Citrus Sinensis ID: 004704


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-----
MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
cccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccEEccHHHHHccccccEEEcccccccEEccccccccccccEEEcccccccccccccHHHccccccEEEcccccccccccccccccccccEEEcccccccEEccHHHHcccccccEEEccccEEEEEccccccccccccEEEcccccEEccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccHHHHHHccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHccccccEEEEEEEEccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEEEEEEEEEEc
cccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcHHHcEEEEcccccccccccHHHccccccEEEEccccccccccccHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHcHHHHHHHHcccccccccccHccccccEEEEcccccccccccHHccccccccEEEccccccccccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc
mnlernfigspliTCLKNltrlkildissnqlngslpsvISNLTsleyldlshnnfegmfplsslanhsKLEGLLLSTrnntlhvktenwlpTSQLIVLGLtkcnlngsypdfllHQYHLKYLdlshnklvgnfptwllrnnpklEVLLLKNnsfsgilqlpkakhdflhhldiscnnfrgklphNMGVILQKLMYMDISkncfegnipysagemkELSLLDLSrnyfsgglsqsvVTGCFSLELldlsnnnfegqffsEYMNLTRLRHLYfennnfsgkikdgllsstslQVLDISnnmlsghiphwmgnfSSELEILSMSKnhlegnvpvqlnnlerlrildisenrlsgpiasslnlssVEHLSLQKnalnglipgelfrSCKLVtlnlrdntfsgriphqinehSNLRFLLLggnhlqgpipdqLCQLQKLAMMDlsrnkfsgsippcfanvlswrvgsddvlngsklnspeldeeiefgslgnnrssntMFGMWRWLSALEKRAAIDERVEIEFAMKNRYeiyngsnvnrvtgldlscnqltgeipsdiGQLQAILALNLsnnslsgsipesfsnlkMIESLDISynkltgqippqltaLNFLSIFNVSynnlsgrtpdkgqfatfdessyrgnpsLCAWLIQQKYsrtlkptttqasgaeeeeeeedddesaIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
mnlernfigspLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIefgslgnnrssNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYsrtlkptttqasgaeeeeeeedddesaIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILAlnlsnnslsGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAeeeeeeedddeSAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
*****NFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVL*************************NTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSL***IPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGR*****QFATFDESSYRGNPSLCAWLIQQKY***************************IDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLC*
MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQ*****************************IDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTL**********************AIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
*NL*RNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYS*********************DDESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query735 2.2.26 [Sep-21-2011]
Q8L899 1207 Systemin receptor SR160 O N/A no 0.918 0.559 0.327 3e-67
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.918 0.559 0.327 4e-67
Q9FL28 1173 LRR receptor-like serine/ no no 0.857 0.537 0.310 8e-66
C0LGQ5 1249 LRR receptor-like serine/ no no 0.840 0.494 0.307 6e-64
Q9ZWC8 1166 Serine/threonine-protein no no 0.827 0.521 0.319 7e-62
Q9C9H7847 Receptor-like protein 12 no no 0.798 0.693 0.304 3e-60
Q9LJF3 1164 Receptor-like protein kin no no 0.829 0.524 0.322 4e-59
Q9FZ59 1088 Leucine-rich repeat recep no no 0.794 0.536 0.304 2e-57
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.873 0.512 0.287 2e-57
O22476 1196 Protein BRASSINOSTEROID I no no 0.825 0.507 0.321 2e-57
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 233/712 (32%), Positives = 345/712 (48%), Gaps = 37/712 (5%)

Query: 1   MNLERNFIGSPL--ITCLKNLTRLKILDISSNQLNGSLPSVISNLT-SLEYLDLSHNNFE 57
           ++L  N I  P+  I+     + LK L++S N L+     ++   T SL+ LDLS+NN  
Sbjct: 139 IDLAENTISGPISDISSFGVCSNLKSLNLSKNFLDPPGKEMLKGATFSLQVLDLSYNNIS 198

Query: 58  G--MFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLL 115
           G  +FP  S     +LE    S + N L       L    L  L L+  N +  +P F  
Sbjct: 199 GFNLFPWVSSMGFVELE--FFSIKGNKLAGSIPE-LDFKNLSYLDLSANNFSTVFPSFK- 254

Query: 116 HQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDIS 175
              +L++LDLS NK  G+  + L  +  KL  L L NN F G++  PK   + L +L + 
Sbjct: 255 DCSNLQHLDLSSNKFYGDIGSSL-SSCGKLSFLNLTNNQFVGLV--PKLPSESLQYLYLR 311

Query: 176 CNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQS 235
            N+F+G  P+ +  + + ++ +D+S N F G +P S GE   L L+D+S N FSG L   
Sbjct: 312 GNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLPVD 371

Query: 236 VVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSS--TSLQV 293
            +    +++ + LS N F G     + NL +L  L   +NN +G I  G+      +L+V
Sbjct: 372 TLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKV 431

Query: 294 LDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGP 353
           L + NN+  G IP  + N  S+L  L +S N+L G++P  L +L +L+ L +  N+LSG 
Sbjct: 432 LYLQNNLFKGPIPDSLSN-CSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGE 490

Query: 354 IASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLR 412
           I   L  L ++E+L L  N L G IP  L    KL  ++L +N  SG IP  +   SNL 
Sbjct: 491 IPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLA 550

Query: 413 FLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSI-PPCFANVLSWRVGSDDVLNGSK 471
            L LG N + G IP +L   Q L  +DL+ N  +GSI PP F    +  V    +L G +
Sbjct: 551 ILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVA---LLTGKR 607

Query: 472 LNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGS 531
               + D   E    GN       FG  R     E+   I  R    F    R       
Sbjct: 608 YVYIKNDGSKECHGAGNLLE----FGGIRQ----EQLDRISTRHPCNFTRVYRGITQPTF 659

Query: 532 NVN-RVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDIS 590
           N N  +  LDLS N+L G IP ++G +  +  LNL +N LSG IP+    LK +  LD+S
Sbjct: 660 NHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLS 719

Query: 591 YNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQK 650
           YN+  G IP  LT+L  L   ++S NNLSG  P+   F TF +  +  N SLC + +   
Sbjct: 720 YNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAPFDTFPDYRFANN-SLCGYPLPLP 778

Query: 651 YSRTLKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVTVILVLIAI 702
            S   K    Q   +   +       +   + +L+  FG       L+++AI
Sbjct: 779 CSSGPKSDANQHQKSHRRQASLAGSVAMGLLFSLFCIFG-------LIIVAI 823




Receptor with a serine/threonine-protein kinase activity. Involved in the perception of systemin, a peptide hormone responsible for the systemic activation of defense genes in leaves of wounded plants. May also regulate, in response to brassinosteroid binding, a signaling cascade involved in plant development.
Solanum peruvianum (taxid: 4082)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query735
358345471 933 Receptor kinase [Medicago truncatula] gi 0.968 0.763 0.470 1e-160
359482749 1067 PREDICTED: leucine-rich repeat receptor 0.963 0.663 0.448 1e-159
357468861 1016 Receptor-like protein kinase [Medicago t 0.918 0.664 0.455 1e-156
358345693 1011 Receptor-like protein kinase [Medicago t 0.918 0.667 0.455 1e-155
359482735 1097 PREDICTED: receptor-like protein 12-like 0.961 0.644 0.436 1e-154
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.963 0.690 0.435 1e-153
255553269 2793 receptor-kinase, putative [Ricinus commu 0.897 0.236 0.475 1e-152
359483163 1047 PREDICTED: LRR receptor-like serine/thre 0.965 0.678 0.444 1e-152
358345705703 Receptor protein kinase-like protein [Me 0.911 0.953 0.447 1e-151
357468869703 Receptor protein kinase-like protein [Me 0.911 0.953 0.447 1e-151
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 357/758 (47%), Positives = 461/758 (60%), Gaps = 46/758 (6%)

Query: 1   MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMF 60
           ++L RN +      CL+NLT L++LD+SSN   G++PS I +L SLEYL L   NF+G+F
Sbjct: 187 LDLSRNGMSGYFPQCLRNLTSLRVLDLSSNNFVGNIPSFIISLKSLEYLSLFDTNFDGIF 246

Query: 61  PLSSLANHSKLEGLLLSTRNNTLHVKTE---NWLPTSQLIVLGLTKCNLN----GSYPDF 113
             SSL NHSKLE  LLS + N L+V+TE   +W PT QL VL L  C LN    G++P F
Sbjct: 247 SFSSLNNHSKLEVFLLSPKTNNLYVETEESPSWHPTFQLKVLQLRNCFLNSKRDGTFPTF 306

Query: 114 LLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLD 173
           LL+Q+ L+ LDLSHNKL GNFP+W+L NN KLE L L NNSF+G L+LP  KH  L  L 
Sbjct: 307 LLYQHELQLLDLSHNKLSGNFPSWILENNTKLETLYLMNNSFTGTLELPTFKHGLLD-LQ 365

Query: 174 ISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLS 233
           IS N   G+L  ++G I   L Y+++SKN FEG +P S GEM+ +  LDLS N FSG LS
Sbjct: 366 ISNNKIGGQLQEDIGKIFPNLYYVNLSKNSFEGILPSSIGEMQTIRTLDLSNNNFSGELS 425

Query: 234 QSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQV 293
             +++   SL LL LS+N+F G       NLTRL  LY  NN+FSG I+DG+ +++SL  
Sbjct: 426 SHLISNLTSLRLLRLSHNSFHG-LVPLLSNLTRLNWLYLNNNSFSGVIEDGVSNNSSLFS 484

Query: 294 LDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGP 353
           LDISNNMLSG IP W+G F+ +L +LS+SKN L+G +P +L NL  L  LD+SEN LS  
Sbjct: 485 LDISNNMLSGRIPRWIGRFT-KLSVLSLSKNRLQGEIPNELCNLISLSYLDLSENNLSDF 543

Query: 354 IASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLR 412
           +     N   ++ L LQKNAL G IP    +  KL +L+LRDN F G IP  IN  S LR
Sbjct: 544 LPYCFKNFKYMKFLYLQKNALQGNIPYAFSQLTKLTSLDLRDNNFFGNIPQWINRLSKLR 603

Query: 413 FLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKL 472
            LLL GN L GPIP  +C+L+ + +MDLS N  + +IPPC  N+    V       G + 
Sbjct: 604 VLLLAGNKLTGPIPIYVCELEHVRIMDLSHNWINETIPPCIKNISFKMVEFQTTAVGGRA 663

Query: 473 NSPELDEEIEFGSLGNNRSSNTMFGMWRWL-----------SALEKRAAID-------ER 514
              + D + +    GN  +S        W            S+L     I        E 
Sbjct: 664 VQNDNDSKDKIQYYGNTATSYIFLVDDIWFTPGNTFDIFYNSSLSLNHPIADEYMISYEI 723

Query: 515 VEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSI 574
           VEIEF  K+ Y  Y G+N+N +TGLDLS N L+G IP +IG+L+ I ALNLS+N  SGSI
Sbjct: 724 VEIEFRTKSYYLSYKGNNLNLMTGLDLSSNNLSGSIPPEIGELRDIKALNLSHNRFSGSI 783

Query: 575 PESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDES 634
           P +F NL  IESLD+SYN L+G +P  LT L  L+IFNVSYN  SGR P   QFA FDE+
Sbjct: 784 PGTFPNLINIESLDLSYNNLSGALPQNLTNLYSLAIFNVSYNKFSGRVPTTMQFANFDEN 843

Query: 635 SYRGNPSLCAWLIQQKYSRT--LKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASY 692
           +YRGN  LC  +I    + T    P +T               ++AIDM + Y S  ASY
Sbjct: 844 NYRGNSDLCGSVINITCNHTSIFPPASTT------------QHQTAIDMESFYWSCVASY 891

Query: 693 VTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSK 730
           VTV++ L  ILW+NS+W R+WF  +D CI   +Y  S+
Sbjct: 892 VTVVIGLAVILWVNSHWCRVWFRYVDLCI---FYCFSR 926




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482749|ref|XP_002262614.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359482735|ref|XP_003632821.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359483163|ref|XP_002263908.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358345705|ref|XP_003636916.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355502851|gb|AES84054.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468869|ref|XP_003604719.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355505774|gb|AES86916.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query735
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.957 0.729 0.414 5.8e-137
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.960 0.651 0.415 5.8e-137
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.953 0.718 0.426 2e-136
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.938 0.774 0.404 1.1e-124
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.942 0.741 0.380 5.9e-112
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.801 0.589 0.402 5.3e-104
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.556 0.450 0.450 1.8e-80
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.842 0.495 0.318 4.1e-67
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.855 0.502 0.317 5e-66
TAIR|locus:2020457 1166 BRL1 "BRI1 like" [Arabidopsis 0.861 0.542 0.318 3.3e-64
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1341 (477.1 bits), Expect = 5.8e-137, P = 5.8e-137
 Identities = 301/726 (41%), Positives = 429/726 (59%)

Query:     1 MNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMF 60
             ++L +N +   L +CL +LT L++LD+SSN+L G++PS + +L SLEYL L  N+FEG F
Sbjct:   249 LDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSF 308

Query:    61 PLSSLANHSKLEGLLLSTRNNTLHVKTEN-WLPTSQLIVLGLTKCNLNGSYPDFLLHQYH 119
                SLAN S L  L L +++++L V +E+ W P  QL V+ L  CN+    P FLLHQ  
Sbjct:   309 SFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNME-KVPHFLLHQKD 367

Query:   120 LKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNF 179
             L+++DLS N + G  P+WLL NN KL+VLLL+NN F+   Q+PK+ H+ L  LD+S N+F
Sbjct:   368 LRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSF-QIPKSAHNLLF-LDVSANDF 425

Query:   180 RGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTG 239
                 P N+G I   L Y++ SKN F+ N+P S G M  +  +DLSRN F G L +S V G
Sbjct:   426 NHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNG 485

Query:   240 CFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNN 299
             C+S+ +L LS+N   G+ F E  N T +  L+ +NN F+GKI  GL S  +L++LD+SNN
Sbjct:   486 CYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNN 545

Query:   300 MLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLN 359
              L+G IP W+G   S L  L +S N L+G++P+ L N   L++LD+S N LSG I    +
Sbjct:   546 NLTGVIPSWIGELPS-LTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHD 604

Query:   360 LSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGN 419
               +   L LQ N L+G IP  L  + ++  L+LR+N FSG+IP  IN   N+  LLL GN
Sbjct:   605 SRNGVVLLLQDNKLSGTIPDTLLANVEI--LDLRNNRFSGKIPEFINIQ-NISILLLRGN 661

Query:   420 HLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSD----DVLNGSKLNSP 475
             +  G IP QLC L  + ++DLS N+ +G+IP C +N  S+  G +    D   G    S 
Sbjct:   662 NFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNT-SFGFGKECTSYDYDFGISFPSD 720

Query:   476 ELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNR 535
               +         +N++    F     L  L        + +IEFA K+RY+ Y G N+  
Sbjct:   721 VFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKL 780

Query:   536 VTGLDLSCNQLTGEIPSDIGQLQAILAXXXXXXXXXGSIPESFSNLKMIESLDISYNKLT 595
             + G+DLS N+L+GEIP + G L  + A         G IP+S S+++ +ES D+S+N+L 
Sbjct:   781 LFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQ 840

Query:   596 GQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTL 655
             G+IP QLT L  LS+F VS+NNLSG  P   QF TFD  SY GN  LC     Q  +R+ 
Sbjct:   841 GRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCG----QPTNRSC 896

Query:   656 KPTTTQASGAXXXXXXXXXXXSAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFY 715
                + + +             S IDMV+ Y SF A+YVT+++ ++A L  +S W R WFY
Sbjct:   897 NNNSYEEAD-----NGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFWFY 951

Query:   716 SIDRCI 721
              +D  I
Sbjct:   952 KVDAFI 957


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020457 BRL1 "BRI1 like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037625001
SubName- Full=Chromosome chr9 scaffold_90, whole genome shotgun sequence; (772 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query735
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-67
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-47
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  238 bits (610), Expect = 3e-67
 Identities = 186/637 (29%), Positives = 283/637 (44%), Gaps = 95/637 (14%)

Query: 13  ITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLE 72
           ITC  N +R+  +D+S   ++G + S I  L  ++ ++LS+N   G  P           
Sbjct: 63  ITC-NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIP----------- 110

Query: 73  GLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVG 132
                                                  D       L+YL+LS+N   G
Sbjct: 111 --------------------------------------DDIFTTSSSLRYLNLSNNNFTG 132

Query: 133 NFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQ 192
           + P   +   P LE L L NN  SG +         L  LD+  N   GK+P+++   L 
Sbjct: 133 SIPRGSI---PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN-LT 188

Query: 193 KLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNN 252
            L ++ ++ N   G IP   G+MK L  + L  N  SG +    + G  SL  LDL  NN
Sbjct: 189 SLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYE-IGGLTSLNHLDLVYNN 247

Query: 253 FEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNF 312
             G   S   NL  L++L+   N  SG I   + S   L  LD+S+N LSG IP  +   
Sbjct: 248 LTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQL 307

Query: 313 SSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL----NLSSVEHLSL 368
            + LEIL +  N+  G +PV L +L RL++L +  N+ SG I  +L    NL+    L L
Sbjct: 308 QN-LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTV---LDL 363

Query: 369 QKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQ 428
             N L G IP  L  S  L  L L  N+  G IP  +    +LR + L  N   G +P +
Sbjct: 364 STNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSE 423

Query: 429 LCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGN 488
             +L  +  +D+S N   G I     N   W + S  +L+ ++                 
Sbjct: 424 FTKLPLVYFLDISNNNLQGRI-----NSRKWDMPSLQMLSLAR----------------- 461

Query: 489 NRSSNTMFGMWRWLSALEKRAAID-ERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLT 547
               N  FG        ++   +D  R +   A+  +       +++ +  L LS N+L+
Sbjct: 462 ----NKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKL-----GSLSELMQLKLSENKLS 512

Query: 548 GEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNF 607
           GEIP ++   + +++L+LS+N LSG IP SFS + ++  LD+S N+L+G+IP  L  +  
Sbjct: 513 GEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVES 572

Query: 608 LSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCA 644
           L   N+S+N+L G  P  G F   + S+  GN  LC 
Sbjct: 573 LVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 735
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PLN03150623 hypothetical protein; Provisional 99.61
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.39
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
PLN03150623 hypothetical protein; Provisional 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.77
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
PRK15386426 type III secretion protein GogB; Provisional 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG4341483 consensus F-box protein containing LRR [General fu 97.93
KOG4341483 consensus F-box protein containing LRR [General fu 97.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.54
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.35
KOG4308478 consensus LRR-containing protein [Function unknown 92.91
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.73
KOG4308478 consensus LRR-containing protein [Function unknown 92.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.75
smart0037026 LRR Leucine-rich repeats, outliers. 90.75
smart0037026 LRR Leucine-rich repeats, outliers. 90.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.24
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.22
KOG0473 326 consensus Leucine-rich repeat protein [Function un 84.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.05
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.77
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.1e-67  Score=627.48  Aligned_cols=543  Identities=34%  Similarity=0.507  Sum_probs=510.4

Q ss_pred             CCCCCEEeCCCCcCCCCcchhhhCCCCCCEEeCCCCcccccCChhhhhcCCCCCeeecccccccccccCCCCCCCCCeeE
Q 004704           19 LTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIV   98 (735)
Q Consensus        19 l~~L~~L~Ls~n~i~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~   98 (735)
                      ..+++.|||++|.+++.+|.+|..+++|++|+|++|++++.+|...+.++++|++|++++|++.+.++.   ..+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCE
Confidence            457999999999999999999999999999999999999999977778999999999999998776664   35789999


Q ss_pred             EEeeCCCCCCCCchhhhCCCCCCEEEccCCcCcccCchHHHhCCCCCcEEECcCCcCcccCcCCcCCCCCcCEEEccCCc
Q 004704           99 LGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNN  178 (735)
Q Consensus        99 L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~  178 (735)
                      |+|++|.+.+.+|..++++++|++|++++|.+.+.+|..+. ++++|++|++++|.+.+..|..+..+++|++|++++|.
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT-NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN  223 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhh-hCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCc
Confidence            99999999999999999999999999999999988998764 89999999999999999999999999999999999999


Q ss_pred             CCCcCChhHHHhcccCcEEECcCCcCCCCCCcccCCCCCCCEEECCCccccCccchhhhhCCCCCCEEEccCCCCCCcCc
Q 004704          179 FRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFF  258 (735)
Q Consensus       179 l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~  258 (735)
                      +.+.+|..+.. +++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+ ..+++|++|++++|.+.+..|
T Consensus       224 l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~Ls~n~l~~~~p  301 (968)
T PLN00113        224 LSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEIP  301 (968)
T ss_pred             cCCcCChhHhc-CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhH-hhccCcCEEECcCCeeccCCC
Confidence            99999998876 8999999999999999999999999999999999999998888776 479999999999999999999


Q ss_pred             ccccCCCCCCEEEccccccCccccccccCCCCCCEEEeeCCccCCCCCchhhhhcccCcEEEcCCCcCCCCCCccCCCCC
Q 004704          259 SEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLE  338 (735)
Q Consensus       259 ~~~~~l~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~p~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~  338 (735)
                      ..+.++++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..++.+.. |+.|++++|++.+.+|..+..++
T Consensus       302 ~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~-L~~L~Ls~n~l~~~~p~~~~~~~  380 (968)
T PLN00113        302 ELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNN-LTVLDLSTNNLTGEIPEGLCSSG  380 (968)
T ss_pred             hhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCC-CcEEECCCCeeEeeCChhHhCcC
Confidence            99999999999999999999999999999999999999999999999999999877 99999999999999999999999


Q ss_pred             CCCEEEcccCCCCccCCCcc-CCCCccEEEccCCcccccCcccccCCCCCcEEeCCCCcccccCChhhhCCCCccEEEcc
Q 004704          339 RLRILDISENRLSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLG  417 (735)
Q Consensus       339 ~L~~L~L~~n~l~~~~~~~~-~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~  417 (735)
                      +|+.|++++|++.+..+..+ .+++|+.|++++|.+++..|..+..+++|+.|++++|.+++.+|..+..+++|+.|+++
T Consensus       381 ~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~  460 (968)
T PLN00113        381 NLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLA  460 (968)
T ss_pred             CCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECc
Confidence            99999999999998888776 89999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCchhhhcCCCCCEEECcCCcCCCCCCchhhcccccccccCCccCCCCCCCcccchhhhcccCCCCCCCccccc
Q 004704          418 GNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFG  497 (735)
Q Consensus       418 ~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  497 (735)
                      +|++.+.+|..+ ..++|+.|++++|++++.+|..+.++                                         
T Consensus       461 ~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l-----------------------------------------  498 (968)
T PLN00113        461 RNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSL-----------------------------------------  498 (968)
T ss_pred             CceeeeecCccc-ccccceEEECcCCccCCccChhhhhh-----------------------------------------
Confidence            999998888765 46899999999999999888776543                                         


Q ss_pred             hhhhhhhhhhhhccccceeEEEEeccccccccCCcccccceEECCCCcccCCCCccccccccCCeEeCCCCcCcccCccc
Q 004704          498 MWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPES  577 (735)
Q Consensus       498 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~  577 (735)
                                                          ++|+.|+|++|++.+.+|..++.+++|++|+|++|.+++.+|..
T Consensus       499 ------------------------------------~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  542 (968)
T PLN00113        499 ------------------------------------SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPAS  542 (968)
T ss_pred             ------------------------------------hccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChh
Confidence                                                56788999999999999999999999999999999999999999


Q ss_pred             ccCcCCCCEEeCCCCcccccCCccccCCCCCCeEEcccCcCcccCCCCCCCCccCCcccCCCCCCCCcc
Q 004704          578 FSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWL  646 (735)
Q Consensus       578 ~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~gN~~lc~~~  646 (735)
                      |+++++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|..+++.++...+|.|||.+|+..
T Consensus       543 ~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        543 FSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             HhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999853



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query735
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-54
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-04
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-54
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-04
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-15
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-08
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 8e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 7e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 211 bits (537), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 206/672 (30%), Positives = 313/672 (46%), Gaps = 60/672 (8%) Query: 1 MNLERNFIGSPL--ITCLKNLTRLKILDISSNQLNGSLPSVISN---LTSLEYLDLSHNN 55 ++L RN + P+ +T L + + LK L++SSN L+ P +S L SLE LDLS N+ Sbjct: 105 LDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--FPGKVSGGLKLNSLEVLDLSANS 162 Query: 56 FEGMFPLSSLANHS--KLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDF 113 G + + + +L+ L +S + V + L L ++ N + P F Sbjct: 163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV---NLEFLDVSSNNFSTGIP-F 218 Query: 114 LLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLD 173 L L++LD+S NKL G+F + + +L++L + +N F G +P L +L Sbjct: 219 LGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVG--PIPPLPLKSLQYLS 275 Query: 174 ISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLS 233 ++ N F G++P + L +D+S N F G +P G L L LS N FSG L Sbjct: 276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP 335 Query: 234 QSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQV 293 + L++LDLS N F G+ NL S SL Sbjct: 336 MDTLLKMRGLKVLDLSFNEFSGELPESLTNL-----------------------SASLLT 372 Query: 294 LDISNNMLSGHI-PHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSG 352 LD+S+N SG I P+ N + L+ L + N G +P L+N L L +S N LSG Sbjct: 373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 432 Query: 353 PIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNL 411 I SSL +LS + L L N L G IP EL L TL L N +G IP ++ +NL Sbjct: 433 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 492 Query: 412 RFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLS--WRVGSDDVLNG 469 ++ L N L G IP + +L+ LA++ LS N FSG+IP + S W + ++ NG Sbjct: 493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG 552 Query: 470 SKLNSPELDEEIEFGS----------LGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEF 519 + + + + + + + N+ G L R+ R+ Sbjct: 553 T-IPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN 611 Query: 520 AMKNRYEIYNG------SNVNRVTGLDLSCNQLTGEIPSDIGQLQAILAXXXXXXXXXGS 573 +Y G N + LD+S N L+G IP +IG + + GS Sbjct: 612 PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGS 671 Query: 574 IPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDE 633 IP+ +L+ + LD+S NKL G+IP ++AL L+ ++S NNLSG P+ GQF TF Sbjct: 672 IPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPP 731 Query: 634 SSYRGNPSLCAW 645 + + NP LC + Sbjct: 732 AKFLNNPGLCGY 743
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query735
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-160
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-99
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-40
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-54
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-42
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-40
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  480 bits (1239), Expect = e-160
 Identities = 192/645 (29%), Positives = 289/645 (44%), Gaps = 47/645 (7%)

Query: 6   NFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVI---SNLTSLEYLDLSHNNFEGMFPL 62
                  ++    L  L++LD+S+N ++G+             L++L +S N   G   +
Sbjct: 137 TLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV 196

Query: 63  SSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKY 122
           S   N                            L  L ++  N +   P FL     L++
Sbjct: 197 SRCVN----------------------------LEFLDVSSNNFSTGIP-FLGDCSALQH 227

Query: 123 LDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGK 182
           LD+S NKL G+F   +     +L++L + +N F G   +P      L +L ++ N F G+
Sbjct: 228 LDISGNKLSGDFSRAI-STCTELKLLNISSNQFVG--PIPPLPLKSLQYLSLAENKFTGE 284

Query: 183 LPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFS 242
           +P  +      L  +D+S N F G +P   G    L  L LS N FSG L    +     
Sbjct: 285 IPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG 344

Query: 243 LELLDLSNNNFEGQFFSEYMNLT-RLRHLYFENNNFSGKI--KDGLLSSTSLQVLDISNN 299
           L++LDLS N F G+      NL+  L  L   +NNFSG I          +LQ L + NN
Sbjct: 345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN 404

Query: 300 MLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL- 358
             +G IP  + N S  L  L +S N+L G +P  L +L +LR L +  N L G I   L 
Sbjct: 405 GFTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 463

Query: 359 NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGG 418
            + ++E L L  N L G IP  L     L  ++L +N  +G IP  I    NL  L L  
Sbjct: 464 YVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 419 NHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELD 478
           N   G IP +L   + L  +DL+ N F+G+IP            + + + G +    + D
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK--QSGKIAANFIAGKRYVYIKND 581

Query: 479 EEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTG 538
              +      N            L+ L  R   +    I   +   +      N   +  
Sbjct: 582 GMKKECHGAGNLLEFQGIRS-EQLNRLSTRNPCN----ITSRVYGGHTSPTFDNNGSMMF 636

Query: 539 LDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQI 598
           LD+S N L+G IP +IG +  +  LNL +N +SGSIP+   +L+ +  LD+S NKL G+I
Sbjct: 637 LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRI 696

Query: 599 PPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLC 643
           P  ++AL  L+  ++S NNLSG  P+ GQF TF  + +  NP LC
Sbjct: 697 PQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLC 741


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query735
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.34
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.82
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.98
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.82
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-78  Score=701.95  Aligned_cols=634  Identities=32%  Similarity=0.441  Sum_probs=497.0

Q ss_pred             cCCCCCCCCcccc--ccCCCCCCCEEeCCCCcCCCCcchhh-hCCCCCCEEeCCCCcccccCChhh--hhcCCCCCeeec
Q 004704            2 NLERNFIGSPLIT--CLKNLTRLKILDISSNQLNGSLPSVI-SNLTSLEYLDLSHNNFEGMFPLSS--LANHSKLEGLLL   76 (735)
Q Consensus         2 ~Ls~n~l~~~~~~--~~~~l~~L~~L~Ls~n~i~~~~p~~~-~~l~~L~~L~Ls~n~l~~~~~~~~--~~~l~~L~~L~L   76 (735)
                      ||++|.++|.+|.  .|+++++|++|+|++|.+++.+|..+ .++++|++||+++|++++..|...  +.++++|++|++
T Consensus       106 ~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~L  185 (768)
T 3rgz_A          106 DLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAI  185 (768)
T ss_dssp             ECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEEC
T ss_pred             ECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEEC
Confidence            4444444444444  44444444444444444444444333 444444444444444444333111  455556666666


Q ss_pred             ccccccccccCCCCCCCCCeeEEEeeCCCCCCCCchhhhCCCCCCEEEccCCcCcccCchHHHhCCCCCcEEECcCCcCc
Q 004704           77 STRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFS  156 (735)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~  156 (735)
                      ++|.+.+..+   +..+++|++|++++|++.+.+|. +.++++|++|++++|++++.+|..+ ..+++|++|++++|.++
T Consensus       186 s~n~l~~~~~---~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~Ls~n~l~  260 (768)
T 3rgz_A          186 SGNKISGDVD---VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISSNQFV  260 (768)
T ss_dssp             CSSEEESCCB---CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEECCSSCCE
T ss_pred             CCCcccccCC---cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEECCCCccc
Confidence            6555543332   36778999999999999988877 8999999999999999987777765 58999999999999998


Q ss_pred             ccCcCCcCCCCCcCEEEccCCcCCCcCChhHHHhcccCcEEECcCCcCCCCCCcccCCCCCCCEEECCCccccCccchhh
Q 004704          157 GILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSV  236 (735)
Q Consensus       157 ~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~  236 (735)
                      +..|..  .+++|++|++++|.+++.+|..++..+++|++|++++|.+++.+|..++.+++|++|++++|.+++.+|...
T Consensus       261 ~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~  338 (768)
T 3rgz_A          261 GPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDT  338 (768)
T ss_dssp             ESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHH
T ss_pred             CccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHH
Confidence            876654  789999999999999999999988767999999999999999999999999999999999999998999887


Q ss_pred             hhCCCCCCEEEccCCCCCCcCcccccCCC-CCCEEEccccccCccccccccC--CCCCCEEEeeCCccCCCCCchhhhhc
Q 004704          237 VTGCFSLELLDLSNNNFEGQFFSEYMNLT-RLRHLYFENNNFSGKIKDGLLS--STSLQVLDISNNMLSGHIPHWMGNFS  313 (735)
Q Consensus       237 ~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~l~~--~~~L~~L~l~~n~l~~~~p~~~~~~~  313 (735)
                      +..+++|++|++++|.+++.+|..+..++ +|++|++++|.+++.+|..+..  +++|++|++++|.+++.+|..+..++
T Consensus       339 l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~  418 (768)
T 3rgz_A          339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS  418 (768)
T ss_dssp             HTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCT
T ss_pred             HhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCC
Confidence            78899999999999999988899888887 9999999999999888888776  78999999999999999999999988


Q ss_pred             ccCcEEEcCCCcCCCCCCccCCCCCCCCEEEcccCCCCccCCCcc-CCCCccEEEccCCcccccCcccccCCCCCcEEeC
Q 004704          314 SELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNL  392 (735)
Q Consensus       314 ~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~-~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l  392 (735)
                      . |+.|++++|++++.+|..+..+++|++|++++|.+.+.++..+ .+++|++|++++|.+++.+|..+..+++|++|++
T Consensus       419 ~-L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L  497 (768)
T 3rgz_A          419 E-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISL  497 (768)
T ss_dssp             T-CCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             C-CCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEc
Confidence            7 9999999999999999999999999999999999998888777 8999999999999999999999999999999999


Q ss_pred             CCCcccccCChhhhCCCCccEEEccCCcCCCCCchhhhcCCCCCEEECcCCcCCCCCCchhhcccccccccCCccCCCCC
Q 004704          393 RDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKL  472 (735)
Q Consensus       393 ~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~l~~~~~~~~~~~~~  472 (735)
                      ++|++++.+|.+++.+++|++|++++|++.+.+|..+..+++|+.|++++|+++|.+|..+.....+....  ...+...
T Consensus       498 ~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~--~~~~~~~  575 (768)
T 3rgz_A          498 SNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN--FIAGKRY  575 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCS--TTCSCEE
T ss_pred             cCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhh--ccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999887654322110  0000000


Q ss_pred             ---CCcccchhhhcccCCCCCCCccccchhhhhhhhhhhhccccceeEEEEeccccccccCCcccccceEECCCCcccCC
Q 004704          473 ---NSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGE  549 (735)
Q Consensus       473 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~  549 (735)
                         ........ ....................+.....   .....   ....+... .....+++|+.|||++|+++|.
T Consensus       576 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~---~~l~~---~~~~g~~~-~~~~~l~~L~~LdLs~N~l~g~  647 (768)
T 3rgz_A          576 VYIKNDGMKKE-CHGAGNLLEFQGIRSEQLNRLSTRNP---CNITS---RVYGGHTS-PTFDNNGSMMFLDMSYNMLSGY  647 (768)
T ss_dssp             EEEECCSCCTT-CCSSEEEEECTTCCGGGGGGGGGTCC---SCTTS---CEEEEECC-CSCSSSBCCCEEECCSSCCBSC
T ss_pred             ccccccccccc-ccccccccccccccchhhhccccccc---ccccc---ceecccCc-hhhhccccccEEECcCCccccc
Confidence               00000000 00000000000000000000000000   00000   00001100 1123568899999999999999


Q ss_pred             CCccccccccCCeEeCCCCcCcccCcccccCcCCCCEEeCCCCcccccCCccccCCCCCCeEEcccCcCcccCCCCCCCC
Q 004704          550 IPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFA  629 (735)
Q Consensus       550 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~  629 (735)
                      +|.+++.+++|+.|+|++|+++|.+|..|+++++|++||||+|+++|.+|..+..+++|++||+++|+++|.+|+.++|.
T Consensus       648 ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~  727 (768)
T 3rgz_A          648 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFE  727 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGG
T ss_pred             CCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcccCCCCCCCCccccCCCCCC
Q 004704          630 TFDESSYRGNPSLCAWLIQQKYSRT  654 (735)
Q Consensus       630 ~~~~~~~~gN~~lc~~~~~~~~~~~  654 (735)
                      ++...+|.|||++||.++. .|...
T Consensus       728 ~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          728 TFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             GSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             cCCHHHhcCCchhcCCCCc-CCCCC
Confidence            9999999999999999876 67543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 735
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 88.5 bits (218), Expect = 2e-19
 Identities = 65/365 (17%), Positives = 110/365 (30%), Gaps = 28/365 (7%)

Query: 16  LKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLL 75
             +L ++  L      +  S+   +  L +L  ++ S+N    + PL +L     +    
Sbjct: 40  QTDLDQVTTLQADRLGIK-SIDG-VEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNN 97

Query: 76  LSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFP 135
               + T      N    +           L        L        D+S    + +  
Sbjct: 98  NQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQ 157

Query: 136 TWLLRNNPKLEVLLLKNNSF--------SGILQLPKAKHDFLHHLDISCNNFRGKLPHNM 187
                N       L    +                 AK   L  L  + N      P  +
Sbjct: 158 QLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGI 217

Query: 188 GVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLD 247
              L +L    ++ N  +     +   +  L+ LDL+ N  S     S   G   L  L 
Sbjct: 218 LTNLDEL---SLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAPLS---GLTKLTELK 269

Query: 248 LSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPH 307
           L  N       S    LT L +L    N          L   +L  L +  N +S   P 
Sbjct: 270 LGANQISN--ISPLAGLTALTNLELNENQLEDISPISNL--KNLTYLTLYFNNISDISP- 324

Query: 308 WMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLS 367
            + + +  L+ L  + N +       L NL  +  L    N++S     + NL+ +  L 
Sbjct: 325 -VSSLTK-LQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTPLA-NLTRITQLG 379

Query: 368 LQKNA 372
           L   A
Sbjct: 380 LNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query735
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.63
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=6.9e-32  Score=276.93  Aligned_cols=254  Identities=35%  Similarity=0.564  Sum_probs=211.1

Q ss_pred             CcEEEcCCCcCCC--CCCccCCCCCCCCEEEccc-CCCCccCCCcc-CCCCccEEEccCCcccccCcccccCCCCCcEEe
Q 004704          316 LEILSMSKNHLEG--NVPVQLNNLERLRILDISE-NRLSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLN  391 (735)
Q Consensus       316 L~~L~l~~n~l~~--~~~~~l~~l~~L~~L~L~~-n~l~~~~~~~~-~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~  391 (735)
                      ++.|++++|.+.+  .+|..+.++++|++|++++ |+++|.+|..+ ++++|++|++++|++.+..+..+..+.+|+.++
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~  131 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD  131 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE
T ss_pred             EEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccc
Confidence            5556666665554  3556666666666666664 56666555544 667777777777777777777788888888999


Q ss_pred             CCCCcccccCChhhhCCCCccEEEccCCcCCCCCchhhhcCCCC-CEEECcCCcCCCCCCchhhcccccccccCCccCCC
Q 004704          392 LRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKL-AMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGS  470 (735)
Q Consensus       392 l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~Ls~N~l~~~~p~~~~~l~~l~~~~~~~~~~~  470 (735)
                      +++|.+.+.+|..+..++.++.+++++|.+.+.+|+.+..+..+ +.+++++|++++..|..+..+              
T Consensus       132 l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--------------  197 (313)
T d1ogqa_         132 FSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--------------  197 (313)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC--------------
T ss_pred             cccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccc--------------
Confidence            99888888888889999999999999999988888888888776 889999999988877766543              


Q ss_pred             CCCCcccchhhhcccCCCCCCCccccchhhhhhhhhhhhccccceeEEEEeccccccccCCcccccceEECCCCcccCCC
Q 004704          471 KLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEI  550 (735)
Q Consensus       471 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~~  550 (735)
                                                                                      ....++++++...+.+
T Consensus       198 ----------------------------------------------------------------~~~~l~l~~~~~~~~~  213 (313)
T d1ogqa_         198 ----------------------------------------------------------------NLAFVDLSRNMLEGDA  213 (313)
T ss_dssp             ----------------------------------------------------------------CCSEEECCSSEEEECC
T ss_pred             ----------------------------------------------------------------cccccccccccccccc
Confidence                                                                            2335899999999999


Q ss_pred             CccccccccCCeEeCCCCcCcccCcccccCcCCCCEEeCCCCcccccCCccccCCCCCCeEEcccCcCcccCCCCCCCCc
Q 004704          551 PSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFAT  630 (735)
Q Consensus       551 p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~  630 (735)
                      |..++.+++++.+++++|.+++.+| .++.+++|+.|||++|+++|.+|..+.++++|++|||++|+|+|.+|+.+.+..
T Consensus       214 ~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~  292 (313)
T d1ogqa_         214 SVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQR  292 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGG
T ss_pred             ccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCC
Confidence            9999999999999999999997665 589999999999999999999999999999999999999999999999988999


Q ss_pred             cCCcccCCCCCCCCcccc
Q 004704          631 FDESSYRGNPSLCAWLIQ  648 (735)
Q Consensus       631 ~~~~~~~gN~~lc~~~~~  648 (735)
                      ++..++.||+.+||.|+.
T Consensus       293 L~~l~l~~N~~l~g~plp  310 (313)
T d1ogqa_         293 FDVSAYANNKCLCGSPLP  310 (313)
T ss_dssp             SCGGGTCSSSEEESTTSS
T ss_pred             CCHHHhCCCccccCCCCC
Confidence            999999999999998764



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure