Citrus Sinensis ID: 004814


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73
MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTLGAE
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccc
ccccHHHHHHcccccccccccHHEEEEHHcccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccc
MTLCIRASKALSAHSYHYFYLKKVRfffpfcfsvhtypsisesnnkdsvlnpesesYYKELIISTVeekpwafcnnrwvsdhfqavvsdpELLVRVLNRIREKPRIALRFFRWvetqpgvkrdefVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLiggglsscVSIKILDLLLLIYTKKSMVEQCLLVFNKMLrngllpdvkncNRIIKVLRDNGFSVKAREVYRMMgefgikpsiVTYNTMLDSFCKEGEMQEALELLWEMqgrgcspngvtYNVLITGFSRNGELEQARGLIRDMLKLGLKvsahsynpiicgysekglLVEALNLEEemvtrgvaptlaTYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYgycrsgnigEAFLLFDElrsrnlvptvVTYNTLIDGLCRYGDLEVAQQLKENMinqgilpdvITYTIMVNGSCKMGNLSMAREFFNEMLRkglqpdrfaYTTQIAgelklgdtSEAYRLQEEMlakgfppdliTYNVLVHGLCKLGSLEEANELLRKMVgdgfipdhitYTSIIHASLEMGDLRRGRDLFNNMLrkglsptlVTYTVLIHAHAARGRLELAFMYFSEmqvkgirpnviTYNALINGLCRLRRIDQAYGLfidmeeegilpnkytYTILINENCNAGNWQEALRLYKEMLDreiepdyctHSALLLKQLDKDYKVHAVEYLESLTLGAE
mtlciraskalsahSYHYFYLKKVRFFFPFCFSVHtypsisesnnkdsvlnPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRirekprialrffrwvetqpgvkrdeFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMlrngllpdvkncNRIIKVlrdngfsvkAREVYRMMgefgikpsivTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLesltlgae
MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTLGAE
***CIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPS****************SYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESL*****
***************YHYFYLKKVRFFFPF**************************YYKELIISTVEEKPWAFCN********QAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTLGA*
MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTLGAE
*****R*****SAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKELIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESLTLGAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query729 2.2.26 [Sep-21-2011]
P0C7Q9718 Pentatricopeptide repeat- yes no 0.975 0.990 0.489 0.0
Q9FIX3747 Pentatricopeptide repeat- no no 0.883 0.862 0.304 2e-84
Q9LFC5729 Pentatricopeptide repeat- no no 0.861 0.861 0.287 4e-83
Q9LVQ5 1096 Pentatricopeptide repeat- no no 0.798 0.531 0.300 4e-81
Q9CA58 763 Putative pentatricopeptid no no 0.803 0.768 0.302 4e-81
Q9CAN0630 Pentatricopeptide repeat- no no 0.725 0.839 0.293 2e-79
Q9LFF1754 Pentatricopeptide repeat- no no 0.827 0.799 0.299 2e-78
Q0WVK7741 Pentatricopeptide repeat- no no 0.823 0.809 0.296 2e-78
Q9LSL9 915 Pentatricopeptide repeat- no no 0.831 0.662 0.288 4e-78
Q9FMF6730 Pentatricopeptide repeat- no no 0.684 0.683 0.302 3e-77
>sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 Back     alignment and function desciption
 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/730 (48%), Positives = 491/730 (67%), Gaps = 19/730 (2%)

Query: 1   MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKE 60
           + LC+RAS++  + S         RF F F     T P  + S+   S  +   ESYY  
Sbjct: 5   LRLCLRASRSFFSISTTNNNNNLSRFLFRFS----TLPHCAASS---SSSSSNLESYYAN 57

Query: 61  LIISTVEE--KPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQP 118
           LI+S+  +  KP    N +W S  F+ +++DP LL+RVLN IR KP IA RFF W++ Q 
Sbjct: 58  LILSSHGDSNKP----NRKWSSHQFRLLLTDPNLLIRVLNMIRVKPEIAFRFFNWIQRQS 113

Query: 119 GVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDL 178
            VK+    F  +LEIL E+ L+  AY V E  + + MH I D+LI G     +++K+LDL
Sbjct: 114 DVKQSRQAFAAMLEILAENDLMSEAYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDL 173

Query: 179 LLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFG 238
           LL +YTKKSM E+ LL F KM+R G LP V+NCN ++KVLRD+    KA  VY  M E G
Sbjct: 174 LLWVYTKKSMAEKFLLSFEKMIRKGFLPSVRNCNIVLKVLRDSRMMNKASAVYETMIEHG 233

Query: 239 IKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQAR 298
           I P+++T+NTMLDS  K G+++   ++  EM+ R    + VTYN+LI GFS+NG++E+AR
Sbjct: 234 IMPTVITFNTMLDSCFKAGDLERVDKIWLEMKRRNIEFSEVTYNILINGFSKNGKMEEAR 293

Query: 299 GLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGL 358
               DM + G  V+ +S+NP+I GY ++GL  +A  + +EM+  G+ PT +TYNI I  L
Sbjct: 294 RFHGDMRRSGFAVTPYSFNPLIEGYCKQGLFDDAWGVTDEMLNAGIYPTTSTYNIYICAL 353

Query: 359 CKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTV 418
           C +GR+ DAR    E+L     PD++SYNTL++GY + G   EA LLFD+LR+ ++ P++
Sbjct: 354 CDFGRIDDAR----ELLSSMAAPDVVSYNTLMHGYIKMGKFVEASLLFDDLRAGDIHPSI 409

Query: 419 VTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNE 478
           VTYNTLIDGLC  G+LE AQ+LKE M  Q I PDVITYT +V G  K GNLSMA E ++E
Sbjct: 410 VTYNTLIDGLCESGNLEGAQRLKEEMTTQLIFPDVITYTTLVKGFVKNGNLSMATEVYDE 469

Query: 479 MLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKG-FPPDLITYNVLVHGLCKLG 537
           MLRKG++PD +AYTT+  GEL+LGD+ +A+RL EEM+A     PDL  YNV + GLCK+G
Sbjct: 470 MLRKGIKPDGYAYTTRAVGELRLGDSDKAFRLHEEMVATDHHAPDLTIYNVRIDGLCKVG 529

Query: 538 SLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYT 597
           +L +A E  RK+   G +PDH+TYT++I   LE G  +  R+L++ MLRK L P+++TY 
Sbjct: 530 NLVKAIEFQRKIFRVGLVPDHVTYTTVIRGYLENGQFKMARNLYDEMLRKRLYPSVITYF 589

Query: 598 VLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEE 657
           VLI+ HA  GRLE AF Y +EM+ +G+RPNV+T+NAL+ G+C+   ID+AY     MEEE
Sbjct: 590 VLIYGHAKAGRLEQAFQYSTEMKKRGVRPNVMTHNALLYGMCKAGNIDEAYRYLCKMEEE 649

Query: 658 GILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHA 717
           GI PNKY+YT+LI++NC+   W+E ++LYKEMLD+EIEPD  TH A L K L+KD++   
Sbjct: 650 GIPPNKYSYTMLISKNCDFEKWEEVVKLYKEMLDKEIEPDGYTHRA-LFKHLEKDHESRE 708

Query: 718 VEYLESLTLG 727
           VE+LE L L 
Sbjct: 709 VEFLERLLLS 718





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2 Back     alignment and function description
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
225424122718 PREDICTED: pentatricopeptide repeat-cont 0.979 0.994 0.656 0.0
297737746 1078 unnamed protein product [Vitis vinifera] 0.971 0.656 0.655 0.0
255570715729 pentatricopeptide repeat-containing prot 0.969 0.969 0.610 0.0
449435202717 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.957 0.973 0.591 0.0
449493486772 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.957 0.904 0.591 0.0
356551209687 PREDICTED: pentatricopeptide repeat-cont 0.893 0.947 0.627 0.0
356554658675 PREDICTED: pentatricopeptide repeat-cont 0.871 0.940 0.634 0.0
357438771 988 Pentatricopeptide repeat-containing prot 0.923 0.681 0.554 0.0
147819071 847 hypothetical protein VITISV_043106 [Viti 0.698 0.600 0.652 0.0
15219974718 pentatricopeptide repeat-containing prot 0.975 0.990 0.489 0.0
>gi|225424122|ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/724 (65%), Positives = 583/724 (80%), Gaps = 10/724 (1%)

Query: 1   MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKE 60
           MTLC+RASKA  + + +     KVR  FP  FS H     S SN+      P SE+++++
Sbjct: 1   MTLCLRASKA--SATINPTRSIKVRLLFPCSFSFHD----STSNHSAP---PFSETHFQD 51

Query: 61  LIISTVEEKPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGV 120
           +I  ++ EKP  F N  W+S  F  V+ DP+L VRVL+  R  PR+ALR FRW E+QPG 
Sbjct: 52  VISKSIREKPSNFSNYYWLSHQFGPVIVDPDLFVRVLSSFRTSPRMALRLFRWAESQPGF 111

Query: 121 KRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLL 180
           +R EFVFC ILEIL ++ L+RSAYWV+E V+  NMH I+DVLIGG +SS VS+KILDLL+
Sbjct: 112 RRSEFVFCAILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLI 171

Query: 181 LIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIK 240
            +Y+KKSMVEQCL VF+KM+++ L PDVKNCNRI+++LRD     KA EVYR MGEFGIK
Sbjct: 172 WVYSKKSMVEQCLSVFDKMIKSRLSPDVKNCNRILRILRDKDLMSKAVEVYRTMGEFGIK 231

Query: 241 PSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGL 300
           P+IVTYNT+LDS+CK G++Q+ L+LL EMQ RGC+PN VTYNVLI G S+ GE EQA+GL
Sbjct: 232 PTIVTYNTLLDSYCKGGKVQQGLDLLSEMQRRGCAPNDVTYNVLINGLSKKGEFEQAKGL 291

Query: 301 IRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCK 360
           I +MLK GLKVSA++YNP+I GY  KG+L EAL+L+EEMV +G +PT+ATYN  IYGLCK
Sbjct: 292 IGEMLKTGLKVSAYTYNPLIYGYFNKGMLAEALSLQEEMVLKGASPTVATYNSFIYGLCK 351

Query: 361 WGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVT 420
            GR+SDA  +  +ML  N++PD++SYNTL+YGYCR GN+ +AFLLFDELRS  L PT+VT
Sbjct: 352 LGRMSDAMQQLSDMLANNLLPDVVSYNTLIYGYCRLGNLMKAFLLFDELRSIYLFPTIVT 411

Query: 421 YNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEML 480
           YNTL+DGLCR G+LEVAQQLK  MIN+GI PD++TYTI+VNGSCKMG+LSMA+EFF+EML
Sbjct: 412 YNTLLDGLCRQGELEVAQQLKVEMINEGIAPDIVTYTILVNGSCKMGSLSMAQEFFDEML 471

Query: 481 RKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLE 540
            +GL+ D +AY T+I GELKLGDTS A+ LQEEMLAKGFPPDLI YNV+V GLCKLG+LE
Sbjct: 472 HEGLELDSYAYATRIVGELKLGDTSRAFSLQEEMLAKGFPPDLIIYNVVVDGLCKLGNLE 531

Query: 541 EANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLI 600
           EA+ELL+KMV DG IPD++TYTSIIHA LE G LR+GR++F  ML KGL+P++VTYTVLI
Sbjct: 532 EASELLQKMVSDGVIPDYVTYTSIIHAHLENGRLRKGREIFYEMLSKGLTPSVVTYTVLI 591

Query: 601 HAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGIL 660
           H HA +GRLE AF+YFSEMQ KGI PNVITYN+LINGLC++RR+DQAY  F +M E+GI 
Sbjct: 592 HGHAGKGRLERAFIYFSEMQEKGILPNVITYNSLINGLCKVRRMDQAYNFFAEMVEKGIF 651

Query: 661 PNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEY 720
           PNKY+YTILINENCN GNWQEAL LYK+MLDR ++PD CTHSA LLKQL KD K+ AV  
Sbjct: 652 PNKYSYTILINENCNMGNWQEALSLYKQMLDRGVQPDSCTHSA-LLKQLGKDCKLQAVRQ 710

Query: 721 LESL 724
           LESL
Sbjct: 711 LESL 714




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297737746|emb|CBI26947.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570715|ref|XP_002526312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534393|gb|EEF36101.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449435202|ref|XP_004135384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449493486|ref|XP_004159312.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356551209|ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356554658|ref|XP_003545661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357438771|ref|XP_003589662.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478710|gb|AES59913.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147819071|emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15219974|ref|NP_173709.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806406|sp|P0C7Q9.1|PPR56_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g22960, mitochondrial; Flags: Precursor gi|332192194|gb|AEE30315.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
TAIR|locus:2017754718 AT1G22960 [Arabidopsis thalian 0.972 0.987 0.491 1.6e-182
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.905 0.905 0.289 2.5e-81
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.886 0.864 0.303 2.2e-80
TAIR|locus:2019085 763 AT1G74580 "AT1G74580" [Arabido 0.695 0.664 0.323 6.2e-78
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.733 0.849 0.290 3.9e-76
TAIR|locus:2016427 904 AT1G19290 [Arabidopsis thalian 0.836 0.674 0.299 1.9e-74
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.831 0.662 0.290 2.5e-74
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.725 0.841 0.291 1.2e-72
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.821 0.794 0.305 3.2e-72
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.724 0.838 0.288 1.8e-71
TAIR|locus:2017754 AT1G22960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1771 (628.5 bits), Expect = 1.6e-182, P = 1.6e-182
 Identities = 359/730 (49%), Positives = 493/730 (67%)

Query:     1 MTLCIRASKALSAHSYHYFYLKKVRFFFPFCFSVHTYPSISESNNKDSVLNPESESYYKE 60
             + LC+RAS++  + S         RF F F     T P  + S++  S      ESYY  
Sbjct:     5 LRLCLRASRSFFSISTTNNNNNLSRFLFRFS----TLPHCAASSSSSS---SNLESYYAN 57

Query:    61 LIISTVEE--KPWAFCNNRWVSDHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQP 118
             LI+S+  +  KP    N +W S  F+ +++DP LL+RVLN IR KP IA RFF W++ Q 
Sbjct:    58 LILSSHGDSNKP----NRKWSSHQFRLLLTDPNLLIRVLNMIRVKPEIAFRFFNWIQRQS 113

Query:   119 GVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDL 178
              VK+    F  +LEIL E+ L+  AY V E  + + MH I D+LI G     +++K+LDL
Sbjct:   114 DVKQSRQAFAAMLEILAENDLMSEAYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDL 173

Query:   179 LLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFG 238
             LL +YTKKSM E+ LL F KM+R G LP V+NCN ++KVLRD+    KA  VY  M E G
Sbjct:   174 LLWVYTKKSMAEKFLLSFEKMIRKGFLPSVRNCNIVLKVLRDSRMMNKASAVYETMIEHG 233

Query:   239 IKPSIVTYNTMLDSFCKEGEMQEALELLW-EMQGRGCSPNGVTYNVLITGFSRNGELEQA 297
             I P+++T+NTMLDS  K G++ E ++ +W EM+ R    + VTYN+LI GFS+NG++E+A
Sbjct:   234 IMPTVITFNTMLDSCFKAGDL-ERVDKIWLEMKRRNIEFSEVTYNILINGFSKNGKMEEA 292

Query:   298 RGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYG 357
             R    DM + G  V+ +S+NP+I GY ++GL  +A  + +EM+  G+ PT +TYNI I  
Sbjct:   293 RRFHGDMRRSGFAVTPYSFNPLIEGYCKQGLFDDAWGVTDEMLNAGIYPTTSTYNIYICA 352

Query:   358 LCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPT 417
             LC +GR+ DAR    E+L     PD++SYNTL++GY + G   EA LLFD+LR+ ++ P+
Sbjct:   353 LCDFGRIDDAR----ELLSSMAAPDVVSYNTLMHGYIKMGKFVEASLLFDDLRAGDIHPS 408

Query:   418 VVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFN 477
             +VTYNTLIDGLC  G+LE AQ+LKE M  Q I PDVITYT +V G  K GNLSMA E ++
Sbjct:   409 IVTYNTLIDGLCESGNLEGAQRLKEEMTTQLIFPDVITYTTLVKGFVKNGNLSMATEVYD 468

Query:   478 EMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGF-PPDLITYNVLVHGLCKL 536
             EMLRKG++PD +AYTT+  GEL+LGD+ +A+RL EEM+A     PDL  YNV + GLCK+
Sbjct:   469 EMLRKGIKPDGYAYTTRAVGELRLGDSDKAFRLHEEMVATDHHAPDLTIYNVRIDGLCKV 528

Query:   537 GSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTY 596
             G+L +A E  RK+   G +PDH+TYT++I   LE G  +  R+L++ MLRK L P+++TY
Sbjct:   529 GNLVKAIEFQRKIFRVGLVPDHVTYTTVIRGYLENGQFKMARNLYDEMLRKRLYPSVITY 588

Query:   597 TVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEE 656
              VLI+ HA  GRLE AF Y +EM+ +G+RPNV+T+NAL+ G+C+   ID+AY     MEE
Sbjct:   589 FVLIYGHAKAGRLEQAFQYSTEMKKRGVRPNVMTHNALLYGMCKAGNIDEAYRYLCKMEE 648

Query:   657 EGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVH 716
             EGI PNKY+YT+LI++NC+   W+E ++LYKEMLD+EIEPD  TH AL  K L+KD++  
Sbjct:   649 EGIPPNKYSYTMLISKNCDFEKWEEVVKLYKEMLDKEIEPDGYTHRALF-KHLEKDHESR 707

Query:   717 AVEYLESLTL 726
              VE+LE L L
Sbjct:   708 EVEFLERLLL 717




GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016427 AT1G19290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C7Q9PPR56_ARATHNo assigned EC number0.48900.97530.9902yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-37
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-35
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-32
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-30
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-26
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-26
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-25
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-24
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-22
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-12
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-08
pfam0153531 pfam01535, PPR, PPR repeat 1e-07
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-07
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 5e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 8e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  148 bits (376), Expect = 5e-37
 Identities = 91/403 (22%), Positives = 185/403 (45%), Gaps = 39/403 (9%)

Query: 327 GLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGR-VSDARHRFFEMLRKNVIPDIIS 385
           G + + ++L E+M  RG+      Y+   +  CK  R V +A  RF +++R    P + +
Sbjct: 384 GRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEA-FRFAKLIRN---PTLST 439

Query: 386 YNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMI 445
           +N L+     S +I  A  +   ++   L      Y TLI    + G ++   ++   M+
Sbjct: 440 FNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMV 499

Query: 446 NQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTS 505
           N G+  +V T+  +++G  + G ++ A   +  M  K ++PDR  +   I+   + G   
Sbjct: 500 NAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVD 559

Query: 506 EAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSII 565
            A+ +  EM A+  P D                                 PDHIT  +++
Sbjct: 560 RAFDVLAEMKAETHPID---------------------------------PDHITVGALM 586

Query: 566 HASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIR 625
            A    G + R ++++  +    +  T   YT+ +++ + +G  + A   + +M+ KG++
Sbjct: 587 KACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVK 646

Query: 626 PNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALRL 685
           P+ + ++AL++       +D+A+ +  D  ++GI     +Y+ L+    NA NW++AL L
Sbjct: 647 PDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALEL 706

Query: 686 YKEMLDREIEPDYCTHSALLLKQLDKDYKVHAVEYLESL-TLG 727
           Y+++   ++ P   T +AL+    + +    A+E L  +  LG
Sbjct: 707 YEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLG 749


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 729
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.89
KOG2076895 consensus RNA polymerase III transcription factor 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.85
KOG2003 840 consensus TPR repeat-containing protein [General f 99.84
KOG2076895 consensus RNA polymerase III transcription factor 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG1915677 consensus Cell cycle control protein (crooked neck 99.78
KOG1915677 consensus Cell cycle control protein (crooked neck 99.75
KOG2003 840 consensus TPR repeat-containing protein [General f 99.72
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.66
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.65
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.64
KOG0547606 consensus Translocase of outer mitochondrial membr 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
KOG0547606 consensus Translocase of outer mitochondrial membr 99.6
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.58
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.58
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.56
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.53
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.53
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.51
PRK12370553 invasion protein regulator; Provisional 99.51
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.5
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.48
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.45
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.42
PRK12370553 invasion protein regulator; Provisional 99.42
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.41
KOG2376652 consensus Signal recognition particle, subunit Srp 99.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.37
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.37
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.36
KOG1129478 consensus TPR repeat-containing protein [General f 99.35
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.35
KOG1129478 consensus TPR repeat-containing protein [General f 99.34
KOG2376652 consensus Signal recognition particle, subunit Srp 99.32
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.3
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.27
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.27
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.26
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.25
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.25
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.24
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.22
PRK11189296 lipoprotein NlpI; Provisional 99.21
PF1304150 PPR_2: PPR repeat family 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.19
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.18
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.16
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.14
PF1304150 PPR_2: PPR repeat family 99.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.12
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.11
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.08
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.05
PRK04841903 transcriptional regulator MalT; Provisional 99.03
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.02
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.97
PRK04841 903 transcriptional regulator MalT; Provisional 98.94
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.94
PLN02789320 farnesyltranstransferase 98.9
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.9
PLN02789320 farnesyltranstransferase 98.84
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.83
KOG1125579 consensus TPR repeat-containing protein [General f 98.83
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.82
KOG1125579 consensus TPR repeat-containing protein [General f 98.81
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.75
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.71
KOG1128777 consensus Uncharacterized conserved protein, conta 98.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.66
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.65
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.62
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.61
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.61
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.6
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.6
PF1285434 PPR_1: PPR repeat 98.58
PRK15359144 type III secretion system chaperone protein SscB; 98.57
PF1285434 PPR_1: PPR repeat 98.56
PRK10370198 formate-dependent nitrite reductase complex subuni 98.54
PRK15359144 type III secretion system chaperone protein SscB; 98.51
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.46
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.45
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.43
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.39
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.29
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.18
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.04
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.98
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.95
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.95
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
KOG20411189 consensus WD40 repeat protein [General function pr 97.88
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.87
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.87
KOG20411189 consensus WD40 repeat protein [General function pr 97.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.83
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.83
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.81
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.77
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.73
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.71
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.66
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.63
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.62
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.62
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.6
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.6
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.56
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.55
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.54
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.54
KOG0553304 consensus TPR repeat-containing protein [General f 97.52
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.51
COG4700251 Uncharacterized protein conserved in bacteria cont 97.51
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.51
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.5
PF12688120 TPR_5: Tetratrico peptide repeat 97.49
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.46
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.46
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.44
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.44
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.42
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.41
COG4700251 Uncharacterized protein conserved in bacteria cont 97.39
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.38
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.34
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.31
COG3898531 Uncharacterized membrane-bound protein [Function u 97.31
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.27
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.23
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.21
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.19
PF12688120 TPR_5: Tetratrico peptide repeat 97.14
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.13
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.13
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.1
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.94
PF1337173 TPR_9: Tetratricopeptide repeat 96.94
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.9
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.89
PRK10803263 tol-pal system protein YbgF; Provisional 96.84
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.82
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.79
PRK10803263 tol-pal system protein YbgF; Provisional 96.75
PRK15331165 chaperone protein SicA; Provisional 96.73
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.66
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.65
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.61
PF1337173 TPR_9: Tetratricopeptide repeat 96.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.51
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.44
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.32
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.23
PRK15331165 chaperone protein SicA; Provisional 96.21
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.18
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.17
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.13
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.1
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.07
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.03
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.96
PRK11906458 transcriptional regulator; Provisional 95.95
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.93
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.88
KOG1258577 consensus mRNA processing protein [RNA processing 95.87
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.74
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.7
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.7
KOG4555175 consensus TPR repeat-containing protein [Function 95.58
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.57
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.47
KOG1585308 consensus Protein required for fusion of vesicles 95.46
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.45
PRK11906458 transcriptional regulator; Provisional 95.45
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.36
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.35
PF13512142 TPR_18: Tetratricopeptide repeat 95.31
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.2
KOG4555175 consensus TPR repeat-containing protein [Function 95.17
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.09
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.08
PF1342844 TPR_14: Tetratricopeptide repeat 95.04
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.96
KOG1585308 consensus Protein required for fusion of vesicles 94.81
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.77
smart00299140 CLH Clathrin heavy chain repeat homology. 94.68
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.66
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.63
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.61
KOG1258577 consensus mRNA processing protein [RNA processing 94.54
PF1342844 TPR_14: Tetratricopeptide repeat 94.4
KOG1550552 consensus Extracellular protein SEL-1 and related 94.34
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.34
smart00299140 CLH Clathrin heavy chain repeat homology. 94.27
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.99
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.8
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.24
KOG4234271 consensus TPR repeat-containing protein [General f 93.11
KOG3941406 consensus Intermediate in Toll signal transduction 93.1
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.1
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.96
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.73
PRK09687280 putative lyase; Provisional 92.72
KOG1550552 consensus Extracellular protein SEL-1 and related 92.32
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.13
PF1343134 TPR_17: Tetratricopeptide repeat 92.02
KOG3941406 consensus Intermediate in Toll signal transduction 91.98
PF13512142 TPR_18: Tetratricopeptide repeat 91.88
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.67
COG3629280 DnrI DNA-binding transcriptional activator of the 91.67
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.63
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.61
PF1343134 TPR_17: Tetratricopeptide repeat 91.6
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.37
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.29
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.24
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.14
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.1
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.05
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.83
COG3629280 DnrI DNA-binding transcriptional activator of the 90.83
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.8
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.75
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.74
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.64
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.16
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.04
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 89.97
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.73
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.53
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.27
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.0
COG2976207 Uncharacterized protein conserved in bacteria [Fun 88.38
PRK09687280 putative lyase; Provisional 88.26
KOG4648536 consensus Uncharacterized conserved protein, conta 88.09
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.01
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.9
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.38
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.27
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.12
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.81
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.52
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.19
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.14
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 85.01
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.78
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.42
KOG4234271 consensus TPR repeat-containing protein [General f 84.29
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 84.09
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.78
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.58
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.33
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 83.09
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 83.03
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 82.33
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.22
PF10155126 DUF2363: Uncharacterized conserved protein (DUF236 81.85
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 81.57
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.3
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.26
KOG2062 929 consensus 26S proteasome regulatory complex, subun 81.19
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 80.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.37
COG3947361 Response regulator containing CheY-like receiver a 80.21
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.8e-76  Score=675.08  Aligned_cols=592  Identities=20%  Similarity=0.292  Sum_probs=471.8

Q ss_pred             CChHHHHHHHHHhhhCCCCCCCHHHHHHHHHHHHhcCChhhHHHHHHHHHhccchh---hhHHHhhcCC-----------
Q 004814          102 EKPRIALRFFRWVETQPGVKRDEFVFCTILEILIESGLLRSAYWVVETVVCVNMHG---ILDVLIGGGL-----------  167 (729)
Q Consensus       102 ~~~~~al~~f~~~~~~~~~~~~~~~~~~l~~~l~~~g~~~~A~~~~~~~~~~~~~~---~~~~l~~~~~-----------  167 (729)
                      +++..|+.+|+.+.. .|++|+..+|..++..+.+.+.++.|..++..+++.++..   +.+.++..+.           
T Consensus        65 g~~~~A~~l~~~m~~-~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~  143 (857)
T PLN03077         65 GQLEQALKLLESMQE-LRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYV  143 (857)
T ss_pred             CCHHHHHHHHHHHHh-cCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHH
Confidence            345555555555542 3445555555555555555555555555555444433210   0111111000           


Q ss_pred             ---CCcchHHHHHHHHHHHHcCCCHHHHHHHHHHHHHCCCCCChHhHHHHHHHHHHCCChhHHHHHHHHHHhCCCCCChh
Q 004814          168 ---SSCVSIKILDLLLLIYTKKSMVEQCLLVFNKMLRNGLLPDVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIV  244 (729)
Q Consensus       168 ---~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~l~~~g~~~~A~~~~~~~~~~~~~~~~~  244 (729)
                         -...+...|+.++.+|++.|++++|+++|++|.+.|+.||..+|+.++.++.+.+++..+.+++..|.+.|+.||..
T Consensus       144 f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~  223 (857)
T PLN03077        144 FGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVD  223 (857)
T ss_pred             HhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccc
Confidence               00123457888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             hHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHhCCCccChhhHHHHHHHHH
Q 004814          245 TYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYS  324 (729)
Q Consensus       245 ~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~  324 (729)
                      +||.|+.+|++.|++++|.++|++|.+    ||.++||++|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+++
T Consensus       224 ~~n~Li~~y~k~g~~~~A~~lf~~m~~----~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~  299 (857)
T PLN03077        224 VVNALITMYVKCGDVVSARLVFDRMPR----RDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACE  299 (857)
T ss_pred             hHhHHHHHHhcCCCHHHHHHHHhcCCC----CCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHH
Confidence            888888888888888888888888864    5788888888888888888888888888888888888888888888888


Q ss_pred             hCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHHcCCHHHHHH
Q 004814          325 EKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRVSDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFL  404 (729)
Q Consensus       325 ~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~  404 (729)
                      +.|+.+.|.+++..|.+.|+.||..+|++|+.+|++.|++++|.++|++|..    ||..+|+.+|.+|++.|++++|++
T Consensus       300 ~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~----~d~~s~n~li~~~~~~g~~~~A~~  375 (857)
T PLN03077        300 LLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMET----KDAVSWTAMISGYEKNGLPDKALE  375 (857)
T ss_pred             hcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCC----CCeeeHHHHHHHHHhCCCHHHHHH
Confidence            8888888888888888888888888888888888888888888888888865    788888888888888888888888


Q ss_pred             HHHHHhhCCCCCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCC
Q 004814          405 LFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGL  484 (729)
Q Consensus       405 l~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~  484 (729)
                      +|++|.+.|+.||..||+.++.+|++.|+++.|.++++.|.+.|+.|+..+|+.|+++|++.|++++|.++|++|.+   
T Consensus       376 lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~---  452 (857)
T PLN03077        376 TYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPE---  452 (857)
T ss_pred             HHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCC---
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888764   


Q ss_pred             CCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHH
Q 004814          485 QPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSI  564 (729)
Q Consensus       485 ~~~~~~~~~li~~~~~~g~~~~A~~l~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l  564 (729)
                       +|..+|+.++.+|++.|+.++|+.+|++|.. +++||..+|+.++.+|++.|..+.+.+++..+.+.|+.+|..+++++
T Consensus       453 -~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naL  530 (857)
T PLN03077        453 -KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNAL  530 (857)
T ss_pred             -CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHH
Confidence             4777888888888888888888888888875 47888888888888888888888888888888888888888888888


Q ss_pred             HHHHHhcCCHHHHHHHHHHHHHCCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCH
Q 004814          565 IHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRI  644 (729)
Q Consensus       565 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~~  644 (729)
                      +++|++.|++++|.++|+.+     .+|..+||.+|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|++.|++
T Consensus       531 i~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v  605 (857)
T PLN03077        531 LDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMV  605 (857)
T ss_pred             HHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChH
Confidence            88888888888888888776     4788888888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHHH-HcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHhhhccchhhc
Q 004814          645 DQAYGLFIDME-EEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKVH  716 (729)
Q Consensus       645 ~~A~~~~~~m~-~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~pd~~~~~~ll~~~l~~~g~~~  716 (729)
                      ++|.++|++|. +.|+.|+..+|+.++++|+++|++++|.+++++|   +++||..+|.++ +..+...|+.+
T Consensus       606 ~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m---~~~pd~~~~~aL-l~ac~~~~~~e  674 (857)
T PLN03077        606 TQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKM---PITPDPAVWGAL-LNACRIHRHVE  674 (857)
T ss_pred             HHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHC---CCCCCHHHHHHH-HHHHHHcCChH
Confidence            88888888888 5788888888888888888888888888888888   578888888888 55566666665



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10155 DUF2363: Uncharacterized conserved protein (DUF2363); InterPro: IPR019312 This entry represents a region of 120 amino acids in proteins conserved from plants to humans Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 2e-06
4g23_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 8e-05
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 44/149 (29%), Positives = 62/149 (41%), Gaps = 26/149 (17%) Query: 500 KLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHI 559 K GD EA RL +E G YNVL++ +C L E A E Sbjct: 38 KKGDVLEALRLYDEARRNGVQLSQYHYNVLLY-VCSLA--EAATE--------------- 79 Query: 560 TYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHAARGRLELAFMYFSEM 619 +S G L RG D+F M+ + P T+T A+ E+AF +M Sbjct: 80 -------SSPNPG-LSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQM 131 Query: 620 QVKGIRPNVITYNALINGLCRLRRIDQAY 648 + GI+P + +Y + G CR D+AY Sbjct: 132 KAFGIQPRLRSYGPALFGFCRKGDADKAY 160
>pdb|4G23|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-06
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 95.3 bits (235), Expect = 3e-20
 Identities = 40/245 (16%), Positives = 74/245 (30%), Gaps = 15/245 (6%)

Query: 480 LRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSL 539
           L + LQ +    + Q+AG L+           EE LA+                    SL
Sbjct: 60  LTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKL-----------SL 108

Query: 540 EEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFN---NMLRKGLSPTLVTY 596
           +       +              +     L    L     L        +K    TL  Y
Sbjct: 109 DVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMY 168

Query: 597 TVLIHAHAARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYG-LFIDME 655
             ++   A +G  +        ++  G+ P++++Y A +  + R  +           M 
Sbjct: 169 NAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMS 228

Query: 656 EEGILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLDKDYKV 715
           +EG+        +L++E   A   +   ++          P     S LL     KD +V
Sbjct: 229 QEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRV 288

Query: 716 HAVEY 720
              + 
Sbjct: 289 SYPKL 293


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.76
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.67
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.61
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.44
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.39
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.3
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.14
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.07
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.07
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.02
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.01
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.01
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.01
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.97
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.94
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.92
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.82
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.8
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.75
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.75
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.73
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.72
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.65
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.65
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.61
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.61
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.6
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.6
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.6
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.59
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.58
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.55
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.52
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.49
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.48
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.45
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.45
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.41
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.41
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.4
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.4
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.35
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.33
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.3
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.25
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.18
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.15
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.15
3k9i_A117 BH0479 protein; putative protein binding protein, 98.15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.15
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.04
3k9i_A117 BH0479 protein; putative protein binding protein, 98.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.02
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.0
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.98
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.98
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.76
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.75
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.74
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.72
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.61
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.52
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.42
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.34
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.96
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.94
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.87
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.78
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.77
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.71
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.62
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.56
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.46
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.45
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.43
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.32
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.95
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.85
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.77
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.69
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.47
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.27
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.14
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.81
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.58
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.26
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.31
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.03
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.94
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.66
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.61
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.28
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.17
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 89.76
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.2
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 89.16
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.83
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.5
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.96
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.25
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.07
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.29
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.28
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.23
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.93
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.75
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.26
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 81.59
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 80.58
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=5.4e-42  Score=383.42  Aligned_cols=489  Identities=11%  Similarity=-0.003  Sum_probs=348.6

Q ss_pred             ChHhHHHHHHHHHHCCChhHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHH
Q 004814          207 DVKNCNRIIKVLRDNGFSVKAREVYRMMGEFGIKPSIVTYNTMLDSFCKEGEMQEALELLWEMQGRGCSPNGVTYNVLIT  286 (729)
Q Consensus       207 ~~~~~~~ll~~l~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~  286 (729)
                      ++..|+.++..+.+.|++++|..+|+++.+.  .|+..++..++.+|.+.|++++|..+|+++...  +++..+++.++.
T Consensus        83 ~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~  158 (597)
T 2xpi_A           83 REDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYLAAF  158 (597)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHHHHH
Confidence            4444555555555555555555555555432  344455555555555555555555555554332  344555555555


Q ss_pred             HHHhCCCHHHHHHHHHHHHh---------------CCCccChhhHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHH
Q 004814          287 GFSRNGELEQARGLIRDMLK---------------LGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATY  351 (729)
Q Consensus       287 ~~~~~g~~~~A~~~~~~m~~---------------~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~  351 (729)
                      +|.+.|++++|.++|+++..               .+.+.+..+|+.++.+|.+.|++++|.++|++|.+.++. +...+
T Consensus       159 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~  237 (597)
T 2xpi_A          159 CLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAF  237 (597)
T ss_dssp             HHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHH
T ss_pred             HHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHH
Confidence            55555555555555543211               122335667777777777777777777777777765433 44455


Q ss_pred             HHHHHHHHhcCCHHHHHH--H-HHHHHHCCCCCCHhHHHHHHHHHHHcCCHHHHHHHHHHHhhCCCCCCHhhHHHHHHHH
Q 004814          352 NILIYGLCKWGRVSDARH--R-FFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGL  428 (729)
Q Consensus       352 ~~li~~~~~~g~~~~A~~--~-~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~ll~~~  428 (729)
                      ..+...+...+..+.+..  + +..+...+..+...+|+.++..|.+.|++++|.++|+++.+.  +++..+++.++.+|
T Consensus       238 ~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~  315 (597)
T 2xpi_A          238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTL  315 (597)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHH
Confidence            555544433322222111  1 344444343344555666677777788888888888877664  46777888888888


Q ss_pred             HhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCCHHHHH
Q 004814          429 CRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAY  508 (729)
Q Consensus       429 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~  508 (729)
                      .+.|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|.++++++.+.. ..+..++..++..|.+.|++++|.
T Consensus       316 ~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~  393 (597)
T 2xpi_A          316 FVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEAR  393 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHH
T ss_pred             HHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHH
Confidence            88888888888888887765 3466777888888888888888888888887653 335777777888888888888888


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCC
Q 004814          509 RLQEEMLAKGFPPDLITYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKG  588 (729)
Q Consensus       509 ~l~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  588 (729)
                      ++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.+. .+..++..++.+|.+.|++++|.++|+++.+..
T Consensus       394 ~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  471 (597)
T 2xpi_A          394 RYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ-GTHLPYLFLGMQHMQLGNILLANEYLQSSYALF  471 (597)
T ss_dssp             HHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT-TCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-cchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC
Confidence            8888887653 55788899999999999999999999999988753 477889999999999999999999999998875


Q ss_pred             CCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHC----CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCC
Q 004814          589 LSPTLVTYTVLIHAHAARGRLELAFMYFSEMQVK----GIRPN--VITYNALINGLCRLRRIDQAYGLFIDMEEEGILPN  662 (729)
Q Consensus       589 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~----g~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~g~~p~  662 (729)
                       +.+..+|+.++.+|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.+.++++.+.+ +.+
T Consensus       472 -~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~  549 (597)
T 2xpi_A          472 -QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TND  549 (597)
T ss_dssp             -CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCC
T ss_pred             -CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCC
Confidence             567889999999999999999999999999875    56777  7899999999999999999999999999875 568


Q ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHhhhc
Q 004814          663 KYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCTHSALLLKQLD  710 (729)
Q Consensus       663 ~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~pd~~~~~~ll~~~l~  710 (729)
                      ..+|..++.+|.+.|++++|.+.+++++  .+.|+.......++.+|.
T Consensus       550 ~~~~~~l~~~~~~~g~~~~A~~~~~~~l--~~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          550 ANVHTAIALVYLHKKIPGLAITHLHESL--AISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHH--HHCTTCHHHHHHHHHTTC
T ss_pred             hHHHHHHHHHHHHhCCHHHHHHHHHHHH--hcCCCChHHHHHHHHHHh
Confidence            8899999999999999999999999999  677876655555576664



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 729
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.5 bits (101), Expect = 6e-05
 Identities = 55/368 (14%), Positives = 121/368 (32%), Gaps = 24/368 (6%)

Query: 362 GRVSDARHRFFEMLRKNVIPD-IISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVV- 419
           G    A     ++ R+   PD       L   + +   +  +         +N  P +  
Sbjct: 13  GDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN--PLLAE 68

Query: 420 TYNTLIDGLCRYGDLEVAQQLKENMINQGILPDVITYTIMVNGSCKMGNLSMAREFFNEM 479
            Y+ L +     G L+ A +   + +            +              + + + +
Sbjct: 69  AYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSAL 128

Query: 480 LRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLITYNVLVHGLCKLGSL 539
                     +    +   L   + ++A  L+        P   + ++ L       G +
Sbjct: 129 QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIE---TQPNFAVAWSNLGCVFNAQGEI 185

Query: 540 EEANELLRKMVGDGFIPDHI-TYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTV 598
             A     K V     P+ +  Y ++ +   E     R    +   L        V +  
Sbjct: 186 WLAIHHFEKAVT--LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGN 242

Query: 599 LIHAHAARGRLELAFMYFSEMQVKGIRPN-VITYNALINGLCRLRRIDQAYGLFIDMEEE 657
           L   +  +G ++LA   +   +   ++P+    Y  L N L     + +A   + +    
Sbjct: 243 LACVYYEQGLIDLAIDTYR--RAIELQPHFPDAYCNLANALKEKGSVAEAEDCY-NTALR 299

Query: 658 GILPNKYTYTILINENCNAGNWQEALRLYKEMLDREIEPDYCT---HSALLLKQLDKDYK 714
               +  +   L N     GN +EA+RLY++ L  E+ P++     + A +L+Q  K  +
Sbjct: 300 LCPTHADSLNNLANIKREQGNIEEAVRLYRKAL--EVFPEFAAAHSNLASVLQQQGKLQE 357

Query: 715 VHAVEYLE 722
             A+ + +
Sbjct: 358 --ALMHYK 363


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.33
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.15
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.14
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.12
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.09
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.63
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.6
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.53
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.53
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.32
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.31
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.17
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.12
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.06
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.05
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.03
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.93
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.76
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.72
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.64
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.61
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.0
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.4
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.78
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.12
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.74
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.7
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.1
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 82.93
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=5.2e-22  Score=205.42  Aligned_cols=382  Identities=15%  Similarity=0.056  Sum_probs=203.5

Q ss_pred             HHHHHhCCCHHHHHHHHHHHHhCCCccChhhHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCH
Q 004814          285 ITGFSRNGELEQARGLIRDMLKLGLKVSAHSYNPIICGYSEKGLLVEALNLEEEMVTRGVAPTLATYNILIYGLCKWGRV  364 (729)
Q Consensus       285 i~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~  364 (729)
                      ...+.+.|++++|.+.++++++.. +-+..++..+...|.+.|++++|.+.++++.+..+. +..+|..+...|.+.|++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhccc
Confidence            344555666666666666665543 224455555555566666666666666555554322 344555555555555555


Q ss_pred             HHHHHHHHHHHHCCCCCCHhHHHHHHHHHHHcCCHHHHHHHHHHHhhCCCCCCHhhHHHHHHHHHhcCCHHHHHHHHHHH
Q 004814          365 SDARHRFFEMLRKNVIPDIISYNTLLYGYCRSGNIGEAFLLFDELRSRNLVPTVVTYNTLIDGLCRYGDLEVAQQLKENM  444 (729)
Q Consensus       365 ~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~  444 (729)
                      ++|.+.+........ .+..............+....+...........                               
T Consensus        84 ~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------  131 (388)
T d1w3ba_          84 QEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-------------------------------  131 (388)
T ss_dssp             HHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-------------------------------
T ss_pred             ccccccccccccccc-ccccccccccccccccccccccccccccccccc-------------------------------
Confidence            555555555554332 223333333333333333333333333322221                               


Q ss_pred             HHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHH
Q 004814          445 INQGILPDVITYTIMVNGSCKMGNLSMAREFFNEMLRKGLQPDRFAYTTQIAGELKLGDTSEAYRLQEEMLAKGFPPDLI  524 (729)
Q Consensus       445 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~l~~~~~~~~~~~~~~  524 (729)
                           .................+....+...+.+...... .+...+..+...+...|++++|...++..++.. |.+..
T Consensus       132 -----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~  204 (388)
T d1w3ba_         132 -----PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQP-NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLD  204 (388)
T ss_dssp             -----TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHH
T ss_pred             -----cccccccccccccccccchhhhhHHHHHHhhccCc-chhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHH
Confidence                 12222233333333444444444444444443321 123344444444555555555555555544432 33455


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCChhhHHHHHHHHH
Q 004814          525 TYNVLVHGLCKLGSLEEANELLRKMVGDGFIPDHITYTSIIHASLEMGDLRRGRDLFNNMLRKGLSPTLVTYTVLIHAHA  604 (729)
Q Consensus       525 ~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~  604 (729)
                      .+..+...+...|++++|...+++...... .+...+..+...+.+.|++++|.+.++++++.. +.+..++..+...+.
T Consensus       205 ~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~  282 (388)
T d1w3ba_         205 AYINLGNVLKEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALK  282 (388)
T ss_dssp             HHHHHHHHHHTTTCTTHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHH
T ss_pred             HHHHHhhhhhccccHHHHHHHHHHhHHHhh-hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHH
Confidence            556666666666666666666666655432 245555566666666666666666666666553 344556666666666


Q ss_pred             HcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHH
Q 004814          605 ARGRLELAFMYFSEMQVKGIRPNVITYNALINGLCRLRRIDQAYGLFIDMEEEGILPNKYTYTILINENCNAGNWQEALR  684 (729)
Q Consensus       605 ~~g~~~~A~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~  684 (729)
                      ..|++++|.+.++..... .+.+...+..++..+.+.|++++|++.+++.++.. +.+..++..++.+|.+.|++++|+.
T Consensus       283 ~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~  360 (388)
T d1w3ba_         283 EKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALM  360 (388)
T ss_dssp             HHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHH
T ss_pred             HcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHH
Confidence            667777777766666654 23355566666666777777777777777666542 3344566666677777777777777


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHhhhccch
Q 004814          685 LYKEMLDREIEPDYCTHSALLLKQLDKDY  713 (729)
Q Consensus       685 ~~~~m~~~~~~pd~~~~~~ll~~~l~~~g  713 (729)
                      .|++++  .+.|+......-++.+|.+.|
T Consensus       361 ~~~~al--~l~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         361 HYKEAI--RISPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             HHHHHH--TTCTTCHHHHHHHHHHHHHTC
T ss_pred             HHHHHH--HhCCCCHHHHHHHHHHHHHcC
Confidence            777766  556654333333255555443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure