Citrus Sinensis ID: 004861
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 726 | ||||||
| 225432464 | 893 | PREDICTED: putative E3 ubiquitin-protein | 0.979 | 0.796 | 0.740 | 0.0 | |
| 255551557 | 894 | conserved hypothetical protein [Ricinus | 0.983 | 0.798 | 0.739 | 0.0 | |
| 356555592 | 855 | PREDICTED: putative E3 ubiquitin-protein | 0.973 | 0.826 | 0.669 | 0.0 | |
| 356520015 | 890 | PREDICTED: putative E3 ubiquitin-protein | 0.965 | 0.787 | 0.634 | 0.0 | |
| 449432767 | 901 | PREDICTED: putative E3 ubiquitin-protein | 0.986 | 0.794 | 0.654 | 0.0 | |
| 449495437 | 901 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.986 | 0.794 | 0.650 | 0.0 | |
| 356549037 | 883 | PREDICTED: putative E3 ubiquitin-protein | 0.961 | 0.790 | 0.651 | 0.0 | |
| 356564559 | 877 | PREDICTED: putative E3 ubiquitin-protein | 0.958 | 0.793 | 0.631 | 0.0 | |
| 224102555 | 762 | predicted protein [Populus trichocarpa] | 0.833 | 0.793 | 0.646 | 0.0 | |
| 357447567 | 929 | Baculoviral IAP repeat-containing protei | 0.942 | 0.736 | 0.635 | 0.0 |
| >gi|225432464|ref|XP_002277269.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1060 bits (2740), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 538/727 (74%), Positives = 596/727 (81%), Gaps = 16/727 (2%)
Query: 1 MASLVAKGSSS-SCQVSPLMLVQEKGSRNKRKFRADPPLGEPNKIIPSPQNECPTYEFTA 59
M+S+ GSS+ Q SP + QEKGSRNKRKFRADPPLG+PNKI+ S Q++C +YEF+A
Sbjct: 1 MSSMAVNGSSTCGTQGSPSVSAQEKGSRNKRKFRADPPLGDPNKIVSS-QDQCLSYEFSA 59
Query: 60 EKFDITPGHGQTGACDLCGVNQDHSDGLKLDLGLSSAVGSSEVGPSRPREELEVEEFQDA 119
EKF++T HGQ GAC +C +NQDHSDGLKLDLGLSSA GSSEVGPS+PR+ELE ++FQDA
Sbjct: 60 EKFEVTSSHGQPGACGMCNLNQDHSDGLKLDLGLSSAAGSSEVGPSQPRDELEADDFQDA 119
Query: 120 DWSDLTESQLEELVLSNLDAIFKSAIKKIVACGYMEEVATKAVLRSGLCYGSKDTVSNIV 179
DWSDLTESQLEELVLSNLD IFKSAIKKIVACGY EEVATKAVLRSGLCYG KDTVSNIV
Sbjct: 120 DWSDLTESQLEELVLSNLDTIFKSAIKKIVACGYSEEVATKAVLRSGLCYGCKDTVSNIV 179
Query: 180 DNTLAFLRSGQEINSSREHYFQDLPQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM 239
DNTLAFLR+GQEI+ SREHYF DL QLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM
Sbjct: 180 DNTLAFLRNGQEIDPSREHYFDDLQQLEKYILAELVCVLREVRPFFSTGDAMWCLLICDM 239
Query: 240 NVSHACAMDGDPLSSF-SGDGASNGNSHITTQLQTKTEAKCSELNLPNPSKPVPSIPCSH 298
NVSHACAMDGD SS SGDGASNG+S + Q Q+KTEAK SELNLPNP PV SIPC+H
Sbjct: 240 NVSHACAMDGDSFSSIVSGDGASNGSSSTSGQPQSKTEAKSSELNLPNPCNPVHSIPCAH 299
Query: 299 SSQPEAPTVAGIPNITKSKNSHV-GSEISEKDGTNSISDNVDKTFSVAGTSQSPALEEKF 357
SSQ E P +G+PN+ K KNS V +SEKDG N+ SD DK+FSV GTSQS A EEKF
Sbjct: 300 SSQSETPIASGVPNLAKPKNSLVLNGLVSEKDGLNNTSDTTDKSFSVTGTSQSAAPEEKF 359
Query: 358 VGSRKVHSGSSKREYMLRQKSLHLEKHYRTYGSKGSSRAGKLSGLGGLILDKKLKSVSDT 417
SRKVHSG +KRE MLRQKSLHLEK+YRTYG KGSSR KLSGLG +LDKKLKSVSD+
Sbjct: 360 GLSRKVHSGGTKRESMLRQKSLHLEKNYRTYGCKGSSRTAKLSGLGSYMLDKKLKSVSDS 419
Query: 418 TSVNLKNASSKISKA--IEVHQDNGSHNLSTSPGTSSPATFHSQGANAISALPKTSMPST 475
T VNLKNAS KISKA ++V QDNG+HNLS + G SS A F+ + N I +LPKT+ PS
Sbjct: 420 TGVNLKNASLKISKAMGVDVPQDNGNHNLSPNSGLSSSAAFNLETVNTIGSLPKTNSPSA 479
Query: 476 FPPGGTPAVLPLANTLPVLSAADTELSLSLPTKSNSTQVPAGINSVAPNCGYAGILSDDT 535
PP TP P+ S ADTELSLSL TKSNS VP N+ NC Y GI D
Sbjct: 480 LPPVNTP---------PIPSGADTELSLSLTTKSNSAPVPLSCNAETSNCSYTGI-PYDK 529
Query: 536 SLEHLVPQDKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQE 595
SL VPQDK+DE+ILKL+PRVREL NQL EWTEWANQKVMQAARRL KDKAELKTLRQE
Sbjct: 530 SLGQWVPQDKKDEMILKLVPRVRELQNQLQEWTEWANQKVMQAARRLGKDKAELKTLRQE 589
Query: 596 KEEVERLKKEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAA 655
KEEVERLKKEKQ LE+NT KKLSEMENAL KASGQVERAN+AVRRLEVEN++LRQEMEAA
Sbjct: 590 KEEVERLKKEKQTLEDNTAKKLSEMENALGKASGQVERANAAVRRLEVENSSLRQEMEAA 649
Query: 656 KLRAAESAASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQ 715
KL AAESAASCQEVSKREKKT MKFQ+WEKQKA F EEL +EKR++ QL QEL+QA LQ
Sbjct: 650 KLEAAESAASCQEVSKREKKTLMKFQTWEKQKAFFHEELTSEKRRLAQLRQELEQATELQ 709
Query: 716 EQLEVFF 722
+QLE +
Sbjct: 710 DQLEARW 716
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255551557|ref|XP_002516824.1| conserved hypothetical protein [Ricinus communis] gi|223543912|gb|EEF45438.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356555592|ref|XP_003546114.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356520015|ref|XP_003528662.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449432767|ref|XP_004134170.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449495437|ref|XP_004159841.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein ligase RF298-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356549037|ref|XP_003542905.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356564559|ref|XP_003550520.1| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224102555|ref|XP_002312723.1| predicted protein [Populus trichocarpa] gi|222852543|gb|EEE90090.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357447567|ref|XP_003594059.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|355483107|gb|AES64310.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 726 | ||||||
| TAIR|locus:2062374 | 738 | AT2G35330 [Arabidopsis thalian | 0.297 | 0.292 | 0.365 | 2.4e-55 | |
| TAIR|locus:2033765 | 711 | AT1G32530 [Arabidopsis thalian | 0.176 | 0.180 | 0.422 | 1.3e-44 | |
| TAIR|locus:2139310 | 814 | AT4G03000 [Arabidopsis thalian | 0.803 | 0.716 | 0.267 | 4.1e-40 | |
| DICTYBASE|DDB_G0271670 | 374 | DDB_G0271670 [Dictyostelium di | 0.417 | 0.810 | 0.181 | 6e-05 |
| TAIR|locus:2062374 AT2G35330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 333 (122.3 bits), Expect = 2.4e-55, Sum P(2) = 2.4e-55
Identities = 83/227 (36%), Positives = 124/227 (54%)
Query: 499 TELSLSLP-TKSNSTQVPAGINSVAPNCGYAGILSD--DTSLEHLV---PQDKRDEIILK 552
T LS + T S + P S C ++ +L D +L+ V P++ +D+ ++
Sbjct: 344 TSLSCTAAATHSEKCEQPHVFGS--EEC-FSSVLEKFRDLNLDDNVDSAPEELKDDALIG 400
Query: 553 LIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTXXXXXXXXXXXXXXXXILEEN 612
L+ +V++L QL E +WA +K MQAA+++S + +ELK+ E++
Sbjct: 401 LLQQVQDLKKQLKERKDWAQKKAMQAAQKVSDELSELKSLRSEREEIQRVKKGKQTREDS 460
Query: 613 TMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMXXXXXXXXXXXXXCQEVSKR 672
T+KKLSEMENAL KASGQV++AN+ VR LE E+ +R EM C E SK+
Sbjct: 461 TLKKLSEMENALRKASGQVDKANAVVRALENESAEIRAEMEASKLSASESLTACMEASKK 520
Query: 673 EKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLE 719
EKK K +WEKQK Q+E+ EK K+ L + L A+ QE+ E
Sbjct: 521 EKKCLKKLLAWEKQKMKLQDEITAEKEKIKALNRAL--AQITQEEKE 565
|
|
| TAIR|locus:2033765 AT1G32530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139310 AT4G03000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 726 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 2e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 2e-04 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 64.4 bits (157), Expect = 2e-10
Identities = 37/172 (21%), Positives = 78/172 (45%)
Query: 548 EIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKKEKQ 607
E + + + E +L E E +++ + L + L L++E EE+E ++ Q
Sbjct: 733 EQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQ 792
Query: 608 ILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAASCQ 667
E ++L E E L ++E RLE E L +E+E + + E +
Sbjct: 793 EELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELE 852
Query: 668 EVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLE 719
E+ K ++ + + + E +K ++EL + + +L +EL + ++ +L+
Sbjct: 853 ELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELK 904
|
Length = 1163 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.13 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.02 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.6 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.45 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.3 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.16 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.13 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.06 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.03 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 95.94 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.84 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.76 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 95.67 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.67 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.4 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.26 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.13 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 94.95 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 94.63 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.53 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 94.45 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.36 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.34 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 94.32 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 94.29 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 94.21 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.04 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 93.96 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 93.9 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 93.85 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 93.72 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.65 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 93.64 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.47 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 93.3 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 93.18 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.84 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 92.53 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 92.34 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.27 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 92.25 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 92.11 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.85 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 91.83 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 91.83 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 91.75 | |
| PF13514 | 1111 | AAA_27: AAA domain | 91.69 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 91.58 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 91.29 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 91.21 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 91.11 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 91.01 | |
| PF13514 | 1111 | AAA_27: AAA domain | 90.99 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 90.95 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.88 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 90.73 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 90.69 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 90.6 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 90.1 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 90.1 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.09 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 90.08 | |
| PF13166 | 712 | AAA_13: AAA domain | 90.06 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 90.02 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 89.73 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 89.51 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 89.33 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 89.33 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 89.16 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 89.12 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 89.1 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 89.03 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 88.94 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 88.82 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 88.6 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 88.59 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 88.57 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 88.45 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.37 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 88.22 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 88.16 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 87.91 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 87.87 | |
| PRK09039 | 343 | hypothetical protein; Validated | 87.67 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 87.53 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 87.37 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 87.32 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 87.3 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 87.11 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 87.02 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 86.89 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 86.77 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 86.72 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.63 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 86.6 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 86.55 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 86.49 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 86.19 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 86.11 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 85.89 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 85.75 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 85.69 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 85.51 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 85.38 | |
| PF05600 | 507 | DUF773: Protein of unknown function (DUF773); Inte | 85.33 | |
| PF07246 | 264 | Phlebovirus_NSM: Phlebovirus nonstructural protein | 85.31 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 85.29 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 85.28 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 85.17 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 84.95 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 84.71 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 84.67 | |
| PF15369 | 328 | KIAA1328: Uncharacterised protein KIAA1328 | 84.53 | |
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 84.52 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 84.51 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 84.5 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 84.39 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 84.09 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 83.87 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.83 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 83.81 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 83.76 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 83.62 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 82.93 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 82.85 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 82.65 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 82.48 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 82.15 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 82.13 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 81.95 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 81.63 | |
| PF05615 | 139 | THOC7: Tho complex subunit 7; InterPro: IPR008501 | 81.21 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 81.16 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 80.5 | |
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 80.44 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 80.4 |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Probab=97.13 E-value=0.11 Score=62.61 Aligned_cols=17 Identities=18% Similarity=0.261 Sum_probs=6.4
Q ss_pred HHhHHHHHHHHHHHHHH
Q 004861 680 FQSWEKQKALFQEELVT 696 (726)
Q Consensus 680 ~qsWEkQK~lLQEELa~ 696 (726)
+..++.+...+++++..
T Consensus 345 ~~~~~~~~~~~~~~l~~ 361 (1164)
T TIGR02169 345 IEEERKRRDKLTEEYAE 361 (1164)
T ss_pred HHHHHHHHHHHHHHHHH
Confidence 33333333333333333
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. |
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF05600 DUF773: Protein of unknown function (DUF773); InterPro: IPR008491 This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown | Back alignment and domain information |
|---|
| >PF07246 Phlebovirus_NSM: Phlebovirus nonstructural protein NS-M; InterPro: IPR009879 This entry consists of several Phlebovirus nonstructural NS-M proteins, which represent the N-terminal region of the M polyprotein precursor | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15369 KIAA1328: Uncharacterised protein KIAA1328 | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 726 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 5e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 1e-05 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 1e-05 | |
| 4f61_I | 240 | Stathmin-like domain R4; alpha-tubulin, beta-tubul | 3e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 2e-04 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 4e-04 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 6e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 65.2 bits (159), Expect = 5e-11
Identities = 32/175 (18%), Positives = 69/175 (39%), Gaps = 4/175 (2%)
Query: 545 KRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLKK 604
+DE + + R ++ +L E + Q + K +AE + + +E RL
Sbjct: 861 AKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAA 920
Query: 605 EKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESAA 664
+KQ LEE L EME + + + ++ + ++++ + L +++E + +
Sbjct: 921 KKQELEE----ILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQL 976
Query: 665 SCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQLE 719
+ KK + E Q +E + +V L L + + + L
Sbjct: 977 EKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLT 1031
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Length = 120 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.26 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.15 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.92 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.88 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 96.8 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.7 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.5 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.15 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.1 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.46 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.1 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.37 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 92.73 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.3 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 92.01 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 90.38 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 90.18 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 89.55 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 88.54 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 88.43 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 87.78 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 85.51 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 83.69 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 83.21 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 82.79 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 82.73 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 82.32 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 81.76 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 80.7 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=97.26 E-value=0.13 Score=48.38 Aligned_cols=15 Identities=27% Similarity=0.240 Sum_probs=5.7
Q ss_pred hhhhHHHHHHHHHhH
Q 004861 582 LSKDKAELKTLRQEK 596 (726)
Q Consensus 582 L~kdk~ELksLR~Ek 596 (726)
+..-..++..++.+.
T Consensus 43 ~~~~~~~~~~~~~~~ 57 (284)
T 1c1g_A 43 LVSLQKKLKATEDEL 57 (284)
T ss_dssp HHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHH
Confidence 333333334444333
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 726 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 6e-05 | |
| d2b3tb1 | 344 | e.38.1.1 (B:7-354) Peptide chain release factor 1, | 0.004 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.0 bits (103), Expect = 3e-05
Identities = 26/175 (14%), Positives = 63/175 (36%), Gaps = 7/175 (4%)
Query: 544 DKRDEIILKLIPRVRELHNQLHEWTEWANQKVMQAARRLSKDKAELKTLRQEKEEVERLK 603
+E + I + + + +K + R+ + + L+T + KE +
Sbjct: 133 SPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMT--- 189
Query: 604 KEKQILEENTMKKLSEMENALCKASGQVERANSAVRRLEVENTALRQEMEAAKLRAAESA 663
IL+ + E E + + + E A ++ + L Q ME + E
Sbjct: 190 --DAILQTDQTLTEKEKEIEVERV--KAESAQASAKMLHEMQRKNEQMMEQKERSYQEHL 245
Query: 664 ASCQEVSKREKKTQMKFQSWEKQKALFQEELVTEKRKVVQLLQELDQAKALQEQL 718
E + ++ +K Q L ++E + ++ + ++ + LQ ++
Sbjct: 246 KQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKM 300
|
| >d2b3tb1 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 {Escherichia coli [TaxId: 562]} Length = 344 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 91.15 |
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: MW0975(SA0943)-like family: MW0975(SA0943)-like domain: Hypothetical protein MW0975 (SA0943) species: Staphylococcus aureus [TaxId: 1280]
Probab=91.15 E-value=3.3 Score=33.84 Aligned_cols=28 Identities=25% Similarity=0.429 Sum_probs=10.9
Q ss_pred hhHHHHHHHHHHhhhhhhhhhhhHHHHH
Q 004861 615 KKLSEMENALCKASGQVERANSAVRRLE 642 (726)
Q Consensus 615 KrLsEmEnAL~kas~QlerAns~vrrLE 642 (726)
+.+.+....+..+..+++.+.....+++
T Consensus 69 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 96 (185)
T d2ap3a1 69 KEFEKEEDAIKKSEQDFKKAKSHVDNID 96 (185)
T ss_dssp HHHHHHHHHHHHHHHHHTTC-----CCC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3344444444555555555554444443
|