Citrus Sinensis ID: 004862

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720------
MSGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
ccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHccccEEEEEccHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEccccccEEEEEcccccccccccccccccccccccccccccEEEEccccEEEccEEEEEEcccccccccccccEEEEEEccccccccccccEEEEEEEEEEEccccccccccccccccccEEEEEEEEEEccccccccccccHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccEEccccccccccccEEEEEEccccccEEEEccEEEEEcccEEEEEcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEcccEEEEEcc
ccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHcccccccEHHHHHHHcccEEEEcHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccHHcccHHHHHHEEEcccEEEEccccccccEEEEEEEcccccEEEEEcccccccEEccccccccccccccccccccEEEEccccEEEEEEEEEEEccccccccccccccEEEEEcHHHHcccccccEEEEEEEEEEEEcccccccccccEEEEcEEEEEEEEEEEccccccccEcccHHHHHHHHHHHccccHHHHHHHHHccHHcccHHHHHHHHHHHHcccccccccccEEEccEEEEEEcccccHHHHHHHHHHHHcccEEEEccccccccEEEEEEEEcccccEEEEEccHEEEEcccEEEEccHccccHHHHHHHHHHHHHHHHHHHHHcHHEEEcHHHHHHHHcccccccccccccccccccccccHHccccEEEEEEccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEcccEEEEEEc
msgwdegavyysdqaqfpddavgatadanhRRHTTLIKFKEFIRNFerdknvfpyreslienpKFLLVHLEDLLafdadlpsllrsspadflpLFETAAAEVLASLKMkvdneepktEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLScknckstldvpcrpglggaivprscghipqageepcpidpwiivpdksqyvdQQTLKlqenpedvptgelprnmllSVDRHLvqtivpgtrltIMGIYSIfqsanspashkgavavrqpyIRVVGleetneassrgaAAFTQEEIEKFKKfasqpdayktvcskiapsifghddVKKAVSCLlfggsrknlpdgvklrgDVNVlllgdpstakSQFLKFVEKTApiavytsgkgssaagltasvirdgssrefyLEGGAMVladggvvcidefdkmrpedRVAIHEAMEQQTISIAKAGITTVLNSRTsvlaaanppsgryddlksaqdniDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHasadavsadskvskEENWLKRYIQYCRlechprlsesasAKLRDQYVQIRKDMRRQanetgeaapipiTVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKrripignqiserRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
MSGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLkmkvdneepktEEVQILltskedsmsmRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLqenpedvptgelPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKkfasqpdayKTVCSKIAPSIFGHDDVKKAVSCLLFGgsrknlpdgvkLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVytsgkgssaaglTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHasadavsadskvskeeNWLKRYIQYCRLEChprlsesasaklrDQYVQIRKDMRRqanetgeaapipitvrQLEAIVRLSEALAKMKLshvatenevnEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAetqikrripignqiserrliddltRMGMNESIIRRAliimhqrdeveykrerrvilrkv
MSGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLiashiikihasadavsadskvskEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
*******AVYYSD***F**DAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASL****************************SIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVD*******************RNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSAN****HKGAVAVRQPYIRVVGL*********************FKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLA****************DNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVSAD*KVSKEENWLKRYIQYCRLECHPRL******************************PIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIK***TQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEY***********
*SGWDEGAVYYSDQ************DANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPR****************PWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIF*************AVRQPYIRVVGLEE****************IEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLP**VKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIH****************NWLKRYIQYCRLECHPRLSESASAKLRDQYVQ*******************ITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVST**************************************ISE*RLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRK*
********VYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVD********VQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSA*********VAVRQPYIRVVGLEE**********AFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHAS************EENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
*****EG**YY*************T*DANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAV***SKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQA*****AAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVNLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEYKRERRVILRKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query726 2.2.26 [Sep-21-2011]
P55862735 DNA replication licensing N/A no 0.982 0.970 0.505 0.0
Q561P5735 DNA replication licensing yes no 0.987 0.975 0.504 0.0
P33992734 DNA replication licensing yes no 0.982 0.971 0.504 0.0
Q6PCI7735 DNA replication licensing N/A no 0.987 0.975 0.5 0.0
Q0V8B7734 DNA replication licensing yes no 0.983 0.972 0.5 0.0
P49718733 DNA replication licensing yes no 0.983 0.974 0.485 0.0
Q9VGW6733 DNA replication licensing yes no 0.979 0.969 0.486 0.0
P41389720 DNA replication licensing yes no 0.971 0.979 0.481 0.0
Q21902759 DNA replication licensing yes no 0.991 0.948 0.462 0.0
Q54CP4757 DNA replication licensing yes no 0.980 0.940 0.447 0.0
>sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS=Xenopus laevis GN=mcm5-a PE=1 SV=2 Back     alignment and function desciption
 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/744 (50%), Positives = 496/744 (66%), Gaps = 31/744 (4%)

Query: 1   MSGWDEGAVYYSD----QAQFPDDAVGATADANHRRHTTLIKFKEFIRNF----ERDKNV 52
           MSG+D+  VYYSD    + Q  DD     +    R       F+EF+R +    +R    
Sbjct: 1   MSGFDDLGVYYSDSFGGEQQVGDDGQAKKSQLKKR-------FREFLRQYRIGTDRTGFT 53

Query: 53  FPYRESLIENPK----FLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKM 108
           F YR+ L  +      ++ V +EDL +FD DL   L   P + L L E AA EV   +  
Sbjct: 54  FKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPTEHLQLLEEAAQEVADEVTR 113

Query: 109 KVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSC 168
                E   +E+Q++L S  +  ++RS+ ++ +S LVKI GI IAA+ V+AKAT + + C
Sbjct: 114 PRPAGEETIQEIQVMLRSDANPANIRSLKSEQMSHLVKIPGIIIAATAVRAKATKISIQC 173

Query: 169 KNCKSTL-DVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQE 227
           ++C++T+ ++  RPGL G  +PR C +  QAG   CP+DP+ I+PDK + VD QTLKLQE
Sbjct: 174 RSCRNTIGNIAVRPGLEGYAMPRKC-NTEQAGRPNCPLDPYFIIPDKCKCVDFQTLKLQE 232

Query: 228 NPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKG----AVAV 283
           +P+ VP GELPR+M L  DR+L   +VPG R+TIMGIYSI +S  +  S KG     V +
Sbjct: 233 SPDAVPHGELPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIRKSGKT--STKGRDRVGVGI 290

Query: 284 RQPYIRVVGLEETNEASSRGAA-AFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDV 342
           R  YIRVVG++   E + R AA A T +E E+F++ A++PD Y+TV   IAPSI+G  D+
Sbjct: 291 RSSYIRVVGIQVDTEGTGRSAAGAITPQEEEEFRRLAAKPDIYETVAKSIAPSIYGSSDI 350

Query: 343 KKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGS 402
           KKA++CLLFGGSRK LPDG+  RGDVN+L+LGDP TAKSQ LKFVE+ +PI VYTSGKGS
Sbjct: 351 KKAIACLLFGGSRKRLPDGLTRRGDVNLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGS 410

Query: 403 SAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISI 462
           SAAGLTASV+RD  SR F +EGGAMVLADGGVVCIDEFDKMR +DRVAIHEAMEQQTISI
Sbjct: 411 SAAGLTASVMRDPVSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISI 470

Query: 463 AKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQ 522
           AKAGITT LNSR SVLAAAN   GR+DD K  ++NID   TILSRFD+IFIVKD     +
Sbjct: 471 AKAGITTTLNSRCSVLAAANSVYGRWDDTK-GEENIDFMPTILSRFDMIFIVKDEHNEQR 529

Query: 523 DKLIASHIIKIHASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQ 582
           D  +A H++ +H SA   S+  +   + N LK+YI YCR +C PRLS  A+ KL+++Y+ 
Sbjct: 530 DMTLAKHVMNVHLSARTQSSSVEGEVDLNTLKKYIAYCRAKCGPRLSAEAAEKLKNRYIL 589

Query: 583 IRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVST 642
           +R   R    ET + + IPITVRQLEAIVR+SE+L KMKL   ATE +V EA+RLF VST
Sbjct: 590 MRSGAREHERETEKRSSIPITVRQLEAIVRISESLGKMKLQPFATETDVEEALRLFQVST 649

Query: 643 MDAARSGINQQVN--LTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESII 700
           +DAA SG    V    T E    + + E Q+K+R  IG+Q+SE  +I D  +    E  I
Sbjct: 650 LDAAMSGSLSGVEGFTTQEDQEMLSRIEKQMKKRFAIGSQVSEHSIIQDFLKQKYPEHAI 709

Query: 701 RRALIIMHQRDEVEYKRERRVILR 724
            + L +M +R E++++ +R+V+ R
Sbjct: 710 HKVLSLMMRRGEIQHRLQRKVLYR 733
Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Xenopus laevis (taxid: 8355)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xenopus tropicalis GN=mcm5 PE=2 SV=1 Back     alignment and function description
>sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens GN=MCM5 PE=1 SV=5 Back     alignment and function description
>sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS=Xenopus laevis GN=mcm5-b PE=2 SV=1 Back     alignment and function description
>sp|Q0V8B7|MCM5_BOVIN DNA replication licensing factor MCM5 OS=Bos taurus GN=MCM5 PE=2 SV=1 Back     alignment and function description
>sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mus musculus GN=Mcm5 PE=2 SV=1 Back     alignment and function description
>sp|Q9VGW6|MCM5_DROME DNA replication licensing factor Mcm5 OS=Drosophila melanogaster GN=Mcm5 PE=1 SV=1 Back     alignment and function description
>sp|P41389|MCM5_SCHPO DNA replication licensing factor mcm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm5 PE=1 SV=2 Back     alignment and function description
>sp|Q21902|MCM5_CAEEL DNA replication licensing factor mcm-5 OS=Caenorhabditis elegans GN=mcm-5 PE=3 SV=1 Back     alignment and function description
>sp|Q54CP4|MCM5_DICDI DNA replication licensing factor mcm5 OS=Dictyostelium discoideum GN=mcm5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query726
225462994732 PREDICTED: DNA replication licensing fac 0.998 0.990 0.842 0.0
296084590732 unnamed protein product [Vitis vinifera] 0.998 0.990 0.839 0.0
449443007735 PREDICTED: DNA replication licensing fac 0.998 0.986 0.825 0.0
224088238726 predicted protein [Populus trichocarpa] 0.993 0.993 0.826 0.0
356562886732 PREDICTED: DNA replication licensing fac 0.998 0.990 0.808 0.0
356548459732 PREDICTED: DNA replication licensing fac 0.998 0.990 0.807 0.0
225639908732 minichromosome maintenance 5 protein [Pi 0.997 0.989 0.808 0.0
255565077723 DNA replication licensing factor MCM5, p 0.988 0.993 0.801 0.0
15226146727 minichromosome maintenance protein 5 (ce 0.993 0.991 0.787 0.0
297835904727 minichromosome maintenance family protei 0.993 0.991 0.787 0.0
>gi|225462994|ref|XP_002263791.1| PREDICTED: DNA replication licensing factor mcm5-A-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1281 bits (3315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/731 (84%), Positives = 667/731 (91%), Gaps = 6/731 (0%)

Query: 1   MSGWDEGAVYYSDQAQFPDDAVGAT-ADANHRRHTTLIKFKEFIRNFERDKNVFPYRESL 59
           MSGWDEGAVYYSDQAQFP    GA   +    RH+ L KFKEFIR FE DKNVFPYRESL
Sbjct: 1   MSGWDEGAVYYSDQAQFPRGGAGAGDPETTATRHSALRKFKEFIRGFESDKNVFPYRESL 60

Query: 60  IENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNE-----E 114
           + NP +L V +EDL AFDADLP+ LRSSPAD+LPLFETAAAEVL SLK KV  E     E
Sbjct: 61  VHNPTYLRVDMEDLHAFDADLPAKLRSSPADYLPLFETAAAEVLVSLKSKVAGETGELEE 120

Query: 115 PKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKST 174
           P T EVQILLTSKEDS+SMRS+GAQFISKLVKI+GITIAASR KAKATYV L CKNCK+ 
Sbjct: 121 PMTGEVQILLTSKEDSVSMRSLGAQFISKLVKIAGITIAASRTKAKATYVTLLCKNCKNV 180

Query: 175 LDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPT 234
             VPCRPGLGGAIVPRSC HIPQ GEEPCPIDPWI+VPDKS+YVDQQTLKLQENPEDVPT
Sbjct: 181 KIVPCRPGLGGAIVPRSCDHIPQPGEEPCPIDPWIVVPDKSKYVDQQTLKLQENPEDVPT 240

Query: 235 GELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLE 294
           GELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSI+Q+ANS  SHKGAVAVRQPYIRVVG+E
Sbjct: 241 GELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIYQAANSSTSHKGAVAVRQPYIRVVGIE 300

Query: 295 ETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGS 354
           E NEA+SRG AAFT E++E+FKKFAS+ DAYK +CSKIAPSI+GHDDVKKAV+CLLFGGS
Sbjct: 301 EANEANSRGPAAFTSEDMEEFKKFASEADAYKRICSKIAPSIYGHDDVKKAVACLLFGGS 360

Query: 355 RKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRD 414
           RKNLPDGVKLRGD+NVLLLGDPSTAKSQFLKFVEKTAP+AVYTSGKGSSAAGLTASVIRD
Sbjct: 361 RKNLPDGVKLRGDINVLLLGDPSTAKSQFLKFVEKTAPVAVYTSGKGSSAAGLTASVIRD 420

Query: 415 GSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSR 474
            S+REFYLEGGAMVLADGGVVCIDEFDKMR EDRVAIHEAMEQQTISIAKAGITTVLNSR
Sbjct: 421 NSTREFYLEGGAMVLADGGVVCIDEFDKMRAEDRVAIHEAMEQQTISIAKAGITTVLNSR 480

Query: 475 TSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIH 534
           TSVLAAANPPSGRYDDLK+AQDNIDLQTTILSRFDLIFIVKDIRMY+QDK+IASHIIK+H
Sbjct: 481 TSVLAAANPPSGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDIRMYSQDKIIASHIIKVH 540

Query: 535 ASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANET 594
           ASADA S D++ SKEENWLKRYIQYCR ECHPRLS+SAS  L++ YV+IR+DMR+QANET
Sbjct: 541 ASADATSGDTRTSKEENWLKRYIQYCRTECHPRLSDSASTMLQNNYVKIRQDMRQQANET 600

Query: 595 GEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQV 654
           GEAA IPITVRQLEAIVRLSEALAKM+LSHVATE  V EA+RLF VSTMDAARSGIN+ +
Sbjct: 601 GEAAAIPITVRQLEAIVRLSEALAKMRLSHVATEENVLEAIRLFNVSTMDAARSGINEHM 660

Query: 655 NLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVE 714
           NLTAEMA+EIKQAETQIKRR+ IG+ ISERRLIDD+TRMGMNESI+RRAL+IMHQRDEVE
Sbjct: 661 NLTAEMANEIKQAETQIKRRMGIGSHISERRLIDDMTRMGMNESIVRRALLIMHQRDEVE 720

Query: 715 YKRERRVILRK 725
           YKRERR+I+RK
Sbjct: 721 YKRERRIIVRK 731

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296084590|emb|CBI25611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443007|ref|XP_004139272.1| PREDICTED: DNA replication licensing factor mcm5-A-like [Cucumis sativus] gi|449493665|ref|XP_004159401.1| PREDICTED: DNA replication licensing factor mcm5-A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224088238|ref|XP_002308385.1| predicted protein [Populus trichocarpa] gi|222854361|gb|EEE91908.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356562886|ref|XP_003549699.1| PREDICTED: DNA replication licensing factor mcm5-A-like [Glycine max] Back     alignment and taxonomy information
>gi|356548459|ref|XP_003542619.1| PREDICTED: DNA replication licensing factor mcm5-A-like [Glycine max] Back     alignment and taxonomy information
>gi|225639908|gb|ACD87452.2| minichromosome maintenance 5 protein [Pisum sativum] Back     alignment and taxonomy information
>gi|255565077|ref|XP_002523531.1| DNA replication licensing factor MCM5, putative [Ricinus communis] gi|223537238|gb|EEF38870.1| DNA replication licensing factor MCM5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15226146|ref|NP_178812.1| minichromosome maintenance protein 5 (cell division control protein 46) [Arabidopsis thaliana] gi|3327389|gb|AAC26671.1| putative DNA replication licensing factor, mcm5 [Arabidopsis thaliana] gi|330251034|gb|AEC06128.1| minichromosome maintenance protein 5 (cell division control protein 46) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835904|ref|XP_002885834.1| minichromosome maintenance family protein [Arabidopsis lyrata subsp. lyrata] gi|297331674|gb|EFH62093.1| minichromosome maintenance family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query726
TAIR|locus:2054698727 MCM5 "MINICHROMOSOME MAINTENAN 0.993 0.991 0.769 4.8e-300
UNIPROTKB|P55862735 mcm5-a "DNA replication licens 0.990 0.978 0.497 7.5e-176
UNIPROTKB|Q561P5735 mcm5 "DNA replication licensin 0.990 0.978 0.494 2.5e-175
UNIPROTKB|P33992734 MCM5 "DNA replication licensin 0.987 0.976 0.495 2.9e-174
UNIPROTKB|Q6PCI7735 mcm5-b "DNA replication licens 0.990 0.978 0.490 1.6e-173
UNIPROTKB|Q5ZKL0734 MCM5 "Uncharacterized protein" 0.987 0.976 0.491 6.9e-173
UNIPROTKB|Q0V8B7734 MCM5 "DNA replication licensin 0.988 0.978 0.490 1.8e-172
UNIPROTKB|A6H7F8734 MCM5 "Minichromosome maintenan 0.988 0.978 0.490 2.4e-172
ZFIN|ZDB-GENE-021209-1736 mcm5 "MCM5 minichromosome main 0.990 0.976 0.481 1.7e-169
ASPGD|ASPL0000012760724 AN7994 [Emericella nidulans (t 0.943 0.946 0.490 2.8e-169
TAIR|locus:2054698 MCM5 "MINICHROMOSOME MAINTENANCE 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2880 (1018.9 bits), Expect = 4.8e-300, P = 4.8e-300
 Identities = 562/730 (76%), Positives = 634/730 (86%)

Query:     1 MSGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLI 60
             MSGWDEGAVYYSDQ QFP+    AT       H  L KFKEFIRNFE ++N FPYRE+L+
Sbjct:     1 MSGWDEGAVYYSDQPQFPEAGDAATISP----HAVLTKFKEFIRNFEIEQNCFPYREALL 56

Query:    61 ENPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNE-----EP 115
             +NPK L+VHLEDLL+FD+DLPSL+RS+PAD+LP+FE AA EVL  LKM+  NE     EP
Sbjct:    57 DNPKRLVVHLEDLLSFDSDLPSLIRSAPADYLPVFEKAAGEVLTGLKMREANEGGVMEEP 116

Query:   116 KTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTL 175
              T +VQILLTS+ED +SMR +GAQ+ISKLVKISGI+IAASRVKAKATYV L CKNCK T 
Sbjct:   117 LTRDVQILLTSREDPVSMRLLGAQYISKLVKISGISIAASRVKAKATYVFLVCKNCKKTR 176

Query:   176 DVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTG 235
             +VPCRPGLGGAIVPRSC +IPQ GEEPCP+DPW++VPD+SQYVDQQTLKLQENPEDVPTG
Sbjct:   177 EVPCRPGLGGAIVPRSCDNIPQPGEEPCPLDPWMVVPDRSQYVDQQTLKLQENPEDVPTG 236

Query:   236 ELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEE 295
             ELPRNMLLSVDRHLVQTIVPGTRLT+MGIYSIFQ+++S  SHKGAVA+RQPYIRVVGLE+
Sbjct:   237 ELPRNMLLSVDRHLVQTIVPGTRLTVMGIYSIFQASSSSNSHKGAVAIRQPYIRVVGLED 296

Query:   296 TNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSR 355
             TNEASSRG A FT +E E+FKKFA   D YK +C+KIAPSIFGH+DVK+A +CLLFGGSR
Sbjct:   297 TNEASSRGPANFTPDEEEEFKKFADSQDVYKNICTKIAPSIFGHEDVKRAAACLLFGGSR 356

Query:   356 KNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDG 415
             K+LPDGVKLRGD+NVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRD 
Sbjct:   357 KSLPDGVKLRGDINVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDS 416

Query:   416 SSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRT 475
             S+REFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRT
Sbjct:   417 STREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRT 476

Query:   476 SVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLXXXXXXXXXX 535
             SVLAAANPPSGRYDDLK+AQDNIDLQTTILSRFDLIFIVKDIR Y+QDK           
Sbjct:   477 SVLAAANPPSGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDIRKYSQDKEIASHIIRVHA 536

Query:   536 XXXXXXXXXXXXXEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETG 595
                          E+NWLKRYIQYCR  CHPRLS+ A+  L+ +YV IR DM+R+A+ETG
Sbjct:   537 SANKFSDENTDSKEDNWLKRYIQYCRARCHPRLSKDAAENLQRKYVTIRMDMKRRAHETG 596

Query:   596 EAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMDAARSGINQQVN 655
             EAAPIPITVRQLEAIVRLSE+LAKM+LSH AT ++V++A +LF  STMDAARSGINQQ+N
Sbjct:   597 EAAPIPITVRQLEAIVRLSESLAKMRLSHEATPDDVDKAFKLFDTSTMDAARSGINQQIN 656

Query:   656 LTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQRDEVEY 715
             +T EMA+EIKQAETQIKRR+ IG ++SERRLI+DL RMGMN+S++RRAL+IMHQR EVEY
Sbjct:   657 ITGEMANEIKQAETQIKRRMGIGARLSERRLIEDLARMGMNDSMVRRALLIMHQRGEVEY 716

Query:   716 KRERRVILRK 725
             +RERR I+RK
Sbjct:   717 QRERRSIVRK 726
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006260 "DNA replication" evidence=IEA;RCA
GO:0006270 "DNA replication initiation" evidence=IEA;ISS;RCA
GO:0008094 "DNA-dependent ATPase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0006268 "DNA unwinding involved in replication" evidence=TAS
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
UNIPROTKB|P55862 mcm5-a "DNA replication licensing factor mcm5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q561P5 mcm5 "DNA replication licensing factor mcm5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|P33992 MCM5 "DNA replication licensing factor MCM5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PCI7 mcm5-b "DNA replication licensing factor mcm5-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKL0 MCM5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8B7 MCM5 "DNA replication licensing factor MCM5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7F8 MCM5 "Minichromosome maintenance complex component 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021209-1 mcm5 "MCM5 minichromosome maintenance deficient 5 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000012760 AN7994 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33992MCM5_HUMAN3, ., 6, ., 4, ., 1, 20.50470.98200.9713yesno
P29496MCM5_YEAST3, ., 6, ., 4, ., 1, 20.47700.94760.8877yesno
P41389MCM5_SCHPO3, ., 6, ., 4, ., 1, 20.48150.97100.9791yesno
P49718MCM5_MOUSE3, ., 6, ., 4, ., 1, 20.48580.98340.9740yesno
Q0V8B7MCM5_BOVIN3, ., 6, ., 4, ., 1, 20.50.98340.9727yesno
Q21902MCM5_CAEEL3, ., 6, ., 4, ., 1, 20.46250.99170.9486yesno
Q561P5MCM5_XENTR3, ., 6, ., 4, ., 1, 20.50400.98760.9755yesno
P55862MCM5A_XENLA3, ., 6, ., 4, ., 1, 20.50530.98200.9700N/Ano
Q9VGW6MCM5_DROME3, ., 6, ., 4, ., 1, 20.48650.97930.9699yesno
Q9UXG1MCM_SULSO3, ., 6, ., 4, ., 1, 20.36270.87740.9285yesno
Q54CP4MCM5_DICDI3, ., 6, ., 4, ., 1, 20.44730.98070.9405yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query726
smart00350509 smart00350, MCM, minichromosome maintenance protei 0.0
COG1241682 COG1241, MCM2, Predicted ATPase involved in replic 0.0
pfam00493327 pfam00493, MCM, MCM2/3/5 family 1e-175
PTZ00111915 PTZ00111, PTZ00111, DNA replication licensing fact 6e-87
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-07
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 1e-04
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information 
 Score =  631 bits (1629), Expect = 0.0
 Identities = 242/521 (46%), Positives = 326/521 (62%), Gaps = 24/521 (4%)

Query: 132 SMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAI---V 188
           S+R + A  + KLV+ISGI    S V+ K      +C+ C +TL    + G         
Sbjct: 4   SIRELRADHLGKLVRISGIVTRTSGVRPKLKRASFTCEKCGATLGPEIQSGRETEPTVCP 63

Query: 189 PRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRH 248
           PR C   P          P+ +  ++S ++D Q +KLQE+PE+VP G+LPR++ + +D  
Sbjct: 64  PREC-QSPT---------PFSLNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGD 113

Query: 249 LVQTIVPGTRLTIMGIYSI--FQSANSPAS--HKGAVAVRQPYIRVVGLEETNEASSRGA 304
           LV    PG R+ + GIY    +    +        A  +   ++R +  + + E SS   
Sbjct: 114 LVDKAKPGDRVEVTGIYRNVPYGFKLNTVKGLPVFATYIEANHVRKLDYKRSFEDSSFSV 173

Query: 305 AAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKL 364
            + + EE E+ +K +  PD Y+ +   +APSI+GH+D+KKA+  LLFGG  KNLPDG+K+
Sbjct: 174 QSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKI 233

Query: 365 RGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEG 424
           RGD+N+LL GDP TAKSQ LK+VEKTAP AVYT+GKGSSA GLTA+V RD  +REF LE 
Sbjct: 234 RGDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEA 293

Query: 425 GAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPP 484
           GA+VLAD GV CIDEFDKM   DR AIHEAMEQQTISIAKAGITT LN+R SVLAAANP 
Sbjct: 294 GALVLADNGVCCIDEFDKMDDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPI 353

Query: 485 SGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVSADS 544
            GRYD   + ++NIDL   ILSRFDL+F+V D     +D+ +A H++ +H        D 
Sbjct: 354 GGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVVDLH-RYSHPEEDE 412

Query: 545 KVSKE--ENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPI 602
                  +  L++YI Y R +  P+LSE A+ KL   YV    D+R++ ++T   + IPI
Sbjct: 413 AFEPPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYV----DLRKEDSQTESRSSIPI 468

Query: 603 TVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTM 643
           TVRQLE+I+RLSEA AKM+LS V  E +V EA+RL   S +
Sbjct: 469 TVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLLRESII 509

Length = 509
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 726
KOG0481729 consensus DNA replication licensing factor, MCM5 c 100.0
COG1241682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0480764 consensus DNA replication licensing factor, MCM6 c 100.0
PTZ00111915 DNA replication licensing factor MCM4; Provisional 100.0
KOG0482721 consensus DNA replication licensing factor, MCM7 c 100.0
KOG0478804 consensus DNA replication licensing factor, MCM4 c 100.0
KOG0477854 consensus DNA replication licensing factor, MCM2 c 100.0
KOG0479818 consensus DNA replication licensing factor, MCM3 c 100.0
smart00350509 MCM minichromosome maintenance proteins. 100.0
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 100.0
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.96
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.96
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.95
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.95
PRK09862506 putative ATP-dependent protease; Provisional 99.95
COG2204464 AtoC Response regulator containing CheY-like recei 99.95
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.94
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.93
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.93
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.93
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.92
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.92
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.92
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.92
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.88
PRK13531 498 regulatory ATPase RavA; Provisional 99.88
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.88
PRK15424538 propionate catabolism operon regulatory protein Pr 99.87
PRK11608326 pspF phage shock protein operon transcriptional ac 99.87
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.86
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.86
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.86
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.86
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.86
COG1221403 PspF Transcriptional regulators containing an AAA- 99.86
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.85
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.85
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.83
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.83
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.83
PRK15115444 response regulator GlrR; Provisional 99.83
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.83
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.83
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.82
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.82
COG0714329 MoxR-like ATPases [General function prediction onl 99.81
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.81
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.8
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.79
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.78
PF07726131 AAA_3: ATPase family associated with various cellu 99.74
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.72
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.71
PRK13765 637 ATP-dependent protease Lon; Provisional 99.69
CHL00181287 cbbX CbbX; Provisional 99.66
PF14551121 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1 99.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.64
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.62
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.58
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.57
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.56
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.56
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.55
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.55
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.52
PHA02244383 ATPase-like protein 99.52
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.45
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.42
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.41
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.39
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.38
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.38
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.37
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK03992389 proteasome-activating nucleotidase; Provisional 99.36
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.35
PRK13342 413 recombination factor protein RarA; Reviewed 99.34
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.33
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.33
PLN03025319 replication factor C subunit; Provisional 99.33
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.32
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.32
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.32
PRK13341 725 recombination factor protein RarA/unknown domain f 99.32
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.32
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.32
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.31
CHL00195489 ycf46 Ycf46; Provisional 99.31
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.3
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.29
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.29
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.29
KOG2028554 consensus ATPase related to the helicase subunit o 99.28
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.28
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.26
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.25
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.25
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.24
PTZ001121164 origin recognition complex 1 protein; Provisional 99.24
PRK10865857 protein disaggregation chaperone; Provisional 99.24
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.24
PRK12402337 replication factor C small subunit 2; Reviewed 99.24
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK00440319 rfc replication factor C small subunit; Reviewed 99.23
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.23
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.22
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.22
CHL00095821 clpC Clp protease ATP binding subunit 99.2
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.2
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.2
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.2
CHL00176 638 ftsH cell division protein; Validated 99.19
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.18
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.18
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.17
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 99.16
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.16
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.16
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.15
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.14
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.13
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.12
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.12
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.1
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.07
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.07
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.07
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.07
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.06
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.06
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.05
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.05
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.04
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.04
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.03
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.03
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.02
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.02
CHL00206 2281 ycf2 Ycf2; Provisional 99.02
PRK06620214 hypothetical protein; Validated 99.02
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.01
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.01
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.01
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.0
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.99
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.98
PRK08084235 DNA replication initiation factor; Provisional 98.98
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.96
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.95
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.94
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.94
PRK12422445 chromosomal replication initiation protein; Provis 98.94
CHL00095 821 clpC Clp protease ATP binding subunit 98.93
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.92
PRK00149450 dnaA chromosomal replication initiation protein; R 98.92
PF00004132 AAA: ATPase family associated with various cellula 98.92
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.91
PRK06893229 DNA replication initiation factor; Validated 98.91
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.91
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.9
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.9
PHA02544316 44 clamp loader, small subunit; Provisional 98.9
PRK14087450 dnaA chromosomal replication initiation protein; P 98.9
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.9
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.9
PRK09087226 hypothetical protein; Validated 98.89
PRK08727233 hypothetical protein; Validated 98.88
PRK14086617 dnaA chromosomal replication initiation protein; P 98.88
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.87
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.87
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 98.84
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.84
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.84
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.83
PRK04195482 replication factor C large subunit; Provisional 98.82
PRK14088440 dnaA chromosomal replication initiation protein; P 98.79
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.77
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.77
PRK10865 857 protein disaggregation chaperone; Provisional 98.75
PRK05642234 DNA replication initiation factor; Validated 98.73
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.7
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.68
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.67
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.66
PRK07940394 DNA polymerase III subunit delta'; Validated 98.66
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.66
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 98.65
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.64
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.61
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.61
PF13337457 Lon_2: Putative ATP-dependent Lon protease 98.6
PRK04132846 replication factor C small subunit; Provisional 98.56
PRK09112351 DNA polymerase III subunit delta'; Validated 98.56
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.54
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 98.51
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.49
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.47
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 98.45
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.43
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 98.41
COG0593408 DnaA ATPase involved in DNA replication initiation 98.39
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.38
PHA01747425 putative ATP-dependent protease 98.36
PRK15455 644 PrkA family serine protein kinase; Provisional 98.33
smart00382148 AAA ATPases associated with a variety of cellular 98.3
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.26
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 98.19
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.19
PRK07471365 DNA polymerase III subunit delta'; Validated 98.17
PRK06526254 transposase; Provisional 98.16
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.13
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.11
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 98.07
PRK07399314 DNA polymerase III subunit delta'; Validated 98.07
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.06
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.06
KOG2545543 consensus Conserved membrane protein [Function unk 98.04
PRK05564313 DNA polymerase III subunit delta'; Validated 98.02
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 98.02
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.0
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.0
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 97.94
PRK12377248 putative replication protein; Provisional 97.92
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 97.9
PRK08181269 transposase; Validated 97.9
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 97.88
PRK08058329 DNA polymerase III subunit delta'; Validated 97.88
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.81
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.8
PRK09183259 transposase/IS protein; Provisional 97.78
PRK08116268 hypothetical protein; Validated 97.78
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 97.72
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 97.69
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.64
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.64
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.6
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.59
PRK05707328 DNA polymerase III subunit delta'; Validated 97.55
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.54
PRK06835329 DNA replication protein DnaC; Validated 97.5
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 97.49
PRK06921266 hypothetical protein; Provisional 97.47
PRK07952244 DNA replication protein DnaC; Validated 97.47
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 97.44
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.42
PF0549176 RuvB_C: Holliday junction DNA helicase ruvB C-term 97.38
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.34
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 97.27
PRK06871325 DNA polymerase III subunit delta'; Validated 97.26
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.26
KOG0736 953 consensus Peroxisome assembly factor 2 containing 97.19
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.19
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.17
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.16
PF13148378 DUF3987: Protein of unknown function (DUF3987) 97.14
PHA02774613 E1; Provisional 97.06
PRK08939306 primosomal protein DnaI; Reviewed 97.06
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 97.02
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.98
PRK08769319 DNA polymerase III subunit delta'; Validated 96.98
PRK06964342 DNA polymerase III subunit delta'; Validated 96.85
PRK08699325 DNA polymerase III subunit delta'; Validated 96.84
COG4930 683 Predicted ATP-dependent Lon-type protease [Posttra 96.83
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.82
PHA02624647 large T antigen; Provisional 96.77
PF13173128 AAA_14: AAA domain 96.73
PRK07993334 DNA polymerase III subunit delta'; Validated 96.72
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.72
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.71
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.66
PRK06090319 DNA polymerase III subunit delta'; Validated 96.65
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.63
PRK05917290 DNA polymerase III subunit delta'; Validated 96.46
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.37
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.35
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 96.2
PF05729166 NACHT: NACHT domain 96.19
PRK13695174 putative NTPase; Provisional 95.94
PRK10536262 hypothetical protein; Provisional 95.89
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.68
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 95.65
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.6
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.58
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.45
PF01057271 Parvo_NS1: Parvovirus non-structural protein NS1; 95.42
PHA00729226 NTP-binding motif containing protein 95.39
PRK14532188 adenylate kinase; Provisional 95.39
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 95.21
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.2
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.19
PRK13947171 shikimate kinase; Provisional 95.13
PRK08118167 topology modulation protein; Reviewed 95.13
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 95.09
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.05
PRK04296190 thymidine kinase; Provisional 95.04
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.97
PRK14530215 adenylate kinase; Provisional 94.96
PRK00131175 aroK shikimate kinase; Reviewed 94.96
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.93
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.92
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.92
PRK03839180 putative kinase; Provisional 94.91
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.9
COG4619223 ABC-type uncharacterized transport system, ATPase 94.85
COG2766649 PrkA Putative Ser protein kinase [Signal transduct 94.84
PRK07261171 topology modulation protein; Provisional 94.79
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.78
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.78
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 94.76
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 94.69
PRK00625173 shikimate kinase; Provisional 94.68
PRK14709469 hypothetical protein; Provisional 94.65
PRK07132299 DNA polymerase III subunit delta'; Validated 94.63
PF1324576 AAA_19: Part of AAA domain 94.6
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.59
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.59
PTZ00088229 adenylate kinase 1; Provisional 94.52
PRK13949169 shikimate kinase; Provisional 94.5
PRK13826 1102 Dtr system oriT relaxase; Provisional 94.5
PRK13889 988 conjugal transfer relaxase TraA; Provisional 94.49
PRK10875615 recD exonuclease V subunit alpha; Provisional 94.48
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 94.39
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 94.36
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.36
PRK14531183 adenylate kinase; Provisional 94.36
PRK06762166 hypothetical protein; Provisional 94.34
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.26
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 94.24
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.22
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.19
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.17
PRK06217183 hypothetical protein; Validated 94.08
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 94.05
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.05
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.04
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 94.04
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.91
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.9
PRK05057172 aroK shikimate kinase I; Reviewed 93.9
PRK14526211 adenylate kinase; Provisional 93.86
PF1355562 AAA_29: P-loop containing region of AAA domain 93.83
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 93.83
PRK14528186 adenylate kinase; Provisional 93.78
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.66
PRK14700300 recombination factor protein RarA; Provisional 93.6
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.58
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.54
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.54
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 93.5
PLN02200234 adenylate kinase family protein 93.49
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.44
PTZ00301210 uridine kinase; Provisional 93.43
PRK02496184 adk adenylate kinase; Provisional 93.38
COG1936180 Predicted nucleotide kinase (related to CMP and AM 93.37
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.34
PRK13946184 shikimate kinase; Provisional 93.33
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.3
PRK08233182 hypothetical protein; Provisional 93.27
PRK00279215 adk adenylate kinase; Reviewed 93.26
PRK13851344 type IV secretion system protein VirB11; Provision 93.26
PRK05439311 pantothenate kinase; Provisional 93.21
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.19
PRK06547172 hypothetical protein; Provisional 93.17
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 93.16
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.07
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 92.96
PLN02459261 probable adenylate kinase 92.91
PRK03731171 aroL shikimate kinase II; Reviewed 92.85
COG3378517 Phage associated DNA primase [General function pre 92.84
PRK13948182 shikimate kinase; Provisional 92.83
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 92.83
PHA02530300 pseT polynucleotide kinase; Provisional 92.82
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 92.8
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 92.74
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.74
PRK14527191 adenylate kinase; Provisional 92.72
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.7
PLN02674244 adenylate kinase 92.7
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.69
PRK14529223 adenylate kinase; Provisional 92.64
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 92.61
PRK00300205 gmk guanylate kinase; Provisional 92.56
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.53
PRK07276290 DNA polymerase III subunit delta'; Validated 92.46
PRK04040188 adenylate kinase; Provisional 92.41
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 92.39
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.33
PRK06851367 hypothetical protein; Provisional 92.19
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.07
PRK12339197 2-phosphoglycerate kinase; Provisional 92.02
PRK03846198 adenylylsulfate kinase; Provisional 92.01
PRK05541176 adenylylsulfate kinase; Provisional 91.99
PRK05480209 uridine/cytidine kinase; Provisional 91.93
COG4178604 ABC-type uncharacterized transport system, permeas 91.91
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 91.91
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.88
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 91.83
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 91.79
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 91.79
PRK01184184 hypothetical protein; Provisional 91.78
COG4088261 Predicted nucleotide kinase [Nucleotide transport 91.76
TIGR01043578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 91.74
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 91.74
COG1485367 Predicted ATPase [General function prediction only 91.68
KOG2228408 consensus Origin recognition complex, subunit 4 [R 91.65
COG1117253 PstB ABC-type phosphate transport system, ATPase c 91.62
PF00005137 ABC_tran: ABC transporter This structure is on hol 91.6
PF13479213 AAA_24: AAA domain 91.59
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.56
PRK09825176 idnK D-gluconate kinase; Provisional 91.55
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.5
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.5
PRK13833323 conjugal transfer protein TrbB; Provisional 91.49
PRK04182180 cytidylate kinase; Provisional 91.49
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 91.48
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 91.31
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 91.29
PLN02165334 adenylate isopentenyltransferase 91.28
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 91.27
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.26
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 91.22
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 91.21
COG3842352 PotA ABC-type spermidine/putrescine transport syst 91.2
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 91.12
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.07
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.07
PRK05818261 DNA polymerase III subunit delta'; Validated 91.04
cd03269210 ABC_putative_ATPase This subfamily is involved in 91.03
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 91.01
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 90.95
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 90.89
PRK13894319 conjugal transfer ATPase TrbB; Provisional 90.87
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.84
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 90.8
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 90.79
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 90.78
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 90.75
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 90.72
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 90.71
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 90.69
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 90.68
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 90.67
PRK08356195 hypothetical protein; Provisional 90.65
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 90.64
PRK00889175 adenylylsulfate kinase; Provisional 90.62
COG4525259 TauB ABC-type taurine transport system, ATPase com 90.56
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 90.52
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 90.48
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 90.43
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 90.42
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 90.42
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.41
PRK14737186 gmk guanylate kinase; Provisional 90.38
PRK14738206 gmk guanylate kinase; Provisional 90.33
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 90.31
PRK08154309 anaerobic benzoate catabolism transcriptional regu 90.31
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 90.29
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 90.28
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 90.27
PRK04220301 2-phosphoglycerate kinase; Provisional 90.26
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 90.24
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 90.23
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 90.23
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 90.23
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 90.22
cd03246173 ABCC_Protease_Secretion This family represents the 90.21
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 90.2
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.2
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 90.19
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 90.19
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 90.17
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 90.17
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 90.15
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 90.14
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 90.14
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 90.12
PRK12338319 hypothetical protein; Provisional 90.11
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.09
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 90.09
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 90.02
PRK13808333 adenylate kinase; Provisional 90.02
TIGR00231161 small_GTP small GTP-binding protein domain. This m 90.01
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 89.99
cd01878204 HflX HflX subfamily. A distinct conserved domain w 89.98
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 89.96
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 89.95
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 89.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 89.88
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 89.87
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 89.87
cd03215182 ABC_Carb_Monos_II This family represents domain II 89.87
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 89.86
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 89.79
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=9.3e-135  Score=1051.56  Aligned_cols=717  Identities=58%  Similarity=0.883  Sum_probs=657.6

Q ss_pred             CCCCCCceeeecCCCCCCCccCCCcCCcccHHHHHHHHHHHHhccccCCCcchhHHHHhcC----CCEEEEecchhhccC
Q 004862            2 SGWDEGAVYYSDQAQFPDDAVGATADANHRRHTTLIKFKEFIRNFERDKNVFPYRESLIEN----PKFLLVHLEDLLAFD   77 (726)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~Fl~~f~~~~~~~~Y~~~l~~~----~~~l~Vd~~dL~~f~   77 (726)
                      +|||+|+|||++. + ++++...    .-+.++++..|++|++.|+. ...|+|+++|++|    ..+++|+++||.+||
T Consensus         1 ~~~D~~~i~~~d~-f-~~d~~~d----~~~~~~v~~~fkefir~f~~-~~~f~Yrd~L~~N~~~~~y~L~v~le~L~~fd   73 (729)
T KOG0481|consen    1 SGFDEPGIYYSDS-F-GGDGQAD----TGRKSQVKTKFKEFIRQFRT-GTDFKYRDQLKRNYNLGEYSLEVELEDLISFD   73 (729)
T ss_pred             CCCCCCceEeecc-c-CCCCccc----cccHHHHHHHHHHHHHHhcc-ccccchHHHHHhcccccceEEEEEHHHhhccc
Confidence            6999999999973 2 2222222    12688999999999999984 4558999999988    457999999999999


Q ss_pred             chHHHHHHhCHHHHHHHHHHHHHHHHHHhccccCCCCCCcceEEEEecCCCCcccccccCccCCCcEEEEEeEEEEeecc
Q 004862           78 ADLPSLLRSSPADFLPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRV  157 (726)
Q Consensus        78 ~~La~~l~~~P~~~l~~~~~a~~e~~~~~~~~~~~~~~~~~~i~v~~~~~~~~~~ir~l~s~~igkLV~v~GiV~~~s~v  157 (726)
                      .+|++.|..+|.++||+|++|+.++..++..+....+....+|+|.+.....+.++|+|+++++.|||.|.|||+.+|.+
T Consensus        74 edl~~~L~~~P~~~lp~fEeAa~~Vad~i~~~~~~~E~~~~d~Qv~L~sda~p~~iR~l~s~~vsklVki~GIiiaAS~v  153 (729)
T KOG0481|consen   74 EDLADKLSKQPADHLPLFEEAAKEVADEITRPRPSGEEVLHDIQVLLTSDANPISIRQLKSDHVSKLVKISGIIIAASAV  153 (729)
T ss_pred             hHHHHHHHhChHhHHHHHHHHHHHHHhhhcCCCcCCCccceeeEEEEecCCCcccHhHhhhHhhhhheeeccEEEEeeee
Confidence            99999999999999999999999999988765544445667899999999999999999999999999999999999999


Q ss_pred             eeeEEEEEEEecCCCCeE-EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCeEEecCCCceeeeeEEEeecCCCCCCCCC
Q 004862          158 KAKATYVHLSCKNCKSTL-DVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGE  236 (726)
Q Consensus       158 ~~~~~~~~~~C~~C~~~~-~~~~~~~~~~~~~P~~C~~~~~~g~~~C~~~~~~~~~~~s~~~d~Q~I~iQE~~e~~~~g~  236 (726)
                      +.+.+....+|..|.++. .+...++++.+..|..|.+.. .|+.+|+.+||.+.+++|+|+|+|.+||||.|+++|.|+
T Consensus       154 ~~kat~l~l~CrnC~~t~~~~~~~pgl~g~~lPR~C~~~~-~~k~~Cp~DPyii~pdks~~vD~QtLKLQE~pe~VP~GE  232 (729)
T KOG0481|consen  154 SAKATRLSLVCRNCRHTRPNVIMRPGLEGYALPRKCDTPQ-AGKPKCPLDPYIIMPDKSKCVDQQTLKLQELPEDVPVGE  232 (729)
T ss_pred             eecceEEEEEeccccccccceecCCCccccccccccCCcc-cCCCCCCCCCEEEcccccceeehhheehhhCcccCCcCc
Confidence            999999999999999887 455667888899999998654 556779999999999999999999999999999999999


Q ss_pred             CceEEEEEEecCccccccCCcEEEEEEEEEeeeCCCCCCCCCcceeEeeeEEEEEeeeeeccccc-cCCCCCCHHHHHHH
Q 004862          237 LPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASS-RGAAAFTQEEIEKF  315 (726)
Q Consensus       237 ~Pr~i~v~l~~dLv~~~~pGd~V~V~GIl~~~~~~~~~~~~~~~~~~~~~~i~~~~i~~~~~~~~-~~~~~~~~~~~~~~  315 (726)
                      +||++.++++++|++++.||.+|+|+|||.+.+......+.++..++...||+++||+...+... .....||++|.+.|
T Consensus       233 ~PRhl~L~~dRyL~~kvvPG~RvtI~GIYsI~~~~~~~~s~k~~v~iR~PyirVvGi~~ds~~ss~~~~~~ft~eEEEeF  312 (729)
T KOG0481|consen  233 MPRHLQLFCDRYLTNKVVPGNRVTIMGIYSIKKFGSTSSSDKSGVGIRTPYIRVVGIQDDSEGSSRSSATMFTPEEEEEF  312 (729)
T ss_pred             CcchhhhhhhHHHhccccCCceEEEEEEEEeeeccccCCCCccceeeecceEEEEEEEeccCCccccCcccCChhHHHHH
Confidence            99999999999999999999999999999998654433334456789999999999997765422 23457999999999


Q ss_pred             HHHhcCcchHHHHHHhhcCCccCchhHHHHHHHHHhCCCcccCCCCccccCcceEEEECCCchhHHHHHHHHHHhCCCcE
Q 004862          316 KKFASQPDAYKTVCSKIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAV  395 (726)
Q Consensus       316 ~~~~~~~~~~~~l~~si~p~I~G~~~~k~aill~L~~~~~~~~~~g~~~r~~~~vLL~G~pGtGKt~la~~i~~~~~~~~  395 (726)
                      ++++..|++|+.|.+||+|+|||++++|+|+.|.||||+.|.++||...|||+||||.|+|||+||+|++++.+.+|-++
T Consensus       313 k~la~~~d~Ye~is~sIAPSIfG~~DiKkAiaClLFgGsrK~LpDg~~lRGDINVLLLGDPgtAKSQlLKFvEkvsPIaV  392 (729)
T KOG0481|consen  313 KKLAASPDVYERISKSIAPSIFGHEDIKKAIACLLFGGSRKRLPDGVTLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAV  392 (729)
T ss_pred             HHHhcCccHHHHHhhccCchhcCchhHHHHHHHHhhcCccccCCCcceeccceeEEEecCCchhHHHHHHHHHhcCceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCCCcccccceeeecCCCchhhhccCceeecCCCeEEecccCcCCHHHHHHHHHHHhcceEeeeccceEEEeeCce
Q 004862          396 YTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRT  475 (726)
Q Consensus       396 ~~~g~~~~~~gl~~~~~~~~~~~~~~~~~G~l~la~~gvl~iDEi~~~~~~~~~~L~~~me~~~i~i~~~g~~~~l~~~~  475 (726)
                      |++|+|++++|||+++.+|+.+.+|.+++||+++|||||+||||||+|.++++.++||+||||+|+|+|+|++++||+||
T Consensus       393 YTSGKGSSAAGLTASV~RD~~tReFylEGGAMVLADgGVvCIDEFDKMre~DRVAIHEAMEQQTISIAKAGITT~LNSRt  472 (729)
T KOG0481|consen  393 YTSGKGSSAAGLTASVIRDPSTREFYLEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRT  472 (729)
T ss_pred             EecCCCcccccceeeEEecCCcceEEEecceEEEecCCEEEeehhhccCchhhhHHHHHHHhhhHHHhhhcceeeecchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCCCCCcCCCccchhhhccCchhhhcccCeeeEeccCCChhhhHHHHHHHHHHhhhccccc----ccccccCCHH
Q 004862          476 SVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVS----ADSKVSKEEN  551 (726)
Q Consensus       476 ~iiaa~Np~~g~~~~~~~~~~~~~l~~~Ll~RFdli~~l~d~~~~~~d~~i~~~il~~~~~~~~~~----~~~~~~~~~~  551 (726)
                      +|+||+||.+||||+.++..+|+.|.+.+|||||++|.+.|..+++.|..||+|++++|....+..    ......++.+
T Consensus       473 SVLAAANpvfGRyDd~Kt~~dNIDf~~TILSRFDmIFIVKD~h~~~~D~~lAkHVI~vH~~~~n~~~~~~~~~~~ei~~~  552 (729)
T KOG0481|consen  473 SVLAAANPVFGRYDDTKTGEDNIDFMPTILSRFDMIFIVKDEHDEERDITLAKHVINVHVSKANAQTDSQEENEGEIPIE  552 (729)
T ss_pred             hhhhhcCCccccccccCCcccccchhhhHhhhccEEEEEeccCcchhhhHHHHHhhhhhccccccccCccccCCCcccHH
Confidence            999999999999999999999999999999999999999999999999999999999998643222    1245679999


Q ss_pred             HHHHHHHHhHccCCCCCCHHHHHHHHHHHHHHHHHHhhhhcccCCCCCccCChhHHHHHHHHHHHHHhhhCCCcccHHHH
Q 004862          552 WLKRYIQYCRLECHPRLSESASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEV  631 (726)
Q Consensus       552 ~L~~yi~~a~~~~~p~ls~ea~~~l~~~y~~~R~~~~~~~~~~~~~~~~~~t~R~L~~lirla~a~A~l~~~~~V~~~Dv  631 (726)
                      .|++||.|||.+|.|.||++|.+.|.++|+.+|+.......++++..++|+|+||||++||+++++|||+++..++++||
T Consensus       553 ~~KryI~YcR~kc~PrLs~~AaekL~~~yV~~R~~~~q~e~~s~~rssIPITVRQLEAIiRI~ESLAKm~Ls~~ate~hV  632 (729)
T KOG0481|consen  553 KLKRYIQYCRLKCGPRLSAEAAEKLSSRYVTMRKGVRQHEQDSDKRSSIPITVRQLEAIIRIAESLAKMELSPFATEAHV  632 (729)
T ss_pred             HHHHHHHHHHhccCCCCCHHHHHHHHHHHhHHHHHHHHhhhcccccCCCceeHHHHHHHHHHHHHHHhhcCCccccHHHH
Confidence            99999999999999999999999999999999998887777778889999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhhhhhhcCccccc--cccHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHH
Q 004862          632 NEAVRLFTVSTMDAARSGINQQV--NLTAEMAHEIKQAETQIKRRIPIGNQISERRLIDDLTRMGMNESIIRRALIIMHQ  709 (726)
Q Consensus       632 ~~ai~l~~~s~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~l~~l~~  709 (726)
                      ++|++||+.|+++.+.+|.+.+.  ..+++..+.+++++..|+++++.+..+|+..|+++....|+++..+.++|..|.+
T Consensus       633 ~EA~RLF~vSTmdAa~~g~l~g~egf~s~e~~e~i~rie~qlkrr~~IG~~~se~~li~df~~~~y~e~~v~kal~~m~~  712 (729)
T KOG0481|consen  633 EEALRLFQVSTMDAASQGTLAGVEGFTSPEDQEEIKRIEKQLKRRFAIGSQVSEHSLIRDFVRQGYSEHAVKKALQIMLR  712 (729)
T ss_pred             HHHHHHHhHhhHHHHhcCchhcccccCCHHHHHHHHHHHHHHHHhcccccchhHHHHHHHHHhccccHHHHHHHHHHHHh
Confidence            99999999999999998876552  2567889999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEecCCeEEEecC
Q 004862          710 RDEVEYKRERRVILRKV  726 (726)
Q Consensus       710 ~g~i~~~~~g~~~~~~~  726 (726)
                      +|.|+....|+++.|.+
T Consensus       713 rg~iq~r~qrk~lyR~~  729 (729)
T KOG0481|consen  713 RGEIQHRMQRKVLYRSG  729 (729)
T ss_pred             hhHHHHHhcCceEEecC
Confidence            99999999999999975

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF14551 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1LTL_E Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2545 consensus Conserved membrane protein [Function unknown] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05491 RuvB_C: Holliday junction DNA helicase ruvB C-terminus; InterPro: IPR008823 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13148 DUF3987: Protein of unknown function (DUF3987) Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG2766 PrkA Putative Ser protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK14709 hypothetical protein; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG3378 Phage associated DNA primase [General function prediction only] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query726
3f9v_A595 Crystal Structure Of A Near Full-Length Archaeal Mc 1e-102
3f8t_A506 Crystal Structure Analysis Of A Full-Length Mcm Hom 8e-22
2vl6_A268 Structural Analysis Of The Sulfolobus Solfataricus 2e-18
1ltl_A279 The Dodecamer Structure Of Mcm From Archaeal M. The 6e-13
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure 
Iteration: 1

 Score =  369 bits (947), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 232/615 (37%), Positives = 352/615 (57%), Gaps = 39/615 (6%)
Query: 39  FKEFIRNFERDKNVFPYRESLIE----NPKFLLVHLEDLLAFDADLPSLLRSSPADFLPL 94
           F EF+  F+ + N   Y E + E      K L++   D+L+F+ +L   + ++    LP+
Sbjct: 8   FIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPI 67
Query: 95  FETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAA 154
            E A  + +  L      +    E+V + +      + +R I +  I KL+ I GI +  
Sbjct: 68  LEGALYDHILQLDPTYQRD---IEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKV 124
Query: 155 SRVKA---KATYVHLSCKNCKSTLDVPCRPGLGGAI-VPRSCGHIPQAGEEPCPIDPWII 210
           + VK    KATY H+   +C    + P    +   + +P  C    + G+       + +
Sbjct: 125 TPVKERIYKATYKHIH-PDCMQEFEWPEDEEMPEVLEMPTICPKCGKPGQ-------FRL 176
Query: 211 VPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQS 270
           +P+K++ +D Q   +QE PE+VP+G+LPR + + ++  LV +  PG R+ + GI  I Q 
Sbjct: 177 IPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQ- 235
Query: 271 ANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCS 330
            +SP   +G+ AV   Y++V  +E + +         ++E+ +K K  A  P     + S
Sbjct: 236 -DSPVK-RGSRAVFDIYMKVSSIEVSQKVLDE--VIISEEDEKKIKDLAKDPWIRDRIIS 291
Query: 331 KIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKT 390
            IAPSI+GH ++K+A++  LFGG  K L D  ++RGD+++L++GDP TAKSQ L+F+ + 
Sbjct: 292 SIAPSIYGHWELKEALALALFGGVPKVLED-TRIRGDIHILIIGDPGTAKSQMLQFISRV 350
Query: 391 APIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVA 450
           AP AVYT+GKGS+AAGLTA+V+R+  + E+YLE GA+VLADGG+  IDE DKMR EDRVA
Sbjct: 351 APRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDEDRVA 410
Query: 451 IHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDL 510
           IHEAMEQQT+SIAKAGI   LN+R +V+AA NP  GRY   +   DNI+L  TILSRFDL
Sbjct: 411 IHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYISERPVSDNINLPPTILSRFDL 470
Query: 511 IFIVKDIRMYNQDKLXXXXXXXXXXXXXXXXXXXXXXXEENWLKRYIQYCRLECHPRLSE 570
           IFI+KD +   QD+                        + + L++YI Y R    P+++ 
Sbjct: 471 IFILKD-QPGEQDR-----ELANYILDVHSGKSTKNIIDIDTLRKYIAYARKYVTPKITS 524
Query: 571 SASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENE 630
            A   + D +V+    MR++++ET + +PI IT RQLEA++R+SEA AKM L    T  +
Sbjct: 525 EAKNLITDFFVE----MRKKSSETPD-SPILITPRQLEALIRISEAYAKMALKAEVTRED 579
Query: 631 VNEAV---RLFTVST 642
              A+   RLF  S 
Sbjct: 580 AERAINIMRLFLESV 594
>pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 Back     alignment and structure
>pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 Back     alignment and structure
>pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query726
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 0.0
3f8t_A506 Predicted ATPase involved in replication control, 1e-168
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 7e-71
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 9e-67
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
 Score =  738 bits (1908), Expect = 0.0
 Identities = 222/616 (36%), Positives = 347/616 (56%), Gaps = 34/616 (5%)

Query: 38  KFKEFIRNFERDKNVFPYRESLIE----NPKFLLVHLEDLLAFDADLPSLLRSSPADFLP 93
            F EF+  F+ + N   Y E + E      K L++   D+L+F+ +L   + ++    LP
Sbjct: 7   VFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILP 66

Query: 94  LFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIA 153
           + E A  + +  L       +   E+V + +      + +R I +  I KL+ I GI + 
Sbjct: 67  ILEGALYDHILQLD---PTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVK 123

Query: 154 ASRVKAKATYVHLSCKNCKSTLDVP---CRPGLGGAIVPRSCGHIPQAGEEPCPIDPWII 210
            + VK +         +     +              +P  C    + G        + +
Sbjct: 124 VTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKPG-------QFRL 176

Query: 211 VPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQS 270
           +P+K++ +D Q   +QE PE+VP+G+LPR + + ++  LV +  PG R+ + GI  I Q 
Sbjct: 177 IPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQD 236

Query: 271 ANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCS 330
           +      +G+ AV   Y++V  +E + +         ++E+ +K K  A  P     + S
Sbjct: 237 SPV---KRGSRAVFDIYMKVSSIEVSQK--VLDEVIISEEDEKKIKDLAKDPWIRDRIIS 291

Query: 331 KIAPSIFGHDDVKKAVSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKT 390
            IAPSI+GH ++K+A++  LFGG  K L D  ++RGD+++L++GDP TAKSQ L+F+ + 
Sbjct: 292 SIAPSIYGHWELKEALALALFGGVPKVLEDT-RIRGDIHILIIGDPGTAKSQMLQFISRV 350

Query: 391 APIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGGAMVLADGGVVCIDEFDKMRPEDRVA 450
           AP AVYT+GKGS+AAGLTA+V+R+  + E+YLE GA+VLADGG+  IDE DKMR EDRVA
Sbjct: 351 APRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDEDRVA 410

Query: 451 IHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTILSRFDL 510
           IHEAMEQQT+SIAKAGI   LN+R +V+AA NP  GRY   +   DNI+L  TILSRFDL
Sbjct: 411 IHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYISERPVSDNINLPPTILSRFDL 470

Query: 511 IFIVKDIRMYNQDKLIASHIIKIHASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSE 570
           IFI+KD +   QD+ +A++I+ +H+     +         + L++YI Y R    P+++ 
Sbjct: 471 IFILKD-QPGEQDRELANYILDVHSGKSTKNIIDI-----DTLRKYIAYARKYVTPKITS 524

Query: 571 SASAKLRDQYVQIRKDMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENE 630
            A   + D +V    +MR++++ET + +PI IT RQLEA++R+SEA AKM L    T  +
Sbjct: 525 EAKNLITDFFV----EMRKKSSETPD-SPILITPRQLEALIRISEAYAKMALKAEVTRED 579

Query: 631 VNEAVRLFTVSTMDAA 646
              A+ +  +      
Sbjct: 580 AERAINIMRLFLESVG 595
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query726
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 100.0
3f8t_A506 Predicted ATPase involved in replication control, 100.0
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 100.0
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 100.0
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.93
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.91
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.91
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.9
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.89
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.86
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.84
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.84
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.82
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.81
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.77
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.75
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.75
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.72
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.7
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.64
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.63
3pvs_A 447 Replication-associated recombination protein A; ma 99.62
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.61
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.59
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.56
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.53
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.52
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.51
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.51
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.5
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.5
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.5
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.5
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.49
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.49
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.48
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.48
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.47
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.47
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.47
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.46
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.46
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.45
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.45
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.44
3co5_A143 Putative two-component system transcriptional RES 99.43
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.43
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.42
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.42
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.39
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.38
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.37
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.37
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.37
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.36
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.35
3bos_A242 Putative DNA replication factor; P-loop containing 99.34
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.34
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.34
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.31
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.3
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.3
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.28
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.25
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.24
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.22
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.2
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.18
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.18
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.16
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.14
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.12
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.11
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.1
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.07
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.03
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.03
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.02
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.97
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.97
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.94
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.93
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.89
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.87
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.87
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.84
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.82
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.6
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.58
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.55
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.37
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.26
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.25
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.23
1tue_A212 Replication protein E1; helicase, replication, E1E 98.13
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.94
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.93
2qgz_A308 Helicase loader, putative primosome component; str 97.68
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.56
2fna_A357 Conserved hypothetical protein; structural genomic 97.5
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.46
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.22
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.85
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.04
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.75
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.29
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.02
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 95.0
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.83
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.82
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.55
1via_A175 Shikimate kinase; structural genomics, transferase 94.36
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.24
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.23
2jt1_A77 PEFI protein; solution structure, winged helix-tur 94.19
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.19
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.17
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.1
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 94.07
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.07
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.99
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.97
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.92
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.92
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.9
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.83
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.81
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.78
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.75
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.73
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.69
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.67
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.56
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.55
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.5
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.45
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.37
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.34
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.25
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.2
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.19
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.18
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.14
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.13
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.13
1qbj_A81 Protein (double-stranded RNA specific adenosine D 93.08
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.05
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.03
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.02
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.02
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.85
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.76
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.74
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.7
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.65
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 92.61
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.56
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.49
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.48
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.46
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.43
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.41
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.37
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.35
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 92.23
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.23
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.17
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.15
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.14
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 92.14
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.03
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 91.96
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 91.92
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.9
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.85
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 91.8
4a74_A231 DNA repair and recombination protein RADA; hydrola 91.73
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.67
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.63
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.59
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.54
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.42
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.41
3r20_A233 Cytidylate kinase; structural genomics, seattle st 91.33
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.33
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.27
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.23
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.21
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 91.19
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.19
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.16
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.14
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.11
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.92
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 90.87
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.87
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.86
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 90.85
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 90.8
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.68
3lxx_A239 GTPase IMAP family member 4; structural genomics c 90.64
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 90.54
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.49
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.47
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.45
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 90.37
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.36
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.31
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.3
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 90.25
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.22
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.17
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 90.14
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 90.12
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.08
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 90.07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.03
3t1o_A198 Gliding protein MGLA; G domain containing protein, 89.97
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.95
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 89.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 89.91
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.91
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 89.89
1nrj_B218 SR-beta, signal recognition particle receptor beta 89.75
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 89.75
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 89.73
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.72
3kta_A182 Chromosome segregation protein SMC; structural mai 89.72
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 89.65
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 89.6
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 89.57
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 89.55
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 89.54
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 89.51
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 89.5
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 89.49
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 89.45
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 89.42
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 89.41
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.41
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 89.4
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 89.39
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.39
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.36
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 89.35
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 89.34
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 89.33
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 89.33
1b0u_A262 Histidine permease; ABC transporter, transport pro 89.3
2ged_A193 SR-beta, signal recognition particle receptor beta 89.28
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 89.22
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.22
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 89.22
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 89.21
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 89.19
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 89.18
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.17
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 89.11
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 89.07
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.06
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.06
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 89.05
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 89.02
1g6h_A257 High-affinity branched-chain amino acid transport 89.01
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 89.0
3lxw_A247 GTPase IMAP family member 1; immunity, structural 89.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 88.98
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 88.95
2wji_A165 Ferrous iron transport protein B homolog; membrane 88.84
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 88.83
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 88.83
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 88.79
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 88.76
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 88.75
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.74
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 88.71
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 88.7
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.68
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 88.65
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.6
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.58
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 88.54
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.53
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 88.49
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 88.48
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 88.48
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 88.43
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.42
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 88.4
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 88.39
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 88.36
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 88.31
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 88.29
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 88.28
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 88.27
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.26
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 88.19
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 88.17
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.17
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 88.16
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 88.13
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 88.12
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 88.07
2ghi_A260 Transport protein; multidrug resistance protein, M 87.99
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 87.97
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 87.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.89
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 87.87
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 87.87
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 87.86
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 87.86
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 87.79
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 87.75
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 87.73
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 87.72
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 87.66
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 87.6
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 87.59
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 87.57
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 87.54
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 87.53
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 87.5
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 87.48
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.45
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 87.45
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 87.44
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 87.42
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 87.41
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 87.39
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 87.39
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 87.38
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 87.35
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 87.35
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 87.34
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 87.33
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 87.33
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 87.31
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 87.3
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 87.29
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 87.28
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 87.25
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 87.23
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 87.23
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 87.21
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 87.2
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 87.19
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 87.18
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 87.16
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 87.15
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.14
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 87.14
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.13
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 87.09
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.05
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 86.97
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 86.96
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 86.92
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 86.86
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 86.85
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 86.84
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 86.78
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.76
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 86.76
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 86.75
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.74
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 86.74
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 86.72
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 86.7
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 86.67
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 86.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 86.61
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 86.58
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 86.57
3by6_A126 Predicted transcriptional regulator; structural ge 86.52
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 86.52
1p9r_A418 General secretion pathway protein E; bacterial typ 86.46
2fh5_B214 SR-beta, signal recognition particle receptor beta 86.4
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 86.34
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 86.33
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 86.3
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 86.27
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 86.23
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.18
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 86.1
3f8m_A 248 GNTR-family protein transcriptional regulator; PHN 85.98
3llu_A196 RAS-related GTP-binding protein C; structural geno 85.95
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 85.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 85.92
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 85.89
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 85.85
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 85.83
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 85.73
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.69
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 85.67
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 85.64
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 85.62
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 85.6
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 85.6
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 85.49
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 85.48
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 85.46
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 85.39
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 85.38
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 85.28
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 85.2
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 85.19
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 85.18
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 85.08
3io5_A333 Recombination and repair protein; storage dimer, i 85.04
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 84.95
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 84.93
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 84.89
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 84.85
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 84.84
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.78
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 84.71
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.63
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 84.61
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 84.61
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 84.61
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 84.6
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 84.56
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 84.54
2p8t_A 200 Hypothetical protein PH0730; pyrococcus horikoshii 84.44
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.42
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 84.4
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 84.39
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 84.36
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 84.31
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 84.25
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 84.22
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 84.21
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 84.18
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 84.15
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.07
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 83.99
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 83.97
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 83.9
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond 83.84
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 83.71
3edp_A 236 LIN2111 protein; APC88337, listeria innocua CLIP11 83.68
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 83.56
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 83.48
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 83.4
2og2_A359 Putative signal recognition particle receptor; nuc 83.38
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 83.23
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 83.14
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 83.04
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 83.0
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 82.95
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 82.91
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 82.91
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 82.8
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 82.75
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 82.7
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 82.63
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 82.49
2z43_A324 DNA repair and recombination protein RADA; archaea 82.45
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.37
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 82.36
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 82.35
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 82.33
1xjc_A169 MOBB protein homolog; structural genomics, midwest 82.32
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 82.16
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 82.09
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 82.0
3bwg_A 239 Uncharacterized HTH-type transcriptional regulato; 81.99
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 81.98
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 81.93
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 81.91
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 81.84
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 81.77
2h09_A155 Transcriptional regulator MNTR; transcription regu 81.76
3jth_A98 Transcription activator HLYU; transcription factor 81.75
3c7j_A 237 Transcriptional regulator, GNTR family; structural 81.71
2kko_A108 Possible transcriptional regulatory protein (possi 81.65
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 81.64
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 81.59
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 81.56
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 81.28
3iby_A256 Ferrous iron transport protein B; G protein, G dom 81.28
2www_A349 Methylmalonic aciduria type A protein, mitochondri 81.27
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 81.26
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 81.23
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 81.03
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 80.97
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 80.91
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 80.71
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 80.69
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 80.56
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 80.29
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 81.33
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 80.13
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 80.06
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
Probab=100.00  E-value=2.8e-95  Score=835.41  Aligned_cols=583  Identities=38%  Similarity=0.613  Sum_probs=527.2

Q ss_pred             HHHHHHHHHHhccccCCCcchhHHHHhcC----CCEEEEecchhhccCchHHHHHHhCHHHHHHHHHHHHHHHHHHhccc
Q 004862           34 TTLIKFKEFIRNFERDKNVFPYRESLIEN----PKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVLASLKMK  109 (726)
Q Consensus        34 ~~~~~f~~Fl~~f~~~~~~~~Y~~~l~~~----~~~l~Vd~~dL~~f~~~La~~l~~~P~~~l~~~~~a~~e~~~~~~~~  109 (726)
                      +++++|++||++|.+.++.++|+++|+++    ..+|.||++||.+|+|+|+++|+++|.+++++|+.|+++++.+..+.
T Consensus         3 ~~~~~f~~Fl~~~~~~~~~~~y~~~i~~~~~~~~~~l~v~~~~l~~~~~~l~~~l~~~p~~~~~~~~~a~~~~~~~~~~~   82 (595)
T 3f9v_A            3 DYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLDPT   82 (595)
T ss_dssp             CHHHHHHHHHHHCCTTTTSCTTHHHHHHHHHHTCSSCCEEHHHHHTTCTTHHHHHHTTHHHHHHHHHHHHHHHHHHHCGG
T ss_pred             HHHHHHHHHHHhhhccCCChhHHHHHHHHHHcCCcEEEEEhHHHhhhCHHHHHHHHHCHHHHHHHHHHHHHHHHHhhchh
Confidence            47889999999999888899999998764    67899999999999999999999999999999999999998876544


Q ss_pred             cCCCCCCcceEEEEecCCCCcccccccCccCCCcEEEEEeEEEEeecceeeEEEEEEEecC--CCCeEEEecC-CCCCCC
Q 004862          110 VDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKN--CKSTLDVPCR-PGLGGA  186 (726)
Q Consensus       110 ~~~~~~~~~~i~v~~~~~~~~~~ir~l~s~~igkLV~v~GiV~~~s~v~~~~~~~~~~C~~--C~~~~~~~~~-~~~~~~  186 (726)
                      +.   ....+++|+|+|.|....+|+|++.++||||+|+|+|+|+|.|+|++.+++|.|..  |++.+.+... ...+.+
T Consensus        83 ~~---~~~~~~~v~~~~~~~~~~~r~l~~~~i~~lv~v~G~V~r~s~v~~~~~~~~~~C~~~~C~~~~~~~~~~~~~~~~  159 (595)
T 3f9v_A           83 YQ---RDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVL  159 (595)
T ss_dssp             GT---TTCCCCCCCEECCSCEECGGGCCGGGTTCCEEEEEEEEEECCCEEEEEECCCEEESSSCCCBCCSSCSSCCCSSC
T ss_pred             hh---hccceEEEEEeCCCCCCChhhcchhhCCcEEEEEEEEEEecCEEEEEEEEEEEecCCCCCCEEEEEeccccCCcc
Confidence            32   22346899999999999999999999999999999999999999999999999999  9998765531 222467


Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CeEEecCCCceeeeeEEEeecCCCCCCCCCCceEEEEEEecCccccccCCcEEEEEEEE
Q 004862          187 IVPRSCGHIPQAGEEPCPID-PWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIY  265 (726)
Q Consensus       187 ~~P~~C~~~~~~g~~~C~~~-~~~~~~~~s~~~d~Q~I~iQE~~e~~~~g~~Pr~i~v~l~~dLv~~~~pGd~V~V~GIl  265 (726)
                      ..|..|++        |++. +|.++.+.|.|+|||+|+|||.|+++|.|++||+++|+|++||||+|+|||+|.||||+
T Consensus       160 ~~p~~C~~--------C~~~~~~~~~~~~s~~~d~Q~i~iQe~~~~~~~g~~pr~~~v~l~~dlv~~~~pGd~v~v~Gi~  231 (595)
T 3f9v_A          160 EMPTICPK--------CGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGIL  231 (595)
T ss_dssp             CCCSSCTT--------TCCCSEEECCSTTCEEEEEEEEEEECCTTTSCTTSCCCEEEEEEEGGGTTCSCSSCEEEEEEEC
T ss_pred             cCCCcCCC--------CCCCCceEEeccCceeeeeEEEEEEeccccCCCCCCCceEEEEEecccccccccCCEEEEEEEE
Confidence            89999987        8864 89999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeeeCCCCCCCCCcceeEeeeEEEEEeeeeeccccccCCCCCCHHHHHHHHHHhcCcchHHHHHHhhcCCccCchhHHHH
Q 004862          266 SIFQSANSPASHKGAVAVRQPYIRVVGLEETNEASSRGAAAFTQEEIEKFKKFASQPDAYKTVCSKIAPSIFGHDDVKKA  345 (726)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~i~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~si~p~I~G~~~~k~a  345 (726)
                      ++.+..+   ..++...++..||++++|+...+  ......+|+++++.+.++++++++|+.|.++++|.|+|++.+|++
T Consensus       232 ~~~~~~~---~~~~~~~~~~~~i~a~~i~~~~~--~~~~~~~t~~~~~~i~~~~~~~~~~~~l~~~l~~~I~G~e~vk~a  306 (595)
T 3f9v_A          232 DIKQDSP---VKRGSRAVFDIYMKVSSIEVSQK--VLDEVIISEEDEKKIKDLAKDPWIRDRIISSIAPSIYGHWELKEA  306 (595)
T ss_dssp             CCCCSST---TSCTTCCCCCCCCEEEEEEECCC--CCCCCCCTTSTHHHHHTTSSTTTGGGTHHHHTSSTTSCCHHHHHH
T ss_pred             Eeccccc---ccCCCcceEEEEEEEEeeccccc--ccccCCCCHHHHHHHHHHhhCcHHHHHHHHhhcchhcChHHHHHH
Confidence            9887653   22344567999999999987644  345567999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCcccCCCCccccCcceEEEECCCchhHHHHHHHHHHhCCCcEEeCCCCCCcccccceeeecCCCchhhhccC
Q 004862          346 VSCLLFGGSRKNLPDGVKLRGDVNVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSREFYLEGG  425 (726)
Q Consensus       346 ill~L~~~~~~~~~~g~~~r~~~~vLL~G~pGtGKt~la~~i~~~~~~~~~~~g~~~~~~gl~~~~~~~~~~~~~~~~~G  425 (726)
                      ++++|++|..+..++ .+.|+++||||+||||||||+||+++++.+++..++.+.+.+..+++++..++..++.|...+|
T Consensus       307 l~~~l~~g~~~~~~~-~~~r~~~~vLL~GppGtGKT~LAr~la~~~~r~~~~~~~~~~~~~l~~~~~~~~~~g~~~~~~G  385 (595)
T 3f9v_A          307 LALALFGGVPKVLED-TRIRGDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAG  385 (595)
T ss_dssp             HTTTTTCCCCEETTT-TEECCSCCEEEEESSCCTHHHHHHSSSTTCSCEECCCTTCSTTTTSEEECSSGGGTSSCSEEEC
T ss_pred             HHHHHhCCCcccccC-CCcCCCcceEEECCCchHHHHHHHHHHHhCCCceecCCCccccccccceeeeccccccccccCC
Confidence            999999998887777 8899999999999999999999999999999999988887888899998888777888999999


Q ss_pred             ceeecCCCeEEecccCcCCHHHHHHHHHHHhcceEeeeccceEEEeeCceEEEEecCCCCCcCCCccchhhhccCchhhh
Q 004862          426 AMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKSAQDNIDLQTTIL  505 (726)
Q Consensus       426 ~l~la~~gvl~iDEi~~~~~~~~~~L~~~me~~~i~i~~~g~~~~l~~~~~iiaa~Np~~g~~~~~~~~~~~~~l~~~Ll  505 (726)
                      ++.+|++||||||||++|+++.|+.|+++||++.+++.++|....++++++||||+||.+|+|+...+..+++.++++|+
T Consensus       386 ~l~~A~~gil~IDEid~l~~~~q~~Ll~~le~~~i~i~~~g~~~~~~~~~~vIaatNp~~G~~~~~~~~~~ni~l~~aLl  465 (595)
T 3f9v_A          386 ALVLADGGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYISERPVSDNINLPPTIL  465 (595)
T ss_dssp             HHHHHSSSEECCTTTTCCCSHHHHHHHHHHHSSSEEEESSSSEEEECCCCEEEEEECCTTCCSCTTSCSCTTTCSCSSSG
T ss_pred             eeEecCCCcEEeehhhhCCHhHhhhhHHHHhCCEEEEecCCcEEEecCceEEEEEcCCcCCccCcccCchhccCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998888899999999999


Q ss_pred             cccCeeeEeccCCChhhhHHHHHHHHHHhhhcccccccccccCCHHHHHHHHHHhHccCCCCCCHHHHHHHHHHHHHHHH
Q 004862          506 SRFDLIFIVKDIRMYNQDKLIASHIIKIHASADAVSADSKVSKEENWLKRYIQYCRLECHPRLSESASAKLRDQYVQIRK  585 (726)
Q Consensus       506 ~RFdli~~l~d~~~~~~d~~i~~~il~~~~~~~~~~~~~~~~~~~~~L~~yi~~a~~~~~p~ls~ea~~~l~~~y~~~R~  585 (726)
                      +|||+++.+.+.++++ |..|++|++..|...     ...+.++.++|++|+.||+..+.|.+++++.+.|.++|..+|+
T Consensus       466 ~RFDl~~~~~~~~~~e-~~~i~~~il~~~~~~-----~~~~~l~~~~l~~~i~~ar~~~~p~ls~ea~~~l~~~y~~lR~  539 (595)
T 3f9v_A          466 SRFDLIFILKDQPGEQ-DRELANYILDVHSGK-----STKNIIDIDTLRKYIAYARKYVTPKITSEAKNLITDFFVEMRK  539 (595)
T ss_dssp             GGCSCCEEECCTTHHH-HHHHHHHHHTTTCCC-----SSSSTTCCTTTHHHHHHHHHHHCCCCCCCTHHHHHHHHTTSSC
T ss_pred             hhCeEEEEeCCCCCHH-HHHHHHHHHHHhhcc-----ccccCCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999 999999999987642     2236788899999999999989999999999999999999987


Q ss_pred             HHhhhhcccCCCCCccCChhHHHHHHHHHHHHHhhhCCCcccHHHHHHHHHHHhhhhhh
Q 004862          586 DMRRQANETGEAAPIPITVRQLEAIVRLSEALAKMKLSHVATENEVNEAVRLFTVSTMD  644 (726)
Q Consensus       586 ~~~~~~~~~~~~~~~~~t~R~L~~lirla~a~A~l~~~~~V~~~Dv~~ai~l~~~s~~~  644 (726)
                      .....     ....|++|+|+|++++|+|+|+|++++++.|+++|+.+|+++++.|+.+
T Consensus       540 ~~~~~-----~~~~~~~s~R~l~~lirla~a~A~l~~~~~V~~~dv~~Ai~l~~~sl~~  593 (595)
T 3f9v_A          540 KSSET-----PDSPILITPRQLEALIRISEAYAKMALKAEVTREDAERAINIMRLFLES  593 (595)
T ss_dssp             SCCBC-----SSSCBCSSTTTTTHHHHHHHHHHHTTSSCCSSHHHHHHHHHHHHHHHHT
T ss_pred             hhccC-----CCccccccHHHHHHHHHHHHHHHHHhCcCCCCHHHHHHHHHHHHHHHHh
Confidence            65431     1236999999999999999999999999999999999999999998754
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix-TUR UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural GE PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.09A {Listeria innocua} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3bwg_A Uncharacterized HTH-type transcriptional regulato; APC85486, YYDK, transcriptional regulator, structural genomi 2; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 726
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 8e-41
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 6e-11
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score =  147 bits (372), Expect = 8e-41
 Identities = 57/243 (23%), Positives = 98/243 (40%), Gaps = 20/243 (8%)

Query: 32  RHTTLIKFKEFIRNFERDKNVFPYRESLIENPKFLLVHLEDLLAFDADLPSLLRSSPADF 91
           +  TL KF+EF    +    VF   E    N + + V   DL  FD DL  LL   P D 
Sbjct: 3   KSKTLTKFEEFFSLQDYKDRVFEAIEK-YPNVRSIEVDYLDLEMFDPDLADLLIEKPDDV 61

Query: 92  LPLFETAAAEVLASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGIT 151
           +   + A   +         +   K  ++ I  +   + + +R + ++FI K V + GI 
Sbjct: 62  IRAAQQAIRNI---------DRLRKNVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIV 112

Query: 152 IAASRVKAKATYVHLSCKNCKSTLDVPCRPGLGGAIVPRSCGHIPQAGEEPCPIDPWIIV 211
                ++ +       C+ C                 P  C          C    + ++
Sbjct: 113 RKTDEIRPRIVKAVFECRGCMRH--HAVTQSTNMITEPSLC--------SECGGRSFRLL 162

Query: 212 PDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIFQSA 271
            D+S+++D QTLKLQE  E++  GE PR + + ++  LV T+ PG  + + G     +  
Sbjct: 163 QDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRTVRDE 222

Query: 272 NSP 274
            + 
Sbjct: 223 RTK 225
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query726
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 100.0
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.97
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.82
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.68
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.68
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.51
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.51
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.47
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.45
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.45
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.43
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.4
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.4
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.39
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.37
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.34
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.29
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.18
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.15
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.04
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.01
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.93
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.92
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.89
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.86
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.84
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.76
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.57
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.26
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.92
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.78
d1in4a175 Holliday junction helicase RuvB {Thermotoga mariti 97.3
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.26
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.08
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.61
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.51
d1ixsb176 Holliday junction helicase RuvB {Thermus thermophi 96.48
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.46
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.45
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.44
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.36
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.31
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.96
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.92
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.87
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.81
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.79
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.75
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.64
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.57
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.57
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.54
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.52
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.46
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.22
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.19
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.05
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.96
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.95
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.89
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.77
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 94.7
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.68
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.66
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.58
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.47
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.39
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.33
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.28
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 94.26
d1mkma175 Transcriptional regulator IclR, N-terminal domain 94.05
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.86
d2p8ta169 Hypothetical protein PH0730 {Pyrococcus horikoshii 93.83
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.81
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 93.75
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.74
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.5
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.37
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.36
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.35
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.15
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 93.11
d1hw1a174 Fatty acid responsive transcription factor FadR, N 93.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.92
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.86
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.81
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 92.67
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.66
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.59
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.3
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.87
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 91.85
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.83
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.36
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.13
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 91.11
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 90.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.92
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.91
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.66
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.63
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.43
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.37
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.31
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.25
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.17
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.14
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.99
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.94
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.93
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.91
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.91
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.85
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.84
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.83
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.78
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.76
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.7
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.56
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.54
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.53
d2awna2232 Maltose transport protein MalK, N-terminal domain 89.51
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.49
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.45
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 89.45
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.43
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 89.43
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.41
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.4
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.33
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.3
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.2
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.17
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.15
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.12
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.1
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.07
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.07
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.02
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.98
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 88.92
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 88.85
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.65
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.59
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.53
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.5
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 88.45
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.43
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.29
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.2
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.19
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.14
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.11
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.97
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 87.93
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 87.88
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 87.82
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.82
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.72
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.7
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.68
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.62
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 87.62
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.6
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.44
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.43
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.4
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.38
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 87.35
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 87.31
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.05
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 87.01
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 86.91
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 86.8
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 86.6
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.51
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.47
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.44
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.39
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.34
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.17
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.17
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 85.91
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 85.84
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.81
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.66
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.41
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.39
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.38
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.36
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 85.16
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.11
d1ls1a2207 GTPase domain of the signal sequence recognition p 84.95
d1okkd2207 GTPase domain of the signal recognition particle r 84.81
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 84.77
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 84.16
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.13
d1vmaa2213 GTPase domain of the signal recognition particle r 84.1
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 83.88
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.88
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 83.8
d2qy9a2211 GTPase domain of the signal recognition particle r 83.73
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.61
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.5
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.34
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 82.79
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.74
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 82.53
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.87
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.7
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 81.66
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.61
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 81.51
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 81.5
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 81.21
d1i5za169 Catabolite gene activator protein (CAP), C-termina 80.95
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 80.83
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 80.15
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=100.00  E-value=1.4e-42  Score=350.46  Aligned_cols=231  Identities=26%  Similarity=0.444  Sum_probs=199.0

Q ss_pred             ccHHHHHHHHHHHHhccccCCCcchhHHHHhc------CCCEEEEecchhhccCchHHHHHHhCHHHHHHHHHHHHHHHH
Q 004862           30 HRRHTTLIKFKEFIRNFERDKNVFPYRESLIE------NPKFLLVHLEDLLAFDADLPSLLRSSPADFLPLFETAAAEVL  103 (726)
Q Consensus        30 ~~~~~~~~~f~~Fl~~f~~~~~~~~Y~~~l~~------~~~~l~Vd~~dL~~f~~~La~~l~~~P~~~l~~~~~a~~e~~  103 (726)
                      ++..+....|.+||...       .|.+++.+      +..+|.|||.||..|+|+|+++|+++|.+++++|++|++++.
T Consensus         1 ~d~~~~l~~f~e~~~~~-------~y~~~i~~~~~~~~~~~sl~Vd~~~L~~~~~~L~~~l~~~P~~~l~~~~~ai~~~~   73 (239)
T d1ltla_           1 VDKSKTLTKFEEFFSLQ-------DYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNID   73 (239)
T ss_dssp             CCHHHHHHHHHHHTTSH-------HHHHHHHHHHHHTTSCCEEEEEHHHHHHHCTTHHHHHHHSHHHHHHHHHHHHTTTC
T ss_pred             CCHHHHHHHHHHHhchH-------hHHHHHHHHHHcCCCCcEEEEEHHHHHhhCHHHHHHHHHCHHHHHHHHHHHHHhHH
Confidence            35667778888888543       26666543      346899999999999999999999999999999999987652


Q ss_pred             HHhccccCCCCCCcceEEEEecCCCCcccccccCccCCCcEEEEEeEEEEeecceeeEEEEEEEecCCCCeEEEecCCCC
Q 004862          104 ASLKMKVDNEEPKTEEVQILLTSKEDSMSMRSIGAQFISKLVKISGITIAASRVKAKATYVHLSCKNCKSTLDVPCRPGL  183 (726)
Q Consensus       104 ~~~~~~~~~~~~~~~~i~v~~~~~~~~~~ir~l~s~~igkLV~v~GiV~~~s~v~~~~~~~~~~C~~C~~~~~~~~~~~~  183 (726)
                      .         ......++|++.+.+...++|+|++.++||||+|+|+|+++|.++|++.+++|.|..|++.+.+....  
T Consensus        74 ~---------~~~~~~i~vr~~~~~~~~~ir~l~s~~igkLv~v~GiV~r~s~v~~~~~~~~~~C~~C~~~~~~~~~~--  142 (239)
T d1ltla_          74 R---------LRKNVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQST--  142 (239)
T ss_dssp             T---------TCCCCCCEEEEECCSCBCCGGGCCGGGTTSEEEEEEEEEEECCCEEEEEEEEEEETTTCCEEEEECSS--
T ss_pred             h---------hccCceEEEEEcCCCCccchhccchhhhccEEEEEEEEEEeCCEEEEEEEEEEECCCCCceEEEEecC--
Confidence            1         12234678999999999999999999999999999999999999999999999999999999877654  


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCeEEecCCCceeeeeEEEeecCCCCCCCCCCceEEEEEEecCccccccCCcEEEEEE
Q 004862          184 GGAIVPRSCGHIPQAGEEPCPIDPWIIVPDKSQYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQTIVPGTRLTIMG  263 (726)
Q Consensus       184 ~~~~~P~~C~~~~~~g~~~C~~~~~~~~~~~s~~~d~Q~I~iQE~~e~~~~g~~Pr~i~v~l~~dLv~~~~pGd~V~V~G  263 (726)
                      +.+..|..|++        |++++|.++++.|.|+|||+|+|||.|+++|.|++||+++|+|++||||+|+|||+|+|+|
T Consensus       143 ~~~~~p~~C~~--------C~~~~f~~~~~~s~~~d~Q~i~iQE~~e~~~~G~~Pr~i~v~l~~dlvd~~~pGd~V~i~G  214 (239)
T d1ltla_         143 NMITEPSLCSE--------CGGRSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTG  214 (239)
T ss_dssp             SSCCCCSCCTT--------TCCCCEEECGGGCEEEEEEEEEEECCSTTCCSSCCCCEEEEEEEGGGTTCCCTTCEEEEEE
T ss_pred             CeecCCccCCC--------CCCcccEEccCcceEeeeEEEEEecccccCCCCCCCcEEEEEEeccccCccCCCCEEEEEE
Confidence            35788999987        8888999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeeeCCCCCCCCCcceeEeeeEEEEEeee
Q 004862          264 IYSIFQSANSPASHKGAVAVRQPYIRVVGLE  294 (726)
Q Consensus       264 Il~~~~~~~~~~~~~~~~~~~~~~i~~~~i~  294 (726)
                      |+++.+...   +     ..+..||.+++|+
T Consensus       215 I~~~~~~~~---~-----~~~~~~i~a~~Ie  237 (239)
T d1ltla_         215 TLRTVRDER---T-----KRFKNFIYGNYTE  237 (239)
T ss_dssp             EEEEEEETT---T-----TEEEEEEEEEECC
T ss_pred             EEEEeecCC---C-----CceEEEEEEEEEE
Confidence            999776432   1     1356778887775
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1in4a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixsb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure