Citrus Sinensis ID: 004772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-
MASSSSLSSSFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDMADPPNFPSSMASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
ccccccccccccccccccEEEcccccccccccHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEEccccHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEEcccccHHHHHcccccccccccEEEEEEccHHHHHHcccccEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHcccccccccHHHHHHEccccccccHHHHHHHHcccccccccHHHHcccccEEEEccEEEccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccEEEEEEEcc
ccccccccccccccccEEEEEccccHcHHHHHHHHHHHHHHHccccEEEcccHHccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccccHcHHHHHHHHHHHHHHHccccEEEccccHccccccccHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHccEEEEEccccEEHHHHHHHHHHHHHHccccccccccEEcccHHHHHHHHHccccccEEEEEEEEc
masssslsssftaksKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFiddeqepqkgdeispAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDckkrngqtvvpvfykvsppavrKQRLSFGeafvhhesnfsdkVQVQKWRDSLTqasnisgfyasrsfrnDAELVEKIAEDISKKLkdmadppnfpssmasssclsssftakckydvflsfggeetrtGIGSHLAAALRRKQIELFIDdekeankgdeispavsDAIETSLILIVIFSKDYASSKWCLDELVKILDCLikntgqivvpvfyridssdvhkqkgSFRKAFVHHERNFPDKVQKWREALTKAssiseffvvdprneagdvEKIAQDISKkvedmsdstdlsgfvglnSRIEKIKSLLClelgdvrivgiwgmggigkTTIASVIFHQisgdfqgkcfmknvgeesskmgvIHVRDEVISQVMgenikigtptitpNIKKRLQQRKVLIVLHdvddnsksFAVCLdlfspgsriiittrdkrlLYKRGVQSVCEVKGLKHNSALELFCRKAFrqnnrspdllELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKlklitdpniYKVLKISYDGLNWEEKEIFLDVacffkgedvdfvtrvqddptsmrnglNILVEKSLITISDNRLQMHDMLQEIGKTIirqesfkepgkrsklwdhKDVYQVLKKNKQMNILASIYTIK
masssslsssftakSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELfiddeqepqkgdeispavSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHhesnfsdkvqVQKWRDSLTQasnisgfyasrsfrndAELVEKIAEDISKKLKDMADPPNFPSSMASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEkeankgdeispavsdAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKafvhhernfpdkVQKWREALTKassiseffvvdprneagdVEKIAQDiskkvedmsdsTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVmgenikigtptitpnikkRLQQRKVLIVLHDVDDNSKSFAVCldlfspgsriiittrdkrllyKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLhklklitdpniyKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTrvqddptsmrnglnilvEKSLITISDNRLQMHDMLQEIGKtiirqesfkepgkrsklwdhKDVYqvlkknkqmnilasiytik
MAsssslsssFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDMADPPNFPssmasssclsssFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
***************KYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFI******************AIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSF***************************************SFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFID**************VSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVD***************************LSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNN***DLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQ**********KLWDHKDVYQVLKKNKQMNILASIYT**
*****************DVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDMADPPNFPSSMASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
***********TAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQ*********PAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDMADPPNFP***********SFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
*************KSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDM********SMAS*******FTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSLSSSFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKKLKDMADPPNFPSSMASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIYTIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query731 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.694 0.444 0.402 2e-95
O82500 1095 Putative disease resistan no no 0.697 0.465 0.375 7e-88
O23530 1301 Protein SUPPRESSOR OF npr no no 0.689 0.387 0.380 1e-87
Q9FL92 1372 Probable WRKY transcripti no no 0.621 0.330 0.348 1e-65
Q9SZ67 1895 Probable WRKY transcripti no no 0.666 0.256 0.312 3e-54
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.630 0.285 0.312 2e-52
Q9FH83 1288 Probable WRKY transcripti no no 0.623 0.354 0.319 2e-50
Q9FHE9354 Protein PHLOEM PROTEIN 2- no no 0.247 0.511 0.354 7e-22
Q9C5Q9411 Protein PHLOEM PROTEIN 2- no no 0.183 0.326 0.388 7e-17
Q9SYC9571 Vesicle-associated protei no no 0.184 0.236 0.345 2e-15
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  351 bits (900), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 214/532 (40%), Positives = 323/532 (60%), Gaps = 24/532 (4%)

Query: 212 YDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILI 271
           YDVFLSF GE+TR    SHL   L  K I+ F DD K    G  I   +  AIE S   I
Sbjct: 12  YDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDD-KRLEYGATIPGELCKAIEESQFAI 70

Query: 272 VIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHHER 331
           V+FS++YA+S+WCL+ELVKI++C  +   Q V+P+FY +D S V  QK SF KAF  HE 
Sbjct: 71  VVFSENYATSRWCLNELVKIMECKTR-FKQTVIPIFYDVDPSHVRNQKESFAKAFEEHET 129

Query: 332 NFPDKV---QKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGF 388
            + D V   Q+WR AL +A+++        + +A  + +I   IS K+  +S S  L   
Sbjct: 130 KYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSY-LQNI 188

Query: 389 VGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISG------DFQGKCF 442
           VG+++ +EKI+SLL + +  VRI+GIWGMGG+GKTTIA  IF  + G       F G CF
Sbjct: 189 VGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACF 248

Query: 443 MKNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPN-IKKRLQQRKVLIVLHDVDDN 501
           +K++ E  +K G+  +++ ++S+++ E           + +  RL+ +KVLIVL D+D+ 
Sbjct: 249 LKDIKE--NKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNK 306

Query: 502 S---KSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQ 558
               +  A  LD F  GSRIIITTRDK L+ K  +  + EV  L  + +++LF + AF +
Sbjct: 307 DHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHESIQLFKQHAFGK 364

Query: 559 NNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLK 618
              + +  +LS EV +YA G PLAL+V GS L+     +WK  +  +K  +   I   LK
Sbjct: 365 EVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLK 424

Query: 619 ISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDD-PTSMRNGLNILVEKSLITISD-NR 676
           ISYDGL  +++E+FLD+ACF +GE+ D++ ++ +        GL IL++KSL+ IS+ N+
Sbjct: 425 ISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQ 484

Query: 677 LQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIY 728
           +QMHD++Q++GK I+  +  K+PG+RS+LW  K+V +V+  N     + +I+
Sbjct: 485 VQMHDLIQDMGKYIVNFQ--KDPGERSRLWLAKEVEEVMSNNTGTMAMEAIW 534
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FHE9|P2A08_ARATH Protein PHLOEM PROTEIN 2-LIKE A8 OS=Arabidopsis thaliana GN=PP2A8 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5Q9|P2A05_ARATH Protein PHLOEM PROTEIN 2-LIKE A5 OS=Arabidopsis thaliana GN=PP2A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYC9|VAP14_ARATH Vesicle-associated protein 1-4 OS=Arabidopsis thaliana GN=PVA14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query731
255564976 944 TMV resistance protein N, putative [Rici 0.705 0.546 0.498 1e-137
359495285 1557 PREDICTED: TMV resistance protein N-like 0.945 0.443 0.404 1e-128
359487015 1610 PREDICTED: TMV resistance protein N-like 0.948 0.430 0.405 1e-127
255569048 1084 leucine-rich repeat-containing protein, 0.699 0.471 0.482 1e-127
255561496 876 TMV resistance protein N, putative [Rici 0.703 0.586 0.467 1e-126
359495276 1542 PREDICTED: TMV resistance protein N-like 0.946 0.448 0.401 1e-125
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.697 0.346 0.478 1e-125
255573549 908 ATP binding protein, putative [Ricinus c 0.705 0.568 0.458 1e-124
359493351 2816 PREDICTED: uncharacterized protein LOC10 0.787 0.204 0.454 1e-122
147828597 1500 hypothetical protein VITISV_003859 [Viti 0.950 0.463 0.390 1e-122
>gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 264/530 (49%), Positives = 369/530 (69%), Gaps = 14/530 (2%)

Query: 206 FTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDEISPAVSDAIE 265
           F  + KYDVF+SF GE+TR    SHL AAL +KQI+ F+DD+   ++G+EIS A+   IE
Sbjct: 10  FDPQLKYDVFVSFRGEDTRDNFTSHLYAALHQKQIKAFVDDK--LSRGEEISAALVKVIE 67

Query: 266 TSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKA 325
            S++ ++IFS++YA S WCLDELVKIL+C  K  GQIV+PVFY +D SDV +QKG F  A
Sbjct: 68  ESMVSVIIFSENYAFSPWCLDELVKILECK-KTVGQIVLPVFYHVDPSDVAEQKGGFGAA 126

Query: 326 FVHHERNFP---DKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDS 382
           F+ HE+ F    DK+QKWR ALT+A++IS +     R+E+  +++IA+DI KK+  MS S
Sbjct: 127 FIEHEKCFKERIDKLQKWRAALTEAANISGWSSSVIRSESKLIQEIAEDILKKLNHMSSS 186

Query: 383 TDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCF 442
           TD  G VG+NSRI+KI+ LLC+EL DVR +G+WGMGG GKTT A V+F++IS  F   CF
Sbjct: 187 TDSKGLVGINSRIDKIELLLCVELADVRFLGLWGMGGAGKTTTAEVVFNRISTQFDSCCF 246

Query: 443 MKNVGEESSKMGVIHVRDEVISQVMGE-NIKIGTPTITPNIKKRLQQRKVLIVLHDVDD- 500
           + NV EES + G++ ++ ++ S+++G+ N+           K RL+ RKVLIVL DV++ 
Sbjct: 247 LANVNEESERYGLLKLQRQLFSKLLGQDNVNYAEGIFD---KSRLKHRKVLIVLDDVNNL 303

Query: 501 -NSKSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQN 559
              ++ A   + F PGSRII+T+RDK +L K    ++ +++ L H+ AL+LF   AFRQ 
Sbjct: 304 RQLENLAGEHNWFGPGSRIILTSRDKDVL-KNKTDAIYKIEDLDHHEALQLFSLNAFRQE 362

Query: 560 NRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKI 619
               D ++LS+ V +YA GNPL L+VLGS LYQ++ ++W+  LHKL+  T+  I  VLK+
Sbjct: 363 CPKADYMKLSKRVINYAKGNPLGLKVLGSFLYQRNIKEWESALHKLERSTNKEIQNVLKV 422

Query: 620 SYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPT-SMRNGLNILVEKSLITISDNRLQ 678
           SYDGL+ EEK+IFLDVACFF GED DFVTR+ +    S    +++LV KSL+TIS+N L 
Sbjct: 423 SYDGLDDEEKDIFLDVACFFNGEDRDFVTRILNGCGFSADIAISVLVSKSLLTISNNTLA 482

Query: 679 MHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQVLKKNKQMNILASIY 728
           +H++LQ++G  I+RQES KEPG+RS+L   +DV  VL KN     +  IY
Sbjct: 483 IHNLLQQMGWGIVRQESTKEPGRRSRLCTSEDVVHVLSKNTGTEAIEGIY 532

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359495285|ref|XP_002276740.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487015|ref|XP_003633506.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569048|ref|XP_002525493.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223535172|gb|EEF36851.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359495276|ref|XP_002276447.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573549|ref|XP_002527699.1| ATP binding protein, putative [Ricinus communis] gi|223532930|gb|EEF34698.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493351|ref|XP_002277841.2| PREDICTED: uncharacterized protein LOC100251634 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147828597|emb|CAN68630.1| hypothetical protein VITISV_003859 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query731
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.674 0.248 0.347 4.4e-100
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.692 0.391 0.407 3.2e-97
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.700 0.429 0.418 1.8e-96
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.701 0.448 0.398 5.5e-93
TAIR|locus:2032602 1163 AT1G72860 [Arabidopsis thalian 0.688 0.432 0.413 8.3e-90
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.682 0.467 0.394 4.6e-89
TAIR|locus:2162439 1008 AT5G22690 [Arabidopsis thalian 0.683 0.496 0.401 1.6e-88
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.701 0.420 0.387 4.1e-88
TAIR|locus:2151491 1123 AT5G46450 [Arabidopsis thalian 0.678 0.441 0.395 1.1e-87
TAIR|locus:2122199 1607 AT4G36140 [Arabidopsis thalian 0.586 0.266 0.365 1.8e-87
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 775 (277.9 bits), Expect = 4.4e-100, Sum P(2) = 4.4e-100
 Identities = 178/512 (34%), Positives = 292/512 (57%)

Query:   231 LAAALRRKQIELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVK 290
             L    +RK I  F D+E    +G+ ISP +  AI  S I +++ S++YASS WCLDEL +
Sbjct:  1269 LMKEFQRKGITPFNDNE--IKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAE 1326

Query:   291 ILDCLIKNTGQIVVPVFYRIDSSDVHKQKGSFRKAFVHH-ERNFPDKVQKWREALTKASS 349
             I+ C  +  GQ V+ VFY++D SD+ K  G F   F         +  ++W +AL K ++
Sbjct:  1327 IIKCR-EEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVAT 1385

Query:   350 ISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDV 409
             ++ +   +  NEA  +EKIA DIS K+   + S D    VG+ + +E+++ LLCL+  +V
Sbjct:  1386 LAGYVSNNWDNEAVMIEKIATDISNKLNKSTPSRDFDELVGMGAHMERMELLLCLDSDEV 1445

Query:   410 RIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNVGEESSKMGV--------IHVRDE 461
             R++GIWG  GIGKTTIA  +F Q S  F+   FM+N+ E   +  V        +H++++
Sbjct:  1446 RMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQ 1505

Query:   462 VISQVMGENIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDL--FSPGSRII 519
              +SQ++  ++ +  P +   ++ RL  +KVLIVL ++D + +  A+  +   F  GSRII
Sbjct:  1506 FMSQIIN-HMDVEVPHLGV-VENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRII 1563

Query:   520 ITTRDKRLLYKRGVQSVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGN 579
             ITT+D++LL   G+  + +V     + A ++FC  A  +     +  EL+ EV +     
Sbjct:  1564 ITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNL 1623

Query:   580 PLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFF 639
             PL L+V+GS     SK++W + L +L+   D NI  +LK SYD L  E+K++FL +AC F
Sbjct:  1624 PLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACTF 1683

Query:   640 KGEDVDFV-TRVQDDPTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTII--RQESF 696
               + ++ V   +       +   ++L EKSLI+I +  ++MH++L+ +G+ I+    ES 
Sbjct:  1684 NNKRIENVEAHLTHKFLDTKQRFHVLAEKSLISIEEGWIKMHNLLELLGREIVCHEHESI 1743

Query:   697 KEPGKRSKLWDHKDVYQVLKKNKQMNILASIY 728
             +EPGKR  L D +D+ +VL  +     +  IY
Sbjct:  1744 REPGKRQFLVDARDICEVLTDDTGSKSVVGIY 1775
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2032602 AT1G72860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122199 AT4G36140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01250003
tir-nbs-lrr resistance protein (1470 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query731
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-116
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-37
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 8e-36
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 9e-34
pfam01582135 pfam01582, TIR, TIR domain 2e-33
pfam01582135 pfam01582, TIR, TIR domain 2e-30
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 8e-30
pfam13676102 pfam13676, TIR_2, TIR domain 3e-11
pfam13676102 pfam13676, TIR_2, TIR domain 1e-08
PLN03194187 PLN03194, PLN03194, putative disease resistance pr 1e-08
PLN03194187 PLN03194, PLN03194, putative disease resistance pr 8e-06
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  375 bits (965), Expect = e-116
 Identities = 216/546 (39%), Positives = 309/546 (56%), Gaps = 39/546 (7%)

Query: 196 MASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQIELFIDDEKEANKGDE 255
           MASSS  S ++     YDVF SF GE+ R    SH    L RK I  F D+E E  +   
Sbjct: 1   MASSSSSSRNWV----YDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIE--RSQS 54

Query: 256 ISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDV 315
           + P +  AI  S I +V+FSK+YASS WCL+EL++I+ C  +  GQ+V+PVFY +D S V
Sbjct: 55  LDPELKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCK-EELGQLVIPVFYGLDPSHV 113

Query: 316 HKQKGSFRKAFVHHERNFPDKVQK-WREALTKASSISEFFVVDPRNEAGDVEKIAQDISK 374
            KQ G F +AF    +N  +  +  W++ALT  ++I  +   +  NEA  +E+IA D+  
Sbjct: 114 RKQTGDFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLG 173

Query: 375 KVEDMSDSTDLSGFVGLNSRIEKIKSLLCLELGDVRIVGIWGMGGIGKTTIASVIFHQIS 434
           K+ +++ S D   FVG+   I K+ SLL LE  +VR+VGIWG  GIGKTTIA  +F ++S
Sbjct: 174 KL-NLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLS 232

Query: 435 GDFQGKCFMKNVGEESSKMGV-----------IHVRDEVISQVMGE-NIKIGTPTITPNI 482
             FQ   F+       S               +H++   +S+++ + +IKI        +
Sbjct: 233 RQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIKIYH---LGAM 289

Query: 483 KKRLQQRKVLIVLHDVDDNSKSFAVCLDL-------FSPGSRIIITTRDKRLLYKRGVQS 535
           ++RL+ RKVLI + D+DD        LD        F  GSRII+ T+DK  L   G+  
Sbjct: 290 EERLKHRKVLIFIDDLDDQ-----DVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDH 344

Query: 536 VCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSK 595
           + EV    +  ALE+FCR AF++N+     +EL+ EVA  A   PL L VLGS L  + K
Sbjct: 345 IYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDK 404

Query: 596 EQWKDKLHKLKLITDPNIYKVLKISYDGLN-WEEKEIFLDVACFFKGEDV-DFVTRVQDD 653
           E W D L +L+   D  I K L++SYDGLN  ++K IF  +AC F GE V D    + + 
Sbjct: 405 EDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANS 464

Query: 654 PTSMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKLWDHKDVYQ 713
              +  GL  LV+KSLI + ++ ++MH +LQE+GK I+R +S  EPG+R  L D KD+  
Sbjct: 465 DLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICD 523

Query: 714 VLKKNK 719
           VL+ N 
Sbjct: 524 VLEDNT 529

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information
>gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional Back     alignment and domain information
>gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 731
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN03194187 putative disease resistance protein; Provisional 100.0
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03194187 putative disease resistance protein; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.97
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.87
smart00255140 TIR Toll - interleukin 1 - resistance. 99.82
smart00255140 TIR Toll - interleukin 1 - resistance. 99.72
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.71
PRK04841 903 transcriptional regulator MalT; Provisional 99.7
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.49
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.48
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.46
COG3899 849 Predicted ATPase [General function prediction only 99.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.36
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.29
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.26
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.24
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.23
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.15
PF05729166 NACHT: NACHT domain 99.05
COG3903414 Predicted ATPase [General function prediction only 99.02
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.88
PRK13342413 recombination factor protein RarA; Reviewed 98.85
PRK06893229 DNA replication initiation factor; Validated 98.84
PTZ001121164 origin recognition complex 1 protein; Provisional 98.84
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.72
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.72
PRK12402337 replication factor C small subunit 2; Reviewed 98.68
PRK07471365 DNA polymerase III subunit delta'; Validated 98.63
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.62
PRK00440319 rfc replication factor C small subunit; Reviewed 98.61
PLN03025319 replication factor C subunit; Provisional 98.6
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.59
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.59
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.58
KOG3678832 consensus SARM protein (with sterile alpha and arm 98.58
PRK04195 482 replication factor C large subunit; Provisional 98.58
PRK08727233 hypothetical protein; Validated 98.58
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.57
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.56
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.55
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.55
PF14516331 AAA_35: AAA-like domain 98.52
PRK08084235 DNA replication initiation factor; Provisional 98.52
PRK05642234 DNA replication initiation factor; Validated 98.52
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.52
PTZ00202550 tuzin; Provisional 98.5
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.48
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.46
PRK09112351 DNA polymerase III subunit delta'; Validated 98.46
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK13341 725 recombination factor protein RarA/unknown domain f 98.43
PRK05564313 DNA polymerase III subunit delta'; Validated 98.43
KOG2028554 consensus ATPase related to the helicase subunit o 98.42
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.41
PRK09087226 hypothetical protein; Validated 98.41
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK07940394 DNA polymerase III subunit delta'; Validated 98.41
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.41
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK14087450 dnaA chromosomal replication initiation protein; P 98.4
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.39
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.37
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.37
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.35
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.35
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.35
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.33
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.32
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.31
PRK00149450 dnaA chromosomal replication initiation protein; R 98.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.3
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.29
PRK14088440 dnaA chromosomal replication initiation protein; P 98.29
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.25
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.24
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.23
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.23
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.22
KOG3678832 consensus SARM protein (with sterile alpha and arm 98.21
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.21
PRK03992389 proteasome-activating nucleotidase; Provisional 98.16
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.14
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.13
PRK12422445 chromosomal replication initiation protein; Provis 98.12
PRK06620214 hypothetical protein; Validated 98.12
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.11
PF13173128 AAA_14: AAA domain 98.11
PRK14086617 dnaA chromosomal replication initiation protein; P 98.1
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.08
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.07
PHA02544316 44 clamp loader, small subunit; Provisional 98.06
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.04
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.04
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.99
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.98
PRK05707328 DNA polymerase III subunit delta'; Validated 97.97
CHL00095 821 clpC Clp protease ATP binding subunit 97.97
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.94
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.93
COG0593408 DnaA ATPase involved in DNA replication initiation 97.9
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.9
PRK10865 857 protein disaggregation chaperone; Provisional 97.89
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 97.89
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.88
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 97.88
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.86
PRK07399314 DNA polymerase III subunit delta'; Validated 97.82
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.8
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.73
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.73
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.72
CHL00176638 ftsH cell division protein; Validated 97.71
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.71
PRK08116268 hypothetical protein; Validated 97.69
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.68
PRK09376416 rho transcription termination factor Rho; Provisio 97.68
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.68
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.65
PRK10536262 hypothetical protein; Provisional 97.65
PRK08769319 DNA polymerase III subunit delta'; Validated 97.64
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.64
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.63
cd01128249 rho_factor Transcription termination factor rho is 97.63
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.62
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.6
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.54
CHL00195489 ycf46 Ycf46; Provisional 97.52
PRK08058329 DNA polymerase III subunit delta'; Validated 97.5
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.48
TIGR00767415 rho transcription termination factor Rho. Members 97.46
smart00382148 AAA ATPases associated with a variety of cellular 97.43
PRK12377248 putative replication protein; Provisional 97.41
PRK06871325 DNA polymerase III subunit delta'; Validated 97.41
PRK07993334 DNA polymerase III subunit delta'; Validated 97.4
PRK08181269 transposase; Validated 97.39
CHL00181287 cbbX CbbX; Provisional 97.36
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.34
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.33
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.33
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 97.32
PRK07952244 DNA replication protein DnaC; Validated 97.31
PF00004132 AAA: ATPase family associated with various cellula 97.31
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.3
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.28
PRK06090319 DNA polymerase III subunit delta'; Validated 97.27
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.27
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.24
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.23
PRK06526254 transposase; Provisional 97.22
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.21
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.18
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.18
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.17
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.17
PRK09183259 transposase/IS protein; Provisional 97.15
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.15
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.15
PRK06964342 DNA polymerase III subunit delta'; Validated 97.15
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.12
PRK06835329 DNA replication protein DnaC; Validated 97.12
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.12
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.11
PRK06921266 hypothetical protein; Provisional 97.1
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.1
PRK10865857 protein disaggregation chaperone; Provisional 97.06
PRK08939306 primosomal protein DnaI; Reviewed 97.06
PRK13531 498 regulatory ATPase RavA; Provisional 97.01
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.0
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.99
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.97
PRK04132846 replication factor C small subunit; Provisional 96.95
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.93
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.83
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.82
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.81
PRK07261171 topology modulation protein; Provisional 96.81
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.81
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.8
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.79
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.78
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.76
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.75
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.73
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.73
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 96.73
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.73
PRK04296190 thymidine kinase; Provisional 96.72
CHL00095821 clpC Clp protease ATP binding subunit 96.71
PRK08699325 DNA polymerase III subunit delta'; Validated 96.69
TIGR01817534 nifA Nif-specific regulatory protein. This model r 96.69
PRK06696223 uridine kinase; Validated 96.67
PRK08118167 topology modulation protein; Reviewed 96.66
PRK12608380 transcription termination factor Rho; Provisional 96.66
cd01394218 radB RadB. The archaeal protein radB shares simila 96.65
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.64
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.63
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.62
PHA02244383 ATPase-like protein 96.62
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.61
PRK07667193 uridine kinase; Provisional 96.6
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.59
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.58
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.57
PRK11608326 pspF phage shock protein operon transcriptional ac 96.55
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.54
TIGR02974329 phageshock_pspF psp operon transcriptional activat 96.52
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.52
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.5
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.5
PRK05022509 anaerobic nitric oxide reductase transcription reg 96.49
PRK15429686 formate hydrogenlyase transcriptional activator Fh 96.47
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 96.46
PRK05541176 adenylylsulfate kinase; Provisional 96.42
PHA00729226 NTP-binding motif containing protein 96.41
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.4
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.4
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.4
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.36
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.33
PRK06067234 flagellar accessory protein FlaH; Validated 96.33
PRK00771437 signal recognition particle protein Srp54; Provisi 96.32
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.3
KOG3928461 consensus Mitochondrial ribosome small subunit com 96.19
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.15
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.13
PRK15455 644 PrkA family serine protein kinase; Provisional 96.08
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.07
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 96.06
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 96.05
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.04
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 96.02
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.0
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 95.97
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.95
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.89
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.88
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.87
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.87
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.85
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.85
PRK11823446 DNA repair protein RadA; Provisional 95.85
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 95.84
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.79
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 95.79
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.77
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.77
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 95.7
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 95.7
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.69
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 95.68
PRK09354349 recA recombinase A; Provisional 95.66
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 95.66
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 95.62
PRK06762166 hypothetical protein; Provisional 95.6
PRK07132299 DNA polymerase III subunit delta'; Validated 95.58
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.56
cd03115173 SRP The signal recognition particle (SRP) mediates 95.54
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.54
PF07726131 AAA_3: ATPase family associated with various cellu 95.53
PTZ00301210 uridine kinase; Provisional 95.52
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.52
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.51
PRK14974336 cell division protein FtsY; Provisional 95.51
PRK06217183 hypothetical protein; Validated 95.5
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.5
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.5
PRK08233182 hypothetical protein; Provisional 95.49
PRK05480209 uridine/cytidine kinase; Provisional 95.49
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.44
KOG1969 877 consensus DNA replication checkpoint protein CHL12 95.43
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 95.43
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 95.43
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 95.43
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.41
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.41
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.39
TIGR02329526 propionate_PrpR propionate catabolism operon regul 95.38
TIGR00064272 ftsY signal recognition particle-docking protein F 95.33
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.32
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.32
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.31
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.3
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.29
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.28
PRK00131175 aroK shikimate kinase; Reviewed 95.24
PRK04040188 adenylate kinase; Provisional 95.22
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 95.21
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.2
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.2
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 95.19
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.19
PRK15115444 response regulator GlrR; Provisional 95.18
PRK03839180 putative kinase; Provisional 95.18
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.11
PRK00889175 adenylylsulfate kinase; Provisional 95.11
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.1
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.09
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.07
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 95.07
PRK06547172 hypothetical protein; Provisional 95.04
PRK10867433 signal recognition particle protein; Provisional 95.02
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.99
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.99
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.98
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 94.96
PRK00625173 shikimate kinase; Provisional 94.96
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.94
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.94
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.93
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 94.91
PRK10416318 signal recognition particle-docking protein FtsY; 94.88
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 94.86
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.82
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.81
PRK03846198 adenylylsulfate kinase; Provisional 94.81
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.8
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.79
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.75
PF10137125 TIR-like: Predicted nucleotide-binding protein con 94.74
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.73
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.72
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.7
PRK05439311 pantothenate kinase; Provisional 94.68
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.65
CHL00206 2281 ycf2 Ycf2; Provisional 94.64
TIGR00959428 ffh signal recognition particle protein. This mode 94.61
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.61
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.6
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.6
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.59
PRK10875 615 recD exonuclease V subunit alpha; Provisional 94.57
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.55
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.54
PRK13947171 shikimate kinase; Provisional 94.54
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.54
PF10137125 TIR-like: Predicted nucleotide-binding protein con 94.53
COG3910233 Predicted ATPase [General function prediction only 94.52
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.51
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.5
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.49
cd03246173 ABCC_Protease_Secretion This family represents the 94.48
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.47
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.46
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.42
PRK09435332 membrane ATPase/protein kinase; Provisional 94.42
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 94.4
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.39
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.37
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.35
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.32
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.32
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.3
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.3
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.3
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.29
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.27
PRK05973237 replicative DNA helicase; Provisional 94.26
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.26
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.26
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.26
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 94.26
COG5635 824 Predicted NTPase (NACHT family) [Signal transducti 94.24
COG2884223 FtsE Predicted ATPase involved in cell division [C 94.23
PRK15424538 propionate catabolism operon regulatory protein Pr 94.22
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.19
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.19
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.17
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 94.16
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 94.14
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 94.13
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.13
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.13
PRK15453290 phosphoribulokinase; Provisional 94.11
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.04
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.03
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 94.03
COG0003322 ArsA Predicted ATPase involved in chromosome parti 94.03
PRK13765 637 ATP-dependent protease Lon; Provisional 94.01
PRK14738206 gmk guanylate kinase; Provisional 94.01
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 93.99
PRK07276290 DNA polymerase III subunit delta'; Validated 93.97
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 93.96
PRK12339197 2-phosphoglycerate kinase; Provisional 93.93
PRK05917290 DNA polymerase III subunit delta'; Validated 93.92
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 93.91
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.89
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.89
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.89
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 93.87
PRK13949169 shikimate kinase; Provisional 93.87
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 93.85
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.81
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.8
PF1324576 AAA_19: Part of AAA domain 93.79
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.78
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.74
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 93.71
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.71
PRK13948182 shikimate kinase; Provisional 93.69
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 93.68
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.67
PRK04328249 hypothetical protein; Provisional 93.63
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.63
KOG0736 953 consensus Peroxisome assembly factor 2 containing 93.62
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 93.62
COG0714329 MoxR-like ATPases [General function prediction onl 93.62
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.59
PRK14530215 adenylate kinase; Provisional 93.59
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 93.54
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 93.53
PRK13946184 shikimate kinase; Provisional 93.52
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 93.51
PRK13768253 GTPase; Provisional 93.5
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 93.45
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.44
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 93.42
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.41
PLN02200234 adenylate kinase family protein 93.4
COG4240300 Predicted kinase [General function prediction only 93.36
PRK14527191 adenylate kinase; Provisional 93.34
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.33
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.31
PRK13975196 thymidylate kinase; Provisional 93.3
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 93.29
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.28
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.28
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 93.27
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 93.25
PLN02318 656 phosphoribulokinase/uridine kinase 93.22
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 93.21
PRK04182180 cytidylate kinase; Provisional 93.18
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.14
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 93.13
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 93.1
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 93.1
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.09
PRK00300205 gmk guanylate kinase; Provisional 93.09
PRK05057172 aroK shikimate kinase I; Reviewed 93.07
PRK14737186 gmk guanylate kinase; Provisional 93.07
PTZ00494664 tuzin-like protein; Provisional 93.07
PRK05818261 DNA polymerase III subunit delta'; Validated 93.07
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 93.03
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 93.02
PLN02348395 phosphoribulokinase 93.01
PRK09280463 F0F1 ATP synthase subunit beta; Validated 93.01
cd03116159 MobB Molybdenum is an essential trace element in t 92.99
TIGR01287275 nifH nitrogenase iron protein. This model describe 92.99
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.99
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 92.98
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 92.97
PRK06761282 hypothetical protein; Provisional 92.96
smart00487201 DEXDc DEAD-like helicases superfamily. 92.96
PRK04301317 radA DNA repair and recombination protein RadA; Va 92.95
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 92.95
PF00154322 RecA: recA bacterial DNA recombination protein; In 92.93
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.91
PRK14531183 adenylate kinase; Provisional 92.9
COG4916329 Uncharacterized protein containing a TIR (Toll-Int 92.89
cd03114148 ArgK-like The function of this protein family is u 92.85
PRK03731171 aroL shikimate kinase II; Reviewed 92.85
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.84
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 92.84
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 92.81
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.8
PRK09302509 circadian clock protein KaiC; Reviewed 92.8
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 92.79
PRK14532188 adenylate kinase; Provisional 92.78
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 92.75
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.75
PRK12338319 hypothetical protein; Provisional 92.74
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 92.72
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 92.7
cd02117212 NifH_like This family contains the NifH (iron prot 92.69
COG0703172 AroK Shikimate kinase [Amino acid transport and me 92.67
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 92.66
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.66
KOG0927 614 consensus Predicted transporter (ABC superfamily) 92.64
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.63
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 92.63
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.63
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 92.62
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 92.6
TIGR02236310 recomb_radA DNA repair and recombination protein R 92.58
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 92.56
cd02034116 CooC The accessory protein CooC, which contains a 92.55
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 92.53
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.53
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 92.53
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 92.52
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 92.52
PRK09302 509 circadian clock protein KaiC; Reviewed 92.52
PHA02530300 pseT polynucleotide kinase; Provisional 92.51
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=1.9e-87  Score=818.96  Aligned_cols=523  Identities=40%  Similarity=0.672  Sum_probs=453.5

Q ss_pred             CCCCCCCCCCCCCCCceeEEEeeecccCCCChHHHHHHHHHhCCCeeeecCCCCCCCCCCccHHHHHHHhhccEEEEEec
Q 004772            1 MASSSSLSSSFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFS   80 (731)
Q Consensus         1 m~~~~~~~~~~~~~~~~dvFis~~~~d~~~~f~~~L~~~l~~~~~~~~~d~~~~~~~g~~~~~~i~~~i~~s~~~ivv~S   80 (731)
                      ||||||+|    +.++|||||||||+|+|++|++||+++|.++||++|+|+  ++++|+.|.+++.+||++|+++|||||
T Consensus         1 ~~~~~~~~----~~~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~--~~~~g~~~~~~l~~~i~~s~~~ivv~s   74 (1153)
T PLN03210          1 MASSSSSS----RNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDN--EIERSQSLDPELKQAIRDSRIAVVVFS   74 (1153)
T ss_pred             CCCCCCCC----CCCCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccC--CccCCCcccHHHHHHHHhCeEEEEEec
Confidence            66665543    468999999999999999999999999999999999987  489999999999999999999999999


Q ss_pred             cCccCccccHHHHHHHHHhhhhcCCeeEeEEeecCccccccccCcHHHHHHhhhhcCCChhHHHHHHHHHHHhhcccccc
Q 004772           81 ENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFY  160 (731)
Q Consensus        81 ~~~~~S~wc~~El~~~~~~~~~~~~~v~Pify~v~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~~w~~al~~~~~~~g~~  160 (731)
                      +|||+|.|||+||++|++|+++.+++|+||||+|+|++||+|+|.||++|.+++.+.. .+++++||+||++|++++||+
T Consensus        75 ~~ya~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~~-~~~~~~w~~al~~~~~~~g~~  153 (1153)
T PLN03210         75 KNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKT-EDEKIQWKQALTDVANILGYH  153 (1153)
T ss_pred             CCcccchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcccc-hhHHHHHHHHHHHHhCcCcee
Confidence            9999999999999999999999999999999999999999999999999999987654 457999999999999999996


Q ss_pred             cCCCCCCHHHHHHHHHHhhhhhhccCCCCCCCCCCCccccccCCCCCCcceeeEEEeccccccccChHHHHHHHHhhcCc
Q 004772          161 ASRSFRNDAELVEKIAEDISKKLKDMADPPNFPSSMASSSCLSSSFTAKCKYDVFLSFGGEETRTGIGSHLAAALRRKQI  240 (731)
Q Consensus       161 ~~~~~~~~~~~i~~iv~~v~~~l~~~~~~~~~~~~m~~~~~~~~~~~~~~~~dvFis~~~~D~~~~f~~~L~~~L~~~g~  240 (731)
                      . ..|++|+++|++||++|+++|+...               +     .                               
T Consensus       154 ~-~~~~~E~~~i~~Iv~~v~~~l~~~~---------------~-----~-------------------------------  181 (1153)
T PLN03210        154 S-QNWPNEAKMIEEIANDVLGKLNLTP---------------S-----N-------------------------------  181 (1153)
T ss_pred             c-CCCCCHHHHHHHHHHHHHHhhcccc---------------C-----c-------------------------------
Confidence            5 5688999999999999999874310               0     0                               


Q ss_pred             ccccccccccCCCCcccHHHHHHhhhceEEEEEecCCCCCChhhHHHHHHHHHHHhhcCCCEEEEEEEeecCCccccccc
Q 004772          241 ELFIDDEKEANKGDEISPAVSDAIETSLILIVIFSKDYASSKWCLDELVKILDCLIKNTGQIVVPVFYRIDSSDVHKQKG  320 (731)
Q Consensus       241 ~~~~d~~~~~~~g~~~~~~i~~ai~~s~~~i~v~S~~y~~S~~c~~El~~~~~~~~~~~~~~vlPv~~~vdpsdvr~~~g  320 (731)
                             +                                                                        
T Consensus       182 -------~------------------------------------------------------------------------  182 (1153)
T PLN03210        182 -------D------------------------------------------------------------------------  182 (1153)
T ss_pred             -------c------------------------------------------------------------------------
Confidence                   0                                                                        


Q ss_pred             chHHhhhhhhhcchHHHHHHHHHHhhccccCCceecCCCCcchhhhHHhhhhhcccccCCCCCCCCCcccchhhHHHHHH
Q 004772          321 SFRKAFVHHERNFPDKVQKWREALTKASSISEFFVVDPRNEAGDVEKIAQDISKKVEDMSDSTDLSGFVGLNSRIEKIKS  400 (731)
Q Consensus       321 ~~~~~~~~~~~~~~~~i~~~~~al~~~~~~~g~~~~~~~~~~~~~~~i~~~v~~~l~~~~~~~~~~~fvGR~~el~~L~~  400 (731)
                                                                                      .+++|||+.++++|..
T Consensus       183 ----------------------------------------------------------------~~~~vG~~~~l~~l~~  198 (1153)
T PLN03210        183 ----------------------------------------------------------------FEDFVGIEDHIAKMSS  198 (1153)
T ss_pred             ----------------------------------------------------------------cccccchHHHHHHHHH
Confidence                                                                            0126788888888888


Q ss_pred             hhhhcCCCeEEEEEEccCCchhhHHHHHHHHHhcccCcceEEEeec--cccc---c------cccHHHHHHHHHHhhhcC
Q 004772          401 LLCLELGDVRIVGIWGMGGIGKTTIASVIFHQISGDFQGKCFMKNV--GEES---S------KMGVIHVRDEVISQVMGE  469 (731)
Q Consensus       401 ~L~~~~~~~~vv~I~G~gGiGKTtLA~~~~~~~~~~f~~~~~~~~~--~~~~---~------~~~~~~l~~~ll~~l~~~  469 (731)
                      +|..+.+++++|+|+||||+||||||+++|+++..+|++.+|+...  ....   .      ......++.+++..+...
T Consensus       199 lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~  278 (1153)
T PLN03210        199 LLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDK  278 (1153)
T ss_pred             HHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCC
Confidence            8876667799999999999999999999999999999999988531  1100   0      011233444555543222


Q ss_pred             CcccCCCCcHHHHHHHHcCCCcEEEEeccCCch--hHhhhhcCCCCCCCEEEEEeCChhhhhhcCCceEEEcCCCCHHHH
Q 004772          470 NIKIGTPTITPNIKKRLQQRKVLIVLHDVDDNS--KSFAVCLDLFSPGSRIIITTRDKRLLYKRGVQSVCEVKGLKHNSA  547 (731)
Q Consensus       470 ~~~~~~~~~~~~l~~~L~~k~~LLVLDdv~~~~--~~l~~~~~~~~~gs~IIiTTR~~~v~~~~~~~~~~~l~~L~~~ea  547 (731)
                      . .... .....+++.|.++|+||||||||+..  +.+.....++++|++||||||+..++...+..++|+++.|+.++|
T Consensus       279 ~-~~~~-~~~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea  356 (1153)
T PLN03210        279 K-DIKI-YHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELA  356 (1153)
T ss_pred             C-Cccc-CCHHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHH
Confidence            1 1111 12356888899999999999998865  555566677889999999999999988877788999999999999


Q ss_pred             HHHHHHhhhcCCCCChhHHHHHHHHHHHhCCChHHHHHHHHHhcCCCHHHHHHHHHHhcCCCCccHHHHHHHcHhCCCH-
Q 004772          548 LELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIYKVLKISYDGLNW-  626 (731)
Q Consensus       548 ~~L~~~~~~~~~~~~~~~~~~~~~i~~~~~GlPLal~~~~~~L~~~~~~~w~~~l~~l~~~~~~~i~~~l~~s~~~L~~-  626 (731)
                      ++||++++|+...+++.+.+++.+|+++|+|+||||+++|++|++++..+|...++++....+..|..+|+.||+.|++ 
T Consensus       357 ~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~  436 (1153)
T PLN03210        357 LEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNK  436 (1153)
T ss_pred             HHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCcc
Confidence            9999999998777777889999999999999999999999999999999999999999888888899999999999986 


Q ss_pred             HHHHHHHHcccccCCcChhHHHhhhcCcc-hHHHHHHHHHHCcCceeeCCeEEehHHHHHHHHHHHhhcCCCCCCCcccc
Q 004772          627 EEKEIFLDVACFFKGEDVDFVTRVQDDPT-SMRNGLNILVEKSLITISDNRLQMHDMLQEIGKTIIRQESFKEPGKRSKL  705 (731)
Q Consensus       627 ~~k~~fl~la~f~~~~~~~~l~~~~~~~~-~~~~~l~~L~~~sLi~~~~~~~~mHdlvr~~a~~~~~~e~~~~~~~r~rl  705 (731)
                      .+|.+|+++|||+.+.+.+.+..++..++ .++.+++.|++++||+..++++.||||+|+||++++++++ .+|++|+|+
T Consensus       437 ~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l  515 (1153)
T PLN03210        437 KDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFL  515 (1153)
T ss_pred             chhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeE
Confidence            58999999999999999998888887766 7778899999999999998999999999999999999987 789999999


Q ss_pred             cCcccHHHHHhcCCCCcceeEEe
Q 004772          706 WDHKDVYQVLKKNKQMNILASIY  728 (731)
Q Consensus       706 ~~~~~i~~~l~~~~~~~~~~~i~  728 (731)
                      |++++|+++|++++|++.++||.
T Consensus       516 ~~~~di~~vl~~~~g~~~v~~i~  538 (1153)
T PLN03210        516 VDAKDICDVLEDNTGTKKVLGIT  538 (1153)
T ss_pred             eCHHHHHHHHHhCcccceeeEEE
Confidence            99999999999999999999996

syringae 6; Provisional
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain [Function unknown] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query731
3jrn_A176 Crystal Structure Of Tir Domain From Arabidopsis Th 5e-29
3jrn_A176 Crystal Structure Of Tir Domain From Arabidopsis Th 9e-25
3ozi_A204 Crystal Structure Of The Tir Domain From The Flax D 2e-24
>pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (316), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 98/168 (58%), Gaps = 5/168 (2%)
Query: 15  SKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAV 74
           +KYDVFLSF G DT       L   L R+ I  F DD +E + G   SP +   IE S  
Sbjct: 7   TKYDVFLSFRGHDTRHNFISFLYKELVRRSIRTFKDD-KELENGQRFSPELKSPIEVSRF 65
Query: 75  SIIIFSENYAYSTWCLDELVRILDCKKRNGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHE 134
           ++++ SENYA S+WCLDELV I+D +K+   TV+P+FY V P  VR Q     E F  H 
Sbjct: 66  AVVVVSENYAASSWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHA 125
Query: 135 SNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDISKK 182
           S   D  +V KWR +LT  + +SG     S  +D++LV+KIA +IS K
Sbjct: 126 SR-EDPEKVLKWRQALTNFAQLSG---DCSGDDDSKLVDKIANEISNK 169
>pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 Back     alignment and structure
>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query731
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 2e-77
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 1e-76
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 3e-76
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 4e-72
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 6e-56
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 5e-55
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-47
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-38
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 4e-35
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 8e-26
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 4e-11
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 3e-10
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 9e-07
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 1e-06
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 2e-05
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 5e-05
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 2e-04
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 Back     alignment and structure
 Score =  246 bits (630), Expect = 2e-77
 Identities = 61/184 (33%), Positives = 97/184 (52%), Gaps = 4/184 (2%)

Query: 1   MASSSSLSSSFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDE 60
             S S+  S      +Y+VFLSF G DT     D L  +LRR +I  F DD+ E  KG E
Sbjct: 20  AISDSTNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDD-ELLKGKE 78

Query: 61  ISPAVSKAIETSAVSIIIFSENYAYSTWCLDELVRILDCKKRNG-QTVVPVFYKVSPPAV 119
           I P + +AI+ S + + I S  YA S WCL EL  I+  ++ +  + ++P+FY V P  V
Sbjct: 79  IGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDV 138

Query: 120 RKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASRSFRNDAELVEKIAEDI 179
           R Q   + +AF  H + F  +  +Q W+D+L +  ++ G++          + +K++ DI
Sbjct: 139 RHQTGCYKKAFRKHANKFDGQ-TIQNWKDALKKVGDLKGWH-IGKNDKQGAIADKVSADI 196

Query: 180 SKKL 183
              +
Sbjct: 197 WSHI 200
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query731
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 100.0
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 100.0
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 100.0
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 100.0
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.97
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.94
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.9
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.85
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.84
2js7_A160 Myeloid differentiation primary response protein M 99.83
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.82
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.82
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.78
2js7_A160 Myeloid differentiation primary response protein M 99.77
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.75
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.75
2fna_A357 Conserved hypothetical protein; structural genomic 99.74
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.74
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.68
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.57
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.55
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.5
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.49
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.47
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.28
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.25
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.08
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.02
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.01
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.87
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.85
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.79
3bos_A242 Putative DNA replication factor; P-loop containing 98.69
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.67
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.62
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.62
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.59
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.57
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.56
3pvs_A447 Replication-associated recombination protein A; ma 98.56
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.56
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.55
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.5
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.46
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.44
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.42
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.41
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.37
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.34
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.32
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.31
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.3
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.3
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.29
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.29
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.28
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.27
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.2
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.14
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.1
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.07
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.04
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.04
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.03
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.01
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.98
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.95
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.93
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.92
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.91
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.9
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.9
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.89
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.87
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.85
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.82
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.8
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.8
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.74
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.73
3co5_A143 Putative two-component system transcriptional RES 97.68
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.68
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.65
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.52
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.5
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.42
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.38
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.37
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 97.27
2qgz_A308 Helicase loader, putative primosome component; str 97.27
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 97.19
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.16
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.13
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.1
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.01
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.9
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.78
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.64
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.63
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.58
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.29
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.28
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.28
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.25
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.12
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.96
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.71
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.71
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.69
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.65
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.61
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.48
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.47
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.45
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.37
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.3
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.24
3hyn_A189 Putative signal transduction protein; DUF1863 fami 95.18
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.17
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.14
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.14
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.14
3io5_A333 Recombination and repair protein; storage dimer, i 95.1
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.09
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.09
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.03
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.94
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.94
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.94
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.94
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.85
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.84
3hyn_A189 Putative signal transduction protein; DUF1863 fami 94.84
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.77
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.71
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.71
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.58
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.55
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.55
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.55
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.51
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.51
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.51
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.45
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.45
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.42
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.41
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.39
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.37
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.37
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.35
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.29
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.28
1tue_A212 Replication protein E1; helicase, replication, E1E 94.24
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.23
1via_A175 Shikimate kinase; structural genomics, transferase 94.22
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.2
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.19
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.19
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.18
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.17
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.17
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.16
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.14
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.13
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.1
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.1
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.09
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.09
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.08
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.05
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.04
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.01
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.99
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.99
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.98
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.94
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 93.91
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.91
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.87
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.87
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.87
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.84
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.81
3fwy_A314 Light-independent protochlorophyllide reductase I 93.8
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.79
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.78
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.77
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.77
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.77
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.74
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.73
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.71
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.71
3ice_A422 Transcription termination factor RHO; transcriptio 93.7
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.68
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.67
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.66
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.64
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.61
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.58
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.57
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 93.53
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.53
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.5
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.48
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.45
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.45
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.42
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 93.36
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.34
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.33
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.31
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.29
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.25
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 93.24
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.22
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.2
4a74_A231 DNA repair and recombination protein RADA; hydrola 93.19
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.18
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.15
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 93.11
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.07
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.03
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.01
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 92.94
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 92.84
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.84
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.82
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.8
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.71
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 92.7
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.68
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 92.66
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.65
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 92.64
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.64
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 92.48
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 92.44
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.43
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.42
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.39
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 92.35
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.35
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.35
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.34
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.33
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 92.33
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.33
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.32
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 92.32
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.3
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.27
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.26
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.19
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.18
3end_A307 Light-independent protochlorophyllide reductase ir 92.16
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 92.11
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.05
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.99
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.98
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.98
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 91.97
2xxa_A433 Signal recognition particle protein; protein trans 91.88
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.85
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.84
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.84
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 91.83
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 91.82
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.8
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.78
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 91.76
2z43_A324 DNA repair and recombination protein RADA; archaea 91.69
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.65
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.63
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.63
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 91.6
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 91.59
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.59
2og2_A359 Putative signal recognition particle receptor; nuc 91.53
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 91.52
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.46
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 91.46
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.45
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.44
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.36
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 91.35
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.34
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 91.31
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 91.31
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.17
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 91.08
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 91.04
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.0
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.94
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 90.83
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 90.78
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 90.77
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 90.72
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.72
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 90.67
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.61
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 90.6
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 90.57
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 90.55
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 90.49
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 90.48
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.47
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 90.46
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.46
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 90.41
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 90.38
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 90.24
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 90.15
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 90.14
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 90.08
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 90.05
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 90.04
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.02
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.01
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 89.82
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.82
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 89.8
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 89.79
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 89.74
1b0u_A262 Histidine permease; ABC transporter, transport pro 89.73
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 89.72
1ji0_A240 ABC transporter; ATP binding protein, structural g 89.65
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.59
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 89.54
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 89.53
1g6h_A257 High-affinity branched-chain amino acid transport 89.51
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 89.47
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 89.45
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 89.41
3cnl_A262 YLQF, putative uncharacterized protein; circular p 89.4
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.4
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.38
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.37
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 89.37
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 89.33
2wji_A165 Ferrous iron transport protein B homolog; membrane 89.3
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.28
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 89.25
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.19
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 89.14
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 89.0
2ghi_A260 Transport protein; multidrug resistance protein, M 88.99
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 88.96
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 88.96
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.95
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 88.94
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.87
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 88.86
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 88.76
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 88.71
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 88.7
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 88.68
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 88.68
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 88.52
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.38
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 88.35
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.33
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 88.32
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 88.28
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.16
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 88.14
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 88.14
3kta_A182 Chromosome segregation protein SMC; structural mai 88.13
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 88.13
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 88.11
2www_A349 Methylmalonic aciduria type A protein, mitochondri 88.06
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 88.04
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 88.02
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 87.92
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 87.82
2ged_A193 SR-beta, signal recognition particle receptor beta 87.75
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 87.73
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 87.64
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 87.63
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.61
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.58
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 87.56
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 87.51
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 87.51
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 87.48
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 87.42
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 87.13
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 87.08
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 87.06
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 87.05
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.03
1p9r_A418 General secretion pathway protein E; bacterial typ 87.02
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 87.01
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 87.0
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 86.97
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 86.95
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 86.93
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 86.92
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.9
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.89
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 86.89
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 86.8
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 86.79
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 86.78
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 86.77
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 86.76
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 86.74
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 86.69
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 86.66
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 86.65
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 86.62
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 86.62
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 86.58
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 86.57
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 86.5
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 86.49
1nrj_B218 SR-beta, signal recognition particle receptor beta 86.48
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 86.44
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 86.4
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 86.39
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 86.36
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 86.32
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 86.28
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 86.25
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 86.17
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 86.1
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 86.09
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 86.04
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 86.04
3igf_A374 ALL4481 protein; two-domained protein consisting o 85.9
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 85.87
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 85.86
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 85.84
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 85.84
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 85.73
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 85.69
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 85.64
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 85.63
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 85.6
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 85.56
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 85.53
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 85.45
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 85.41
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 85.38
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 85.37
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 85.34
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 85.34
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 85.34
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 85.3
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 85.26
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 85.23
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 85.22
3t1o_A198 Gliding protein MGLA; G domain containing protein, 85.12
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 85.12
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.09
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 85.06
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 85.04
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 84.99
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 84.98
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 84.95
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 84.94
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 84.91
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.87
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 84.86
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 84.85
3cwq_A209 Para family chromosome partitioning protein; alpha 84.84
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 84.78
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 84.78
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.77
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 84.76
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 84.62
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 84.57
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 84.57
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 84.56
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 84.5
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 84.48
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 84.46
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 84.46
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 84.42
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 84.37
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 84.32
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 84.32
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 84.29
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 84.28
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 84.17
2fh5_B214 SR-beta, signal recognition particle receptor beta 84.14
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 84.13
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 84.08
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 84.05
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 84.03
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 83.94
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 83.93
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
Probab=100.00  E-value=1.1e-52  Score=399.78  Aligned_cols=178  Identities=34%  Similarity=0.602  Sum_probs=159.4

Q ss_pred             CCCCCCCCCCCceeEEEeeecccCCCChHHHHHHHHHhCCCeeeecCCCCCCCCCCccHHHHHHHhhccEEEEEeccCcc
Q 004772            5 SSLSSSFTAKSKYDVFLSFLGKDTGIGIRDHLAAALRRKQIELFIDDEQEPQKGDEISPAVSKAIETSAVSIIIFSENYA   84 (731)
Q Consensus         5 ~~~~~~~~~~~~~dvFis~~~~d~~~~f~~~L~~~l~~~~~~~~~d~~~~~~~g~~~~~~i~~~i~~s~~~ivv~S~~~~   84 (731)
                      |+++|+..+.++|||||||||+|+|++|++||+++|+++||++|+|++ ++++|+.|.++|.+||++|+++|||||+||+
T Consensus        24 s~~~s~~~~~~~yDVFISfrg~D~r~~Fv~~L~~aL~~~GI~~f~D~~-el~~G~~I~~~l~~aIe~Sri~IvV~S~nYa  102 (204)
T 3ozi_A           24 STNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDD-ELLKGKEIGPNLLRAIDQSKIYVPIISSGYA  102 (204)
T ss_dssp             ----------CCCCEEEEECHHHHTTTHHHHHHHHHHHTTCCEEEEET-TTCCGGGTTTTHHHHHHHCSEEEEEECTTGG
T ss_pred             CCCCcCCCCCcCCeEEEeccccCCCHHHHHHHHHHHHHCCCcEEEeCC-ccCCCCchHHHHHHHHHhCcEeeEEEEcccc
Confidence            344555667899999999999999999999999999999999999986 8999999999999999999999999999999


Q ss_pred             CccccHHHHHHHHHhhhh-cCCeeEeEEeecCccccccccCcHHHHHHhhhhcCCChhHHHHHHHHHHHhhcccccccCC
Q 004772           85 YSTWCLDELVRILDCKKR-NGQTVVPVFYKVSPPAVRKQRLSFGEAFVHHESNFSDKVQVQKWRDSLTQASNISGFYASR  163 (731)
Q Consensus        85 ~S~wc~~El~~~~~~~~~-~~~~v~Pify~v~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~  163 (731)
                      +|.||++||++|++|+++ ++++||||||+|+|++||+|+|+||++|.+|+.++. ++++++||.||++|++++||++. 
T Consensus       103 ~S~WCl~EL~~I~e~~~~~~~~~ViPIFY~VdPs~Vr~q~g~fg~af~~~~~~~~-~~~v~~Wr~AL~~va~lsG~~~~-  180 (204)
T 3ozi_A          103 DSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFD-GQTIQNWKDALKKVGDLKGWHIG-  180 (204)
T ss_dssp             GCHHHHHHHHHHHHHHHHCTTSEECCEEESSCHHHHHHTCTTHHHHHHHHTTTSC-HHHHHHHHHHHHHHHTSCBEEEC-
T ss_pred             cCcHHHHHHHHHHHHHHhcCCeeeEEEEeecCHHHHHhccccHHHHHHHHHHhhC-HHHHHHHHHHHHHHhccCceecC-
Confidence            999999999999999875 679999999999999999999999999999998874 46899999999999999999765 


Q ss_pred             CCCCHHHHHHHHHHhhhhhhcc
Q 004772          164 SFRNDAELVEKIAEDISKKLKD  185 (731)
Q Consensus       164 ~~~~~~~~i~~iv~~v~~~l~~  185 (731)
                      ++.+|+++|++||++|+++|+.
T Consensus       181 ~~~~e~~~i~~Iv~di~~kl~~  202 (204)
T 3ozi_A          181 KNDKQGAIADKVSADIWSHISK  202 (204)
T ss_dssp             TTSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHhcc
Confidence            4678999999999999999975
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 731
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-36
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 2e-17
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 3e-16
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 8e-16
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 1e-15
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  136 bits (343), Expect = 2e-36
 Identities = 37/250 (14%), Positives = 72/250 (28%), Gaps = 18/250 (7%)

Query: 388 FVGLNSRIEKIKSLLC-LELGDVRIVGIWGMGGIGKTTIASVIFH---QISGDFQGKCFM 443
                  ++++   L  +   D   + + G  G GK+ IAS       Q+ G        
Sbjct: 22  CYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW 81

Query: 444 KNVGEESSKMGVIHVRDEVISQVMGENIKIGTPTITPN--------IKKRLQQRKVLIVL 495
                 + K       D ++     +++                      + +   L V 
Sbjct: 82  LKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVF 141

Query: 496 HDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYK-RGVQSVCEVKGLKHNSALELFCRK 554
            DV                  R ++TTRD  +           EV  L+ +   +     
Sbjct: 142 DDVVQEE----TIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAY 197

Query: 555 AFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLITDPNIY 614
                       ++  +    ++GNP  L +   S   K+ E+     +KL+      + 
Sbjct: 198 GMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVE 256

Query: 615 KVLKISYDGL 624
            +   SY  L
Sbjct: 257 CITPYSYKSL 266
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query731
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.74
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.72
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.67
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.61
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.34
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.89
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.81
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.75
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.71
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.7
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.7
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.6
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.53
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.51
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.43
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.41
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.38
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.35
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.32
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.28
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.2
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.16
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.12
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.86
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.19
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.15
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.82
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.73
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.66
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.66
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.66
d2qy9a2211 GTPase domain of the signal recognition particle r 96.59
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.56
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.5
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.45
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.41
d1vmaa2213 GTPase domain of the signal recognition particle r 96.36
d1okkd2207 GTPase domain of the signal recognition particle r 96.34
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.32
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.32
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.29
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.23
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.23
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.09
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.08
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.03
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.94
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.94
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.83
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.81
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.76
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.73
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.67
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.65
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.61
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.56
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.49
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.43
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.38
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.35
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.33
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.33
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.32
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.27
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.14
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.0
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.82
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.72
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.66
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.64
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.63
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.61
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.58
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.58
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.51
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.37
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.34
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.34
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.3
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.26
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.21
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.1
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.1
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.05
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.95
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.86
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.84
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.83
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.81
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.75
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.58
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.41
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.34
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.29
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.21
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.11
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.01
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 92.97
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.69
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.67
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.36
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 92.27
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.25
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.23
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.22
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.93
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.88
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.85
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.78
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.41
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.07
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 91.01
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 90.98
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.84
d1g2912240 Maltose transport protein MalK, N-terminal domain 90.81
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.78
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.71
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.61
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.55
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.53
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.42
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.23
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.2
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.06
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.99
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.98
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.95
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.95
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.91
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.75
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 89.7
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 89.7
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.64
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.56
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 89.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.41
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.37
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.32
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.13
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.11
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.1
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 88.88
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.85
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 88.8
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.7
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 88.7
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 88.6
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.57
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.57
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.42
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.41
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.36
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.35
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.33
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.14
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.14
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.14
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.07
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.05
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.03
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.99
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.85
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 87.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 87.66
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.64
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.64
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 87.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.6
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.59
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.58
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.47
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.47
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 87.33
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.29
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.29
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.27
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.19
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 87.15
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.11
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.0
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.9
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.86
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.84
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.74
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.54
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.47
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.38
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.22
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.22
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 86.2
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.05
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.05
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 86.0
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.96
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.95
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 85.91
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 85.86
d2hyda1255 Putative multidrug export ATP-binding/permease pro 85.75
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.68
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.56
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 85.54
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.51
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 85.46
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 85.34
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.34
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.29
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 85.26
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 85.17
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.09
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.02
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.97
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.0
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.84
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.5
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 83.48
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 83.22
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.13
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 83.11
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 83.01
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.63
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 82.41
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.39
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.21
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 82.12
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 81.19
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=1.7e-34  Score=296.25  Aligned_cols=246  Identities=15%  Similarity=0.112  Sum_probs=187.9

Q ss_pred             CCCCcccchhhHHHHHHhhhh-cCCCeEEEEEEccCCchhhHHHHHHHHH----hcccCcceEEEeecccccccccHHHH
Q 004772          384 DLSGFVGLNSRIEKIKSLLCL-ELGDVRIVGIWGMGGIGKTTIASVIFHQ----ISGDFQGKCFMKNVGEESSKMGVIHV  458 (731)
Q Consensus       384 ~~~~fvGR~~el~~L~~~L~~-~~~~~~vv~I~G~gGiGKTtLA~~~~~~----~~~~f~~~~~~~~~~~~~~~~~~~~l  458 (731)
                      ..+.++||+.++++|.++|.. .+.+.++|+|+||||+||||||+++|++    ...+|++++|+......+ ...+...
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~-~~~l~~~   96 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP-KSTFDLF   96 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST-THHHHHH
T ss_pred             CCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCC-HHHHHHH
Confidence            345578999999999999975 3455889999999999999999999987    445688999997333222 2233333


Q ss_pred             HHHHHHhhhcCCc---ccCCCC-----cHHHHHHHHcCCCcEEEEeccCCchhHhhhhcCCCCCCCEEEEEeCChhhhhh
Q 004772          459 RDEVISQVMGENI---KIGTPT-----ITPNIKKRLQQRKVLIVLHDVDDNSKSFAVCLDLFSPGSRIIITTRDKRLLYK  530 (731)
Q Consensus       459 ~~~ll~~l~~~~~---~~~~~~-----~~~~l~~~L~~k~~LLVLDdv~~~~~~l~~~~~~~~~gs~IIiTTR~~~v~~~  530 (731)
                      ...++..+.....   ......     ....+.+.+.++++|+||||||+....-.    ....|++||||||+..++..
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~----~~~~~srilvTTR~~~v~~~  172 (277)
T d2a5yb3          97 TDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW----AQELRLRCLVTTRDVEISNA  172 (277)
T ss_dssp             HHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHH----HHHTTCEEEEEESBGGGGGG
T ss_pred             HHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhh----hcccCceEEEEeehHHHHHh
Confidence            3344433332211   111111     22346677889999999999998653211    12458999999999999887


Q ss_pred             cCCc-eEEEcCCCCHHHHHHHHHHhhhcCCCCChhHHHHHHHHHHHhCCChHHHHHHHHHhcCCCHHHHHHHHHHhcCCC
Q 004772          531 RGVQ-SVCEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLHKLKLIT  609 (731)
Q Consensus       531 ~~~~-~~~~l~~L~~~ea~~L~~~~~~~~~~~~~~~~~~~~~i~~~~~GlPLal~~~~~~L~~~~~~~w~~~l~~l~~~~  609 (731)
                      +... +.|+|++|+.+||++||.+++|.... .+..++++++|+++|+|+||||+.+|+.|+.++.++|.+..+.+....
T Consensus       173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~-~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~  251 (277)
T d2a5yb3         173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG  251 (277)
T ss_dssp             CCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC
T ss_pred             cCCCCceEECCCCCHHHHHHHHHHHhCCccC-chhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCc
Confidence            6544 68999999999999999999876544 345678899999999999999999999999999999999888887666


Q ss_pred             CccHHHHHHHcHhCCCHHHHHHHHHc
Q 004772          610 DPNIYKVLKISYDGLNWEEKEIFLDV  635 (731)
Q Consensus       610 ~~~i~~~l~~s~~~L~~~~k~~fl~l  635 (731)
                      ...+..++..||+.||++.|.||.++
T Consensus       252 ~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         252 LVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             SSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            67888999999999999999999764
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure