ35394.1| hypothetical protein SELMODRAFT_79938 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 739 | ||||||
| TAIR|locus:2026187 | 844 | LDL1 "LSD1-like 1" [Arabidopsi | 0.591 | 0.517 | 0.748 | 4.5e-233 | |
| TAIR|locus:2075870 | 789 | FLD "FLOWERING LOCUS D" [Arabi | 0.557 | 0.522 | 0.582 | 1.4e-168 | |
| TAIR|locus:2091501 | 746 | LDL2 "LSD1-like2" [Arabidopsis | 0.557 | 0.552 | 0.565 | 3.4e-154 | |
| FB|FBgn0260397 | 890 | Su(var)3-3 "Suppressor of vari | 0.347 | 0.288 | 0.294 | 2.5e-60 | |
| UNIPROTKB|F1NRA3 | 537 | KDM1B "Uncharacterized protein | 0.496 | 0.683 | 0.323 | 1.7e-57 | |
| UNIPROTKB|E1BRG3 | 617 | KDM1B "Uncharacterized protein | 0.496 | 0.594 | 0.324 | 1e-56 | |
| UNIPROTKB|E1BPZ5 | 820 | KDM1B "Uncharacterized protein | 0.497 | 0.448 | 0.312 | 3.6e-52 | |
| MGI|MGI:2145261 | 826 | Kdm1b "lysine (K)-specific dem | 0.500 | 0.447 | 0.308 | 9.2e-50 | |
| TAIR|locus:2130454 | 1628 | LDL3 "LSD1-like 3" [Arabidopsi | 0.209 | 0.095 | 0.409 | 1.2e-49 | |
| UNIPROTKB|G4MR69 | 1200 | MGG_09915 "Lysine-specific his | 0.208 | 0.128 | 0.390 | 9.6e-40 |
| TAIR|locus:2026187 LDL1 "LSD1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1668 (592.2 bits), Expect = 4.5e-233, Sum P(3) = 4.5e-233
Identities = 330/441 (74%), Positives = 362/441 (82%)
Query: 94 FFTEINGNPSLARNRRPRFSCLAKEVDTEALIAISVGFPVDSLTEEEIEANVVSKIGGTE 153
FFTEIN NP+ +RNRR + + KEVD+EALIA+SVGFPV SLTEEEIEANVVS IGG +
Sbjct: 135 FFTEINANPAFSRNRR---TSVGKEVDSEALIAMSVGFPVYSLTEEEIEANVVSIIGGKD 191
Query: 154 QANYIVVRNHILSLWRSNVSVWLTREQALESIRSEHKTLVDSAYDFLLEHGYINFGLAPP 213
QANYIVVRNHI++LWRSNVS WLTR+ ALESIR+EHKTLVD+AY+FLLEHGYINFGLAP
Sbjct: 192 QANYIVVRNHIIALWRSNVSNWLTRDHALESIRAEHKTLVDTAYNFLLEHGYINFGLAPV 251
Query: 214 IKEVKLGSFGRVERXXXXXXXXXXXXXXXXRQLISMGFKVVVLEGRERPGGRVKTRKMKC 273
IKE KL SF VE RQL+SMGF+V+VLEGR+RPGGRVKTRKMK
Sbjct: 252 IKEAKLRSFDGVEPPNVVVVGAGLAGLVAARQLLSMGFRVLVLEGRDRPGGRVKTRKMKG 311
Query: 274 XXXXXXXXXXX-SVLTGINGNPLGVLARQLELPLHKVRDICPLYLPNGKAIDADIDSGVE 332
SVLTGINGNPLGVLARQL LPLHKVRDICPLYLPNG+ DA +DS +E
Sbjct: 312 GDGVEAMADVGGSVLTGINGNPLGVLARQLGLPLHKVRDICPLYLPNGELADASVDSKIE 371
Query: 333 VSFNKLLDRVCKLRHDMIEEFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEY 392
SFNKLLDRVCKLR MIEE KSVDVPLG ALE FR VY VAED QERMLL+WHLANLEY
Sbjct: 372 ASFNKLLDRVCKLRQSMIEENKSVDVPLGEALETFRLVYGVAEDQQERMLLDWHLANLEY 431
Query: 393 ANASLMSNLSMAYWDQDDPYEMGGDHCFIPGGNEWFVRALAEDLPIFYQRTVQSIRYGVD 452
ANA+L+ NLSMAYWDQDDPYEMGGDHCFIPGGNE FV ALAE+LPIFY TV+SIRYG +
Sbjct: 432 ANATLLGNLSMAYWDQDDPYEMGGDHCFIPGGNEIFVHALAENLPIFYGSTVESIRYGSN 491
Query: 453 GVMVYAGGQEFRGDMVLCTVPLGVLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFP 512
GV+VY G +EF DM LCTVPLGVLKKG+IEF PELP +KK+AIQRLG+GLLNKVAMLFP
Sbjct: 492 GVLVYTGNKEFHCDMALCTVPLGVLKKGSIEFYPELPHKKKEAIQRLGFGLLNKVAMLFP 551
Query: 513 HNFWGGEIDTFGHLTEDSSMR 533
NFWG EIDTFG LTED S R
Sbjct: 552 CNFWGEEIDTFGRLTEDPSTR 572
|
|
| TAIR|locus:2075870 FLD "FLOWERING LOCUS D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260397 Su(var)3-3 "Suppressor of variegation 3-3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRA3 KDM1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BRG3 KDM1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPZ5 KDM1B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2145261 Kdm1b "lysine (K)-specific demethylase 1B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MR69 MGG_09915 "Lysine-specific histone demethylase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8VXV7 | LDL1_ARATH | 1, ., -, ., -, ., - | 0.7077 | 0.7253 | 0.6350 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.4.3.2 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.5.3.17 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.14.99 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.4.3.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 739 | |||
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 0.0 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 0.0 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 0.0 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 1e-101 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 9e-59 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 4e-58 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 5e-52 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 3e-51 | |
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 8e-46 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 9e-32 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 1e-28 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 2e-24 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 9e-23 | |
| pfam04433 | 80 | pfam04433, SWIRM, SWIRM domain | 1e-18 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 3e-16 | |
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 4e-15 | |
| COG1233 | 487 | COG1233, COG1233, Phytoene dehydrogenase and relat | 5e-13 | |
| pfam13450 | 66 | pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- | 2e-12 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-07 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 5e-07 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 5e-07 | |
| COG1232 | 444 | COG1232, HemY, Protoporphyrinogen oxidase [Coenzym | 8e-07 | |
| PRK04176 | 257 | PRK04176, PRK04176, ribulose-1,5-biphosphate synth | 1e-06 | |
| PRK11749 | 457 | PRK11749, PRK11749, dihydropyrimidine dehydrogenas | 3e-06 | |
| COG0446 | 415 | COG0446, HcaD, Uncharacterized NAD(FAD)-dependent | 6e-06 | |
| PRK12810 | 471 | PRK12810, gltD, glutamate synthase subunit beta; R | 9e-06 | |
| PRK09853 | 1019 | PRK09853, PRK09853, putative selenate reductase su | 1e-05 | |
| TIGR02733 | 492 | TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | 1e-05 | |
| COG2072 | 443 | COG2072, TrkA, Predicted flavoprotein involved in | 2e-05 | |
| COG1249 | 454 | COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas | 2e-05 | |
| COG1635 | 262 | COG1635, THI4, Ribulose 1,5-bisphosphate synthetas | 2e-05 | |
| TIGR02734 | 502 | TIGR02734, crtI_fam, phytoene desaturase | 2e-05 | |
| COG3573 | 552 | COG3573, COG3573, Predicted oxidoreductase [Genera | 2e-05 | |
| PLN02576 | 496 | PLN02576, PLN02576, protoporphyrinogen oxidase | 3e-05 | |
| pfam01946 | 229 | pfam01946, Thi4, Thi4 family | 5e-05 | |
| PRK12834 | 549 | PRK12834, PRK12834, putative FAD-binding dehydroge | 6e-05 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 7e-05 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 8e-05 | |
| COG3380 | 331 | COG3380, COG3380, Predicted NAD/FAD-dependent oxid | 8e-05 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 9e-05 | |
| PRK13984 | 604 | PRK13984, PRK13984, putative oxidoreductase; Provi | 9e-05 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 1e-04 | |
| smart01002 | 149 | smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT | 1e-04 | |
| TIGR00292 | 254 | TIGR00292, TIGR00292, thiazole biosynthesis enzyme | 1e-04 | |
| cd05305 | 359 | cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin | 1e-04 | |
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 2e-04 | |
| COG1148 | 622 | COG1148, HdrA, Heterodisulfide reductase, subunit | 3e-04 | |
| PRK12814 | 652 | PRK12814, PRK12814, putative NADPH-dependent gluta | 3e-04 | |
| pfam00890 | 401 | pfam00890, FAD_binding_2, FAD binding domain | 4e-04 | |
| PRK07208 | 479 | PRK07208, PRK07208, hypothetical protein; Provisio | 5e-04 | |
| TIGR01372 | 985 | TIGR01372, soxA, sarcosine oxidase, alpha subunit | 5e-04 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 5e-04 | |
| TIGR03997 | 645 | TIGR03997, mycofact_OYE_2, mycofactocin system Fad | 6e-04 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 7e-04 | |
| TIGR02730 | 493 | TIGR02730, carot_isom, carotene isomerase | 7e-04 | |
| pfam01262 | 150 | pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, | 8e-04 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 0.001 | |
| COG0562 | 374 | COG0562, Glf, UDP-galactopyranose mutase [Cell env | 0.001 | |
| COG0686 | 371 | COG0686, Ald, Alanine dehydrogenase [Amino acid tr | 0.001 | |
| TIGR00518 | 370 | TIGR00518, alaDH, alanine dehydrogenase | 0.001 | |
| PLN02172 | 461 | PLN02172, PLN02172, flavin-containing monooxygenas | 0.002 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 0.002 | |
| TIGR00275 | 400 | TIGR00275, TIGR00275, flavoprotein, HI0933 family | 0.003 | |
| TIGR01317 | 485 | TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH | 0.003 | |
| COG1053 | 562 | COG1053, SdhA, Succinate dehydrogenase/fumarate re | 0.003 | |
| TIGR02732 | 474 | TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot | 0.003 | |
| PRK01747 | 662 | PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- | 0.004 | |
| TIGR02032 | 295 | TIGR02032, GG-red-SF, geranylgeranyl reductase fam | 0.004 | |
| TIGR01316 | 449 | TIGR01316, gltA, glutamate synthase (NADPH), homot | 0.004 |
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
Score = 957 bits (2474), Expect = 0.0
Identities = 444/592 (75%), Positives = 483/592 (81%), Gaps = 37/592 (6%)
Query: 2 ETPQEPSDNANDDVVSDESSPETDATLSPSQIETQAETDELQNATET------------- 48
+ P++P+DN ND VVS+ SSPETD +LSPSQ E E D QN+ ET
Sbjct: 6 KEPEDPADNVND-VVSEASSPETDLSLSPSQSEQNIENDG-QNSPETQSPLTELQPSPLP 63
Query: 49 -NTALEAPVSDSLDDSSDPIPEDQQPQNPNPSEPGPPPRKRRRRKRFFTEINGNPSLARN 107
NT L+APVSDS D S QQPQNPN +EP PPP+KRRRRKRFFTEIN NP+ R+
Sbjct: 64 PNTTLDAPVSDSQGDESSSE---QQPQNPNSTEPAPPPKKRRRRKRFFTEINANPAFRRH 120
Query: 108 RRPRFSCLAKEVDTEALIAISVGFPVDSLTEEEIEANVVSKIGGTEQANYIVVRNHILSL 167
R L KEVD EALIAISVGFPVDSLTEEEIEANVVS IGGTEQANYIVVRNHIL+
Sbjct: 121 RVR--GGLGKEVDVEALIAISVGFPVDSLTEEEIEANVVSTIGGTEQANYIVVRNHILAR 178
Query: 168 WRSNVSVWLTREQALESIRSEHKTLVDSAYDFLLEHGYINFGLAPPIKEVKLGSFGRVER 227
WRSNVS WLTR+ ALESIR+EHK LVDSAY+FLLEHGYINFG+AP IKE +L SF VE
Sbjct: 179 WRSNVSNWLTRDHALESIRAEHKNLVDSAYNFLLEHGYINFGVAPVIKEAQLRSFEGVEP 238
Query: 228 GNVVIVGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVL 287
NVV+VGAGLAGLVAARQL+SMGFKVVVLEGR RPGGRVKT KMK DGVVAAAD+GGSVL
Sbjct: 239 ANVVVVGAGLAGLVAARQLLSMGFKVVVLEGRARPGGRVKTMKMKGDGVVAAADLGGSVL 298
Query: 288 TGINGNPLGVLARQLELPLHKVRDICPLYLPNGKAIDADIDSGVEVSFNKLLDRVCKLRH 347
TGINGNPLGVLARQL LPLHKVRDICPLYLP+GKA+DA+IDS +E SFNKLLDRVCKLR
Sbjct: 299 TGINGNPLGVLARQLGLPLHKVRDICPLYLPDGKAVDAEIDSKIEASFNKLLDRVCKLRQ 358
Query: 348 DMIEEFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEYANASLMSNLSMAYWD 407
MIEE KSVDV LG ALEAFR+VYKVAED QERMLLNWHLANLEYANASLMSNLSMAYWD
Sbjct: 359 AMIEEVKSVDVNLGTALEAFRHVYKVAEDPQERMLLNWHLANLEYANASLMSNLSMAYWD 418
Query: 408 QDDPYEMGGDHCFIPGGNEWFVRALAEDLPIFYQRTVQSIRYGVDGVMVYAGGQEFRGDM 467
QDDPYEMGGDHCFIPGGN+ FVR LA+DLPIFY+RTV+SIRYGVDGV+VYAGGQEF GDM
Sbjct: 419 QDDPYEMGGDHCFIPGGNDTFVRELAKDLPIFYERTVESIRYGVDGVIVYAGGQEFHGDM 478
Query: 468 VLCTVPLGVLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWGGEIDTFGHLT 527
VLCTVPLGVLKKG+IEF PELPQRKKDAIQRLGYGLLNKVA+LFP+NFWGGEIDTFGHLT
Sbjct: 479 VLCTVPLGVLKKGSIEFYPELPQRKKDAIQRLGYGLLNKVALLFPYNFWGGEIDTFGHLT 538
Query: 528 EDSSMRDPVQAICTRWGKDRFSYGSYSYVAVGSSGDDYDILAETVGDGRVFF 579
ED SMR + F + SYS V+ G ++A GD V F
Sbjct: 539 EDPSMRG-----------EFFLFYSYSSVSGGPL-----LIALVAGDAAVKF 574
|
Length = 808 |
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|203011 pfam04433, SWIRM, SWIRM domain | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|145231 pfam01946, Thi4, Thi4 family | Back alignment and domain information |
|---|
| >gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223758 COG0686, Ald, Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|129609 TIGR00518, alaDH, alanine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 739 | |||
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 100.0 | |
| PLN03000 | 881 | amine oxidase | 100.0 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 100.0 | |
| PLN02976 | 1713 | amine oxidase | 100.0 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 100.0 | |
| PLN02268 | 435 | probable polyamine oxidase | 100.0 | |
| PLN02568 | 539 | polyamine oxidase | 100.0 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 100.0 | |
| PLN02676 | 487 | polyamine oxidase | 100.0 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 100.0 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 100.0 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.97 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.97 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.97 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.96 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.96 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.95 | |
| PLN02612 | 567 | phytoene desaturase | 99.95 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.94 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.93 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.93 | |
| PLN02487 | 569 | zeta-carotene desaturase | 99.93 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.91 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.9 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.87 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.86 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.83 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.82 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.81 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.75 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.72 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 99.72 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 99.68 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 99.66 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 99.66 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 99.66 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 99.63 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 99.61 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 99.6 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 99.59 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 99.54 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 99.54 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 99.49 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 99.41 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.41 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 99.33 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.27 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 99.27 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 99.23 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 99.21 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 99.14 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 99.14 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 99.13 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.11 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 99.1 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 99.1 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 99.08 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 99.04 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 99.01 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 98.99 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 98.98 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 98.95 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 98.94 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 98.92 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.91 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 98.9 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 98.89 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.89 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 98.87 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 98.85 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 98.82 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 98.8 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 98.75 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 98.75 | |
| PLN02661 | 357 | Putative thiazole synthesis | 98.74 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.71 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 98.71 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 98.7 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 98.68 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 98.68 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 98.68 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 98.67 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 98.66 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 98.66 | |
| PRK05868 | 372 | hypothetical protein; Validated | 98.66 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 98.65 | |
| PF04433 | 86 | SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM | 98.65 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 98.62 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.59 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 98.57 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 98.57 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 98.54 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 98.53 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 98.53 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 98.52 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.52 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.51 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 98.51 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 98.49 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 98.49 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 98.49 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 98.49 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 98.48 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 98.48 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.47 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 98.47 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 98.46 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 98.44 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 98.43 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.41 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 98.41 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 98.41 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.41 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 98.41 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 98.39 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 98.38 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.38 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 98.37 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 98.37 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 98.37 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 98.36 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 98.36 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 98.36 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.35 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.35 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 98.31 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 98.3 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.29 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 98.28 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 98.27 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 98.26 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 98.25 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 98.24 | |
| PRK07121 | 492 | hypothetical protein; Validated | 98.22 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.21 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 98.2 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 98.2 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 98.19 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 98.14 | |
| PLN02463 | 447 | lycopene beta cyclase | 98.13 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 98.11 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 98.11 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.1 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.09 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 98.08 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 98.07 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 98.06 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 98.05 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 98.03 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 98.03 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 98.03 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.03 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 98.02 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 98.0 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 97.98 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 97.97 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 97.95 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 97.9 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 97.9 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 97.89 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 97.89 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 97.88 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 97.84 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 97.84 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.82 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 97.82 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 97.81 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 97.8 | |
| PLN02985 | 514 | squalene monooxygenase | 97.79 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 97.79 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 97.78 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 97.78 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.78 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 97.76 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 97.76 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 97.74 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 97.73 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 97.73 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 97.73 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 97.73 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 97.72 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.72 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 97.72 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 97.72 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 97.7 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.7 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.7 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.69 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 97.69 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 97.69 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.68 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.68 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 97.67 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 97.66 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.64 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 97.63 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 97.63 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 97.63 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.62 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.6 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.6 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 97.59 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.59 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 97.58 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 97.58 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.57 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 97.57 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 97.57 | |
| PLN02507 | 499 | glutathione reductase | 97.56 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.56 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 97.55 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.55 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 97.55 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.54 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 97.53 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.52 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.5 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 97.49 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.48 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 97.48 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.47 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.46 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.46 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 97.46 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.45 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 97.43 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 97.43 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 97.43 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 97.42 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 97.42 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 97.42 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 97.42 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.41 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 97.41 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 97.4 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 97.4 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.39 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 97.35 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.32 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.31 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.31 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 97.31 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 97.3 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.3 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.27 | |
| PLN02507 | 499 | glutathione reductase | 97.25 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 97.25 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 97.25 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.23 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 97.23 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.21 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.2 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 97.2 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 97.17 | |
| PLN02815 | 594 | L-aspartate oxidase | 97.16 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.15 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.15 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.15 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 97.15 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.14 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.14 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 97.13 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.13 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 97.12 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 97.12 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 97.11 | |
| PLN02546 | 558 | glutathione reductase | 97.08 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 97.08 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 97.08 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 97.06 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.04 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 97.03 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.03 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 97.02 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 96.99 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 96.93 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 96.93 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 96.92 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 96.89 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 96.89 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 96.89 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 96.88 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 96.88 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.84 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 96.84 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 96.83 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 96.83 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 96.8 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 96.77 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 96.75 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 96.75 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 96.72 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 96.69 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.67 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 96.61 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 96.59 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 96.58 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 96.57 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 96.54 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 96.52 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 96.5 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 96.46 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 96.36 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 96.35 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 96.35 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 96.33 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 96.32 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 96.32 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 96.27 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 96.18 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 96.09 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 96.09 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 96.04 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 96.04 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 95.99 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 95.94 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 95.94 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 95.92 | |
| PF14691 | 111 | Fer4_20: Dihydroprymidine dehydrogenase domain II, | 95.89 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 95.78 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 95.78 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 95.73 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.62 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 95.6 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 95.37 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 95.28 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 95.27 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 95.26 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.22 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 95.14 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 94.99 | |
| PLN02785 | 587 | Protein HOTHEAD | 94.99 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.97 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 94.65 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 94.51 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 94.38 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.21 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 94.21 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 94.18 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 94.03 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 93.94 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 93.93 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 93.92 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 93.67 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 93.65 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 93.58 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 93.55 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 93.55 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 93.42 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 93.41 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 93.32 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 93.14 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 92.91 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.89 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 92.84 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 92.83 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 92.82 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.79 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 92.77 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 92.67 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.62 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.6 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.49 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 92.46 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 92.39 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 92.32 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 92.11 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 92.05 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 91.9 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 91.89 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 91.87 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 91.86 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 91.83 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 91.82 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 91.81 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 91.78 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 91.75 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 91.62 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.61 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 91.6 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 91.55 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 91.5 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 91.49 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.42 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.36 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 91.3 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.27 | |
| PLN02546 | 558 | glutathione reductase | 91.01 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 91.0 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.95 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 90.91 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 90.79 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.59 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 90.54 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 90.48 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.45 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.33 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 90.31 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.14 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 89.96 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 89.96 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 89.93 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 89.92 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 89.85 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 89.83 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 89.79 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 89.77 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 89.76 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 89.61 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 89.57 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 89.55 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 89.53 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 89.43 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 89.3 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 89.17 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 89.17 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.16 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.84 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 88.6 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 88.58 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 88.5 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 88.5 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 88.29 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 88.27 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 88.23 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 88.06 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.04 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 87.9 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 87.72 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 87.53 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 87.43 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 87.28 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 87.22 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 87.15 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 87.14 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 87.11 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 86.62 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 86.62 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 86.6 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 86.35 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 86.33 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.21 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 86.21 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 86.2 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 86.17 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.94 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 85.83 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 85.8 | |
| KOG2755 | 334 | consensus Oxidoreductase [General function predict | 85.79 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 85.78 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 85.52 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 85.51 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 85.5 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 85.42 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 85.4 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 85.24 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 85.19 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 85.08 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 85.04 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 85.01 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 84.99 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 84.8 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 84.8 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 84.72 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.65 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 84.56 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 84.52 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 84.44 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 84.35 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 84.02 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.97 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 83.93 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 83.72 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 83.59 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 83.59 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 83.55 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.51 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 83.47 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 83.28 | |
| TIGR01087 | 433 | murD UDP-N-acetylmuramoylalanine--D-glutamate liga | 83.23 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 83.2 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 83.09 | |
| PRK03815 | 401 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.94 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 82.93 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 82.89 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 82.87 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 82.82 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 82.72 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 82.67 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 82.33 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 82.32 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 82.31 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 82.08 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 82.03 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 81.98 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 81.93 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 81.81 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 81.77 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 81.77 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 81.63 |
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-132 Score=1166.41 Aligned_cols=727 Identities=79% Similarity=1.226 Sum_probs=656.1
Q ss_pred CCCCCCCCCCccccCCCCCCcCCcCCCcccccccCcchhcccCCC--------------CcccccccCCCCCCCCCCCCC
Q 004657 4 PQEPSDNANDDVVSDESSPETDATLSPSQIETQAETDELQNATET--------------NTALEAPVSDSLDDSSDPIPE 69 (739)
Q Consensus 4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~ 69 (739)
|+.|+|++| +||||.++||||+.++|+|.||++++| .||+.++ +.+.+++++++..+++++.
T Consensus 8 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-- 83 (808)
T PLN02328 8 PEDPADNVN-DVVSEASSPETDLSLSPSQSEQNIEND-GQNSPETQSPLTELQPSPLPPNTTLDAPVSDSQGDESSSE-- 83 (808)
T ss_pred CCCCcchhh-hhhccCCCCCcccccChhHHHHhhhhc-ccCCccccCcccccCCCCCCCCCccccccccccccccccc--
Confidence 344899999 999999999999999999999999998 8888765 5566889999988776654
Q ss_pred CCCCCCCCCCCCCCCchhhhhcccccccccCCccccccCCCcccccccccchHHHHHHHhCCCCCCCCHHHHhhcccccc
Q 004657 70 DQQPQNPNPSEPGPPPRKRRRRKRFFTEINGNPSLARNRRPRFSCLAKEVDTEALIAISVGFPVDSLTEEEIEANVVSKI 149 (739)
Q Consensus 70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~lp~~~l~~~e~~~~~~~~~ 149 (739)
||+||||+++|+|++||||||||||+++|+||.|+|+|.. .++++|+++||++|+++|||+|+|+++||++++.+.+
T Consensus 84 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~a~~~~~p~~~l~~~e~~~~~~~~~ 160 (808)
T PLN02328 84 -QQPQNPNSTEPAPPPKKRRRRKRFFTEINANPAFRRHRVR--GGLGKEVDVEALIAISVGFPVDSLTEEEIEANVVSTI 160 (808)
T ss_pred -ccCCCCCCCCCCcccchhhhccccceeccCCchhccCCCc--hhhcccchHHHHHHHHcCCCCccCCHHHHhhcCcchh
Confidence 9999999999999999999999999999999999999842 4499999999999999999999999999988899999
Q ss_pred cccccchhHHHhhhhhcccccccccCccHhhhhhcccccccchHHHHHHHHHHcCccccccCCCccccccCCCCccCCCc
Q 004657 150 GGTEQANYIVVRNHILSLWRSNVSVWLTREQALESIRSEHKTLVDSAYDFLLEHGYINFGLAPPIKEVKLGSFGRVERGN 229 (739)
Q Consensus 150 ~~~~~~~~~~Ir~~i~~~~~~~~~~~~tr~~~~~~i~~~~~~l~~~~~~~~~~~g~in~g~~~~~~~~~~~~~~~~~~~~ 229 (739)
++++++.|+.|||+||.+|..||..++|++++.+.++.+|.+|++.+++|+.++|||||||.+......+.+......++
T Consensus 161 ~~~~~~~yl~iRN~il~lW~~np~~~~t~~~a~~~~~~~~~~l~~~~~~~l~~~g~in~gv~~~~~~~~~~~~~~~~~~~ 240 (808)
T PLN02328 161 GGTEQANYIVVRNHILARWRSNVSNWLTRDHALESIRAEHKNLVDSAYNFLLEHGYINFGVAPVIKEAQLRSFEGVEPAN 240 (808)
T ss_pred cccceeehhhHHHHHHHHHHhCCcceecHHHHHhhcchhhHHHHHHHHHHHhccCceeeeccccccccccCCCCCCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999875532222333335789
Q ss_pred EEEECccHHHHHHHHHHHHCCCeEEEEccccCCCCceeeeeccCCCceeeeccccceecCCCCChHHHHHHHcCCCcccc
Q 004657 230 VVIVGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVLTGINGNPLGVLARQLELPLHKV 309 (739)
Q Consensus 230 v~IiG~G~aGl~aA~~L~~~g~~v~v~E~~~~~GG~~~~~~~~~~G~~~~~D~Ga~~i~g~~~n~l~~L~~qLGl~~~~~ 309 (739)
|+|||||++||+||++|++.|++|+|||+++++||+++++...+.+..+.+|+|++|+++..+|++..+++++|++.+.+
T Consensus 241 v~IiGaG~aGl~aA~~L~~~g~~v~v~E~~~r~GGr~~t~~~~g~~~~~~~d~Gas~i~g~~~npl~~l~~~lgl~~~~~ 320 (808)
T PLN02328 241 VVVVGAGLAGLVAARQLLSMGFKVVVLEGRARPGGRVKTMKMKGDGVVAAADLGGSVLTGINGNPLGVLARQLGLPLHKV 320 (808)
T ss_pred EEEECcCHHHHHHHHHHHHCCCcEEEEeccccCCCcccccccCCCCcceeccCCceeecCCCccHHHHHHHHcCCceEec
Confidence 99999999999999999999999999999999999999998875544457999999999999999999999999999888
Q ss_pred cCCcceecCCCceeccccchhhHHHHHHHHHHHHHHHHHHHHhhccCCCCHHHHHHHHHhHhhhhhcHHHHHHHHHHHHh
Q 004657 310 RDICPLYLPNGKAIDADIDSGVEVSFNKLLDRVCKLRHDMIEEFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLAN 389 (739)
Q Consensus 310 ~~~~~l~~~~Gk~v~~~~~~~v~~~~~~ll~~~~~l~~~l~~~~~~~~~sl~~~l~~~~~~~~~~~~~~~~~ll~~~l~~ 389 (739)
...+++|+.+|+.++...+..+...++.+++...+++..+.......++|++++++.+...++...++.++.+++|++.+
T Consensus 321 ~~~~~~~~~dG~~~~~~~~~~v~~~f~~lL~~~~klr~~~~~~~~~~D~SLg~~le~~~~~~~~~~~~~e~~Ll~w~lan 400 (808)
T PLN02328 321 RDICPLYLPDGKAVDAEIDSKIEASFNKLLDRVCKLRQAMIEEVKSVDVNLGTALEAFRHVYKVAEDPQERMLLNWHLAN 400 (808)
T ss_pred CCCceEEeCCCcCcchhhhhhHHHHHHHHHHHHHHHHHhhhhcccccCcCHHHHHHHHhhhhccCCCHHHHHHHHHHHHH
Confidence 88899999999998877777777888888888777766443334456889999998776665555677888999999999
Q ss_pred hhhhhhhhhhhhhhhhccCCCCCCCCCCccccCChHHHHHHHHHcCCCEEecceeEEEEEeCCeEEEEeCCEEEEecEEE
Q 004657 390 LEYANASLMSNLSMAYWDQDDPYEMGGDHCFIPGGNEWFVRALAEDLPIFYQRTVQSIRYGVDGVMVYAGGQEFRGDMVL 469 (739)
Q Consensus 390 le~~~~~~l~~Ls~~~~~~~~~~~~gg~~~~i~GG~~~L~~aLa~gl~I~lnt~V~~I~~~~~~V~V~~~g~~i~AD~VI 469 (739)
+++.++..++.++...|++++.++.++.++.+.||+++|+++|++.+.|++|++|++|.+.+++|.|+.+|+++.||+||
T Consensus 401 lE~~~gs~ls~LSl~~w~qd~~~e~~G~~~~v~GG~~~Li~aLa~~L~I~ln~~V~~I~~~~dgV~V~~~G~~~~AD~VI 480 (808)
T PLN02328 401 LEYANASLMSNLSMAYWDQDDPYEMGGDHCFIPGGNDTFVRELAKDLPIFYERTVESIRYGVDGVIVYAGGQEFHGDMVL 480 (808)
T ss_pred HhccchhhHHHHHhhhhhccccccCCCeEEEECCcHHHHHHHHHhhCCcccCCeeEEEEEcCCeEEEEeCCeEEEcCEEE
Confidence 99999999999999999887777888889999999999999999999999999999999999999887788899999999
Q ss_pred EcCChhhHhccCcccCCCCcHHHHHHHhhcCCcceEEEEEEcCCCCCCCCCCceeeeccCCCC---------------C-
Q 004657 470 CTVPLGVLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWGGEIDTFGHLTEDSSM---------------R- 533 (739)
Q Consensus 470 lAvPl~vL~~~~i~f~P~LP~~k~~aI~~l~~g~l~KV~L~fd~~fW~~~~~~fG~l~~~~~~---------------r- 533 (739)
+|+|+++|++..|.|.|+||+++.++|++++|+.++||+|.|+++||+...+.||++..+... .
T Consensus 481 vTvPl~vLk~~~I~F~P~LP~~K~~AI~~l~yG~~~KV~L~F~~~FW~~~~d~fG~l~~d~s~rG~~~lf~s~s~~~G~~ 560 (808)
T PLN02328 481 CTVPLGVLKKGSIEFYPELPQRKKDAIQRLGYGLLNKVALLFPYNFWGGEIDTFGHLTEDPSMRGEFFLFYSYSSVSGGP 560 (808)
T ss_pred ECCCHHHHhhcccccCCCCCHHHHHHHHcCCCcceEEEEEEeCCccccCCCCceEEEeecCCCCceEEEEecCCCCCCCc
Confidence 999999999778999999999999999999999999999999999998777777776432110 0
Q ss_pred ------------------------------------------CCceEEEeccCCCCcCCCccccccCCCCCcchHHHhcc
Q 004657 534 ------------------------------------------DPVQAICTRWGKDRFSYGSYSYVAVGSSGDDYDILAET 571 (739)
Q Consensus 534 ------------------------------------------~P~~~~~t~W~~dp~~~Gsys~~~pg~~~~~~~~l~~p 571 (739)
+|+...+++|.+|||++|+|+++.+|+.+.+|+.|++|
T Consensus 561 vLvafv~G~~A~~~e~lsdeE~v~~vL~~Lr~ifgp~~~~vp~P~~~~vtrW~~DP~s~GSYS~~~pG~~~~~~~~LaeP 640 (808)
T PLN02328 561 LLIALVAGDAAVKFETLSPVESVKRVLQILRGIFHPKGIVVPDPVQAVCTRWGKDCFTYGSYSYVAVGSSGDDYDILAES 640 (808)
T ss_pred EEEEEecChhhHHHhcCCHHHHHHHHHHHHHHHhCcccccccCcceEEEecCCCCCCcCCCCCCCCCCCchhHHHHHhcc
Confidence 35678899999999999999999999988899999999
Q ss_pred cCCCcEEEecccccCcCCCcHHHHHHHHHHHHHHHHHHHhcccccccccccccCCCCcccccccCCCCCCcceEEEeeCC
Q 004657 572 VGDGRVFFAGEATNKQYPATMHGAFLSGMREAASILRVAKRRSLALTNKAYNESEDNGNLDKLFETPDLTFGSFSALFDP 651 (739)
Q Consensus 572 ~~~~rlffAGE~ts~~~pgtveGAv~SG~RAA~~Il~~l~~~~~~~~~k~~~~~~~~~~l~~l~~~~~l~~~~f~~~~~~ 651 (739)
++++|||||||||+..|+||||||++||+|||.+|+..++.++.+..+|..+.-.+++.|.|||++|||+||+||+||+|
T Consensus 641 v~~GRL~FAGEaTs~~~~GtVhGAi~SGlRAA~eIl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 720 (808)
T PLN02328 641 VGDGRVFFAGEATNKQYPATMHGAFLSGMREAANILRVARRRSLCIDDKVNNDEEEDDCLDQLFDTPDLTFGSFSILFDP 720 (808)
T ss_pred CCCCCEEEEEhhHhCCCCeEhHHHHHHHHHHHHHHHHHHhhcccCCcccccccchhhhHHHHHhcCcCccccceEEEecC
Confidence 86679999999999989999999999999999999999998887765565555567788999999999999999999999
Q ss_pred CCCCccCceEEEEEeccCCCCCcceEEEEeeeHHHHHHHHhhcCCchhHHHHHhhcCeeEeeccccccchhHHHHHHHHh
Q 004657 652 KSIDLESDALLRVKFQGENFDSGHLCLYGLVTRKQAVQLRELDGDGNRMKMLHDNFRVKLVARRGVCNATESLITRIKAT 731 (739)
Q Consensus 652 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 731 (739)
.++||+|++||||+|+.++..+++|||||+||||||++|++.+|||+||+|||++|||||||||||+++|++|||+||++
T Consensus 721 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 800 (808)
T PLN02328 721 RSNDPESLSLLRVKFQGEKPDSCFLCLYGLVSRKQAIELGELDDDGKRNEYLYEKFQVVLVGRKGLSQEGESLISSIKEA 800 (808)
T ss_pred CCCCCCCceeEEEEeccCCCCcccEEEEEeeeHHHHHHHHHcCCcHHHHHHHHHhcCeEEeecccccccHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhcCC
Q 004657 732 RFSLND 737 (739)
Q Consensus 732 ~~~~~~ 737 (739)
|++++|
T Consensus 801 ~~~~~~ 806 (808)
T PLN02328 801 RLNLQV 806 (808)
T ss_pred hhcccc
Confidence 999987
|
|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04433 SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in eukaryotic chromosomal proteins | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG2755 consensus Oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 739 | ||||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 2e-42 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 2e-42 | ||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 2e-42 | ||
| 2x0l_A | 734 | Crystal Structure Of A Neuro-Specific Splicing Vari | 9e-42 | ||
| 2v1d_A | 730 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 9e-42 | ||
| 2xaf_A | 852 | Crystal Structure Of Lsd1-Corest In Complex With Pa | 1e-41 | ||
| 2dw4_A | 660 | Crystal Structure Of Human Lsd1 At 2.3 A Resolution | 1e-41 | ||
| 2h94_A | 664 | Crystal Structure And Mechanism Of Human Lysine-Spe | 1e-41 | ||
| 2iw5_A | 666 | Structural Basis For Corest-dependent Demethylation | 1e-41 | ||
| 2ejr_A | 662 | Lsd1-Tranylcypromine Complex Length = 662 | 1e-41 | ||
| 2hko_A | 664 | Crystal Structure Of Lsd1 Length = 664 | 4e-41 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 9e-06 | ||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 9e-06 | ||
| 2com_A | 124 | The Solution Structure Of The Swirm Domain Of Human | 3e-05 | ||
| 2l3d_A | 102 | The Solution Structure Of The Short Form Swirm Doma | 3e-05 |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
|
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
| >pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 | Back alignment and structure |
| >pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 | Back alignment and structure |
| >pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 | Back alignment and structure |
| >pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 | Back alignment and structure |
| >pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 | Back alignment and structure |
| >pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 | Back alignment and structure |
| >pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 | Back alignment and structure |
| >pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 | Back alignment and structure |
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
| >pdb|2COM|A Chain A, The Solution Structure Of The Swirm Domain Of Human Lsd1 Length = 124 | Back alignment and structure |
| >pdb|2L3D|A Chain A, The Solution Structure Of The Short Form Swirm Domain Of Lsd1 Length = 102 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
Score = 328 bits (842), Expect = e-105
Identities = 82/432 (18%), Positives = 142/432 (32%), Gaps = 52/432 (12%)
Query: 230 VVIVGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVLTG 289
++VG G +GL AAR L + G KV++LEG ER GGR +R+ + + ++GG+ L
Sbjct: 4 AIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESR-NVPGLRVEIGGAYLHR 62
Query: 290 INGNPLGVLARQLELPLHKVRDICPLY-------LPNGKAIDADIDSGVEVSFNKLLDRV 342
+ L + +P + + I VE + LL
Sbjct: 63 KHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDA 122
Query: 343 CKLRHDMIEEFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEYANASLMSNLS 402
++ + E + ++ E + Q + W++ AS + L
Sbjct: 123 HRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQ 182
Query: 403 MAYWDQDDPY-EMGGDHCFIPGGNEWFVRALAEDLP-IFYQRTVQSIRYGVDGVMV-YAG 459
+ + G+ V A+++++P I Q V I D V V
Sbjct: 183 LVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKD 242
Query: 460 GQEFRGDMVLCTVPLGVLKKGTIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWGGE 519
G F+ V+ P+ ++ I F P LP+R++ I+ G K+ + G E
Sbjct: 243 GHAFQAHSVIVATPMNTWRR--IVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIE 300
Query: 520 IDTFGHLTE--DSSMR-----------------------------------DPVQAICTR 542
G D + +
Sbjct: 301 CVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHD 360
Query: 543 WGKDRFSYGSYSYVAVGSSGDDYDILAETVGDGRVFFAGEATNKQYPATMHGAFLSGMRE 602
W D G + VG + L E GR+ F G + ++P + GA +
Sbjct: 361 WIADPLFEGPWVAPRVGQFSRVHKELGEPA--GRIHFVGSDVSLEFPGYIEGALETAECA 418
Query: 603 AASILRVAKRRS 614
+IL
Sbjct: 419 VNAILHSHHHHH 430
|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Length = 104 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
| >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Length = 361 | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Length = 377 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Length = 369 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 739 | ||||
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 2e-33 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 5e-33 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 4e-32 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 3e-19 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 3e-28 | |
| d2dw4a1 | 102 | a.4.1.18 (A:172-273) Lysine-specific histone demet | 5e-24 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 5e-19 | |
| d2fq3a1 | 85 | a.4.1.18 (A:311-395) Transcription regulatory prot | 3e-16 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 5e-16 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 4e-12 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 6e-12 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 7e-12 | |
| d2bi7a1 | 314 | c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu | 4e-11 | |
| d2dw4a3 | 109 | d.16.1.5 (A:655-763) Lysine-specific histone demet | 1e-09 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 2e-08 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 5e-08 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 5e-08 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 2e-07 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 7e-07 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 7e-07 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 7e-07 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 9e-07 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 1e-06 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 1e-06 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 1e-06 | |
| d2gv8a1 | 335 | c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox | 2e-06 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 3e-06 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 3e-06 | |
| d1cjca2 | 230 | c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase | 3e-06 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 5e-06 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 8e-06 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 9e-06 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 1e-05 | |
| d1c0pa1 | 268 | c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida | 2e-05 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 2e-05 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 2e-05 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 2e-05 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 2e-05 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 2e-05 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 3e-05 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 3e-05 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 4e-05 | |
| d1fl2a1 | 184 | c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide | 6e-05 | |
| d1pjca1 | 168 | c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phorm | 6e-05 | |
| d1n4wa1 | 367 | c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of | 6e-05 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 6e-05 | |
| d1lqta2 | 239 | c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct | 7e-05 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 8e-05 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 1e-04 | |
| d1q1ra1 | 185 | c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas | 2e-04 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 2e-04 | |
| d1trba1 | 190 | c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase | 2e-04 | |
| d1gtea4 | 196 | c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de | 2e-04 | |
| d2v5za2 | 112 | d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H | 3e-04 | |
| d1b5qa2 | 112 | d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea | 3e-04 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 4e-04 | |
| d1vdca1 | 192 | c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase | 5e-04 | |
| d1kdga1 | 360 | c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain | 5e-04 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 6e-04 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 6e-04 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 7e-04 | |
| d1aoga1 | 238 | c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas | 7e-04 | |
| d1kifa1 | 246 | c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N | 7e-04 | |
| d1ju2a1 | 351 | c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { | 0.001 | |
| d2jfga1 | 93 | c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D- | 0.001 | |
| d1d7ya1 | 183 | c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo | 0.001 | |
| d1xdia1 | 233 | c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd | 0.002 | |
| d1ps9a3 | 179 | c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu | 0.002 | |
| d1l7da1 | 183 | c.2.1.4 (A:144-326) Nicotinamide nucleotide transh | 0.002 | |
| d1fcda1 | 186 | c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf | 0.002 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 0.002 | |
| d2iida2 | 113 | d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan | 0.004 | |
| d1m6ia1 | 213 | c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f | 0.004 |
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Monoamine oxidase B species: Human (Homo sapiens) [TaxId: 9606]
Score = 130 bits (327), Expect = 2e-33
Identities = 68/335 (20%), Positives = 121/335 (36%), Gaps = 31/335 (9%)
Query: 229 NVVIVGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVLT 288
+VV+VG G++G+ AA+ L G VVVLE R+R GGR T + + V D+GGS +
Sbjct: 1 DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYV---DLGGSYVG 57
Query: 289 GINGNPLGVLARQLELPLHKVRDICPLYLPNG-----------KAIDADIDSGVEVSFNK 337
N + LA++L L +KV ++ L + +
Sbjct: 58 P-TQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRT 116
Query: 338 LLDRVCKLRHDMIEEFKSVDVPLGVALEAFRNVYKVAEDLQERMLLNWHLANLEY----- 392
+ D ++ D + + + ++ + E ++ L +L
Sbjct: 117 MDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVS 176
Query: 393 ANASLMSNLSMAYWDQDDPYEMGGDHCFIPGGNEWFVRALAEDLP--IFYQRTVQSIRYG 450
A L + GG GG+ + + L + +R V I
Sbjct: 177 ALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQT 236
Query: 451 VDGVMV-YAGGQEFRGDMVLCTVPLGVLKKGTIEFVPELPQRKKDAIQRLGY-GLLNKVA 508
+ V+V + + V+ +P + K I F P LP + I R+ G+L +
Sbjct: 237 RENVLVETLNHEMYEAKYVISAIPPTLGMK--IHFNPPLPMMRNQMITRVFPPGILTQYG 294
Query: 509 MLFPHN-----FWGGEIDTFGHLTEDSSMRDPVQA 538
+ F G E T + ++ +A
Sbjct: 295 RVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERA 329
|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 85 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Length = 168 | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Length = 93 | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Length = 183 | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 739 | |||
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 100.0 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 100.0 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 100.0 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.98 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 99.96 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.93 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 99.83 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.81 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.76 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 99.71 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 99.49 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.42 | |
| d2dw4a1 | 102 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.41 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 99.39 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 99.39 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 99.35 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 99.31 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 99.31 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 99.21 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.2 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 99.18 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 99.17 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 98.97 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 98.89 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 98.86 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 98.8 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.8 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.76 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.75 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.74 | |
| d2fq3a1 | 85 | Transcription regulatory protein swi3 {Baker's yea | 98.74 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 98.74 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.73 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.7 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.68 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.64 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.6 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 98.6 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.55 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.49 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 98.46 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 98.46 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.45 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.45 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 98.44 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 98.43 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.43 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.42 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.37 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 98.31 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 98.31 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.3 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.3 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.3 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.29 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.29 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.29 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 98.28 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.25 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.24 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.23 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.22 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.22 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.21 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 98.18 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 98.1 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.1 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.05 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.01 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 97.99 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.98 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.97 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 97.96 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.95 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 97.92 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 97.88 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 97.82 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 97.78 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 97.7 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.64 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 97.61 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 97.51 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 97.49 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 97.41 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 97.37 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 97.29 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 97.25 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.15 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 97.11 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.03 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.0 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 96.98 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 96.92 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.89 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 96.84 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.83 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.82 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 96.64 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.24 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.04 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 96.03 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.0 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 95.82 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 95.78 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 95.51 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 95.49 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.21 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.82 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 94.61 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 94.23 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 94.16 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.12 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 93.99 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 93.45 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 93.24 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 93.1 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 92.92 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 92.59 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 92.56 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 92.52 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.29 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 92.25 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 92.24 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 92.12 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 91.99 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 91.82 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.77 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 91.62 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 91.61 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 91.59 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 91.53 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 91.5 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 91.06 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 91.01 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 90.88 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 90.59 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 90.58 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 90.43 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 90.39 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 90.13 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 89.74 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 89.71 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 89.55 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 89.29 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 89.11 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 88.69 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 88.67 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 88.53 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 88.47 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 88.45 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 88.28 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 88.26 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 88.04 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 87.92 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 87.91 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 87.45 | |
| d1gtea1 | 182 | Dihydropyrimidine dehydrogenase, N-terminal domain | 87.24 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 87.02 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 87.02 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 86.58 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 86.51 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 86.43 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 86.33 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 86.15 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 85.89 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 85.7 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 85.68 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 85.27 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 85.16 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 84.92 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 84.73 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 84.62 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 84.12 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 84.12 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 84.07 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 84.03 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 84.0 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 83.99 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 83.65 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 82.98 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 82.37 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 82.02 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.41 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 81.04 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 80.85 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 80.85 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 80.64 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 80.28 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3.6e-34 Score=242.05 Aligned_cols=336 Identities=38% Similarity=0.606 Sum_probs=207.5
Q ss_pred CCCCEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEECCCCCCEEEECCCCCEECCCCCCHHHHHHHHCCCC
Q ss_conf 77748998764877999999998999499990355789760110025897201321465010289998188999981998
Q 004657 226 ERGNVVIVGAGLAGLVAARQLISMGFKVVVLEGRERPGGRVKTRKMKCDGVVAAADVGGSVLTGINGNPLGVLARQLELP 305 (739)
Q Consensus 226 ~~~dVvIIGAGiAGLsAA~~L~k~G~~VtVLEa~~riGGr~~T~~~~~~G~~~~~D~Ga~~i~g~~~npl~~L~~qlGi~ 305 (739)
+..||||||||+|||+||++|+++|++|+|||+++++|||++|++..+ +.+|+|++++++.+.+++..|++++|++
T Consensus 4 ~~~kViVIGaG~aGL~aA~~L~~~G~~V~VlEa~~r~GGr~~t~~~~g----~~~d~G~~~i~~~~~~~~~~l~~~lgl~ 79 (449)
T d2dw4a2 4 KTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGN----YVADLGAMVVTGLGGNPMAVVSKQVNME 79 (449)
T ss_dssp CCCEEEEECCBHHHHHHHHHHHHTTCEEEEECSSSSSBTTCCEEEETT----EEEESSCCEECCSBTCHHHHHHHHHTCC
T ss_pred CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEEEEECC----EEEECCCEEECCCCCCHHHHHHHHCCCC
T ss_conf 999489989888999999999858999899907998756677997299----8997897798899974999999975996
Q ss_pred CCCCCCCCCEECCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHH----------
Q ss_conf 533358854034899321344320169999999999998889888-731038999889999999674321----------
Q 004657 306 LHKVRDICPLYLPNGKAIDADIDSGVEVSFNKLLDRVCKLRHDMI-EEFKSVDVPLGVALEAFRNVYKVA---------- 374 (739)
Q Consensus 306 ~~~~~~~~~l~~~~G~~v~~~~d~~v~~~~~~ll~~~~~l~~~l~-~~~~~~~~sl~~~l~~~~~~~~~~---------- 374 (739)
.........++..+|+.+...........++.++.....+..... ........++.+++..........
T Consensus 80 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 159 (449)
T d2dw4a2 80 LAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWK 159 (449)
T ss_dssp EEECCCCCCEECTTSCBCCHHHHHHHHHHHHHHHHHHHHHHHTSCCCEETTEECBHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CEECCCCCEEEECCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf 25438983499139937204413667999999999999998875221002332007899987788765000178999999
Q ss_pred ------------------------------------------------------HCHHHHHHHH---------HHHHHHH
Q ss_conf ------------------------------------------------------1599999999---------9987554
Q 004657 375 ------------------------------------------------------EDLQERMLLN---------WHLANLE 391 (739)
Q Consensus 375 ------------------------------------------------------~~~~~~~ll~---------~~l~~le 391 (739)
.......... .....+.
T Consensus 160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 239 (449)
T d2dw4a2 160 KIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELE 239 (449)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTC---------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCHHHHHHHHHHEEEEECCCEEEEEEEEEEE
T ss_conf 98763210024454433466677777765444310111101002455411202566641012688325238855577500
Q ss_pred HHH----------H---------------HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEECCEEEE
Q ss_conf 311----------3---------------555666642015799877799721248829999999981898784310589
Q 004657 392 YAN----------A---------------SLMSNLSMAYWDQDDPYEMGGDHCFIPGGNEWFVRALAEDLPIFYQRTVQS 446 (739)
Q Consensus 392 ~~~----------~---------------~~l~~Ls~~~~~~~~~~~~~g~~~~i~gG~~~L~~aLa~gv~I~lnt~V~~ 446 (739)
... . ..........+.................++..+...+...+.+.....+..
T Consensus 240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 319 (449)
T d2dw4a2 240 ANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQ 319 (449)
T ss_dssp TSCCCSCSSCHHHHHHHHHHHHHHHHHHTSCGGGBBTTTTTTTGGGCCBSCCEEETTCTTHHHHHHHTTCEEECSEEEEE
T ss_pred ECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCC
T ss_conf 02676368840564322111122335531111100110000000001245422342100000011034544222233211
Q ss_pred EEEECCEEEE--E-E----CCEEEEECEEEECCCHHHHHCC--CCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCC
Q ss_conf 9980992999--9-4----9979995499991795667226--7314789968999999632984137999985788879
Q 004657 447 IRYGVDGVMV--Y-A----GGQEFRGDMVLCTVPLGVLKKG--TIEFVPELPQRKKDAIQRLGYGLLNKVAMLFPHNFWG 517 (739)
Q Consensus 447 I~~~~~~V~V--~-~----~g~~i~AD~VIlAvP~~vL~~~--~i~f~P~LP~~k~~aI~~l~~g~i~KV~L~f~~~fW~ 517 (739)
......+..+ . . ......++.++++.++..++.. ...+.+.++.|..+.+.+..+.. +.
T Consensus 320 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~ 387 (449)
T d2dw4a2 320 VRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMVAAG------------SS 387 (449)
T ss_dssp EEEETTEEEEEEEESSSTTCEEEEEESEEEECCCHHHHHCSSCSSEEESCCCHHHHHHHHHSCBTT------------CC
T ss_pred CCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCC------------CC
T ss_conf 234788860565203555443101114688877999874354545557556600010465056555------------45
Q ss_pred CCCCCEEEECCCCCCCCCCEEEEECCCCCCCCCCCCC-CCCCCCCCCCHHHHHCCCCCCCEEEECCCCCCCCCCCHHHHH
Q ss_conf 9878414421689989971689701488876788655-445799985168886004999399954542375888489999
Q 004657 518 GEIDTFGHLTEDSSMRDPVQAICTRWGKDRFSYGSYS-YVAVGSSGDDYDILAETVGDGRVFFAGEATNKQYPATMHGAF 596 (739)
Q Consensus 518 ~~~~~fG~l~~~~~~r~pi~~~~~~W~~dp~~~Gsys-~~~~g~~~~~~~~l~~p~~~~rIffAGE~ts~~~~gtveGAv 596 (739)
. . .+. ...|......++.+.+|++ |||||||+|+..|+||||||+
T Consensus 388 ~-----------------~---------------~~~~~~~p~~~~~~~~~~~~~~~--~l~fAGe~t~~~~~g~~~GA~ 433 (449)
T d2dw4a2 388 G-----------------N---------------DYDLMAQPITPGPSIPGAPQPIP--RLFFAGEHTIRNYPATVHGAL 433 (449)
T ss_dssp H-----------------H---------------HHHHHHCCBCC---------CCC--CEEECSGGGCTTSCSSHHHHH
T ss_pred C-----------------C---------------HHHHHCCCCCCCCCCHHHCCCCC--CEEEECCCCCCCCCEEHHHHH
T ss_conf 4-----------------2---------------24554178664333501058889--789980893799960069999
Q ss_pred HHHHHHHHHHHHHHH
Q ss_conf 999999999999981
Q 004657 597 LSGMREAASILRVAK 611 (739)
Q Consensus 597 ~SG~rAA~~Il~~l~ 611 (739)
.||+|||++|++.+.
T Consensus 434 ~SG~~aA~~Il~~~~ 448 (449)
T d2dw4a2 434 LSGLREAGRIADQFL 448 (449)
T ss_dssp HHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHC
T ss_conf 999999999999754
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|