Citrus Sinensis ID: 004914

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----
MAPFPAENGVEGDDEREEEEEEDEDEEEEEEEEEEEPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF
cccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEEEEEcccEEEEEEccccEEEEcccccEEEEEccccccccEEEEcccccEEEEEEccccEEEEEcccccEEcccccccEEEEEEccccccccccEEEEEcccccEEEEEEcccccccEEEEcccccEEEEEEcccEEEEEccccEEEEEcccccEEEEEEccccccccccccccEEEccccEEEEEEcccEEEEEEEEccccccccccccccccEEEEEEEEEEcEEEEEEccccccEEEEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEcccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHcccHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHcccHHHHc
cccccccccccccccccccccccccccccccccccccccEEEEccccHHHHHcccccEEEEEcccEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEccccEEEEEEccccccccccEEEEccccccEEEEEccccccccEEEEcccccEEEEEEcccEEEEEccccEEEEEccccEEEEEEcccccccccHHccccEEEccccEEEEEEccEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEEEEEccccccEEEEEEEccccccccccccccccccccccccEEEEEEccccEEccccEEcccccEcccccccccccccccccccccccccccccEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccHHHcc
mapfpaengvegddereeeeeededeeeeeeeeeeeprlkyqrmggslpsllANDAASCVAVAERMIALGTHAGTVHILDFLGnqvkefpahtaavndlsfdvdgeyvgscsddgsvvinslftdekmkfdyhrpmkaisldpdytrkMSRRFVAGGLAghlylnskkwlgyrdqvlhsgegpvHVVKWRTSLIAWANDAGVKVYDAANDQRITfierprgsprpelllphlvwqddtllvIGWGTYIKIASIKTnqsnvangtyrhvgMNQVDIVASFQTSyyisgiapfgDCLVVLAyipgeedgekefsstlpsrqgnaqrpevrivtwnndelttdalpvlgfehykakdyslahapfsgssyaggqwaagdeplyyivspkdvviakprdAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHlrqlpvlvpymptenprlrdTAYEVALVALATNPSFHKYLLStvkswppviysalpvisaiepqlnsssMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFdfienhnlhDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFevnphagkdfHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKlgdieevf
mapfpaengvegddereeeeeededeeeeeeeeeeeprlkyQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTdekmkfdyhrpmkaisldpdytRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFierprgsprpeLLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFsstlpsrqgnaqrpevrivTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLiqnkdlitpsEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILgrmgntkhALAVIINklgdieevf
MAPFPAENGVegddereeeeeededeeeeeeeeeeePRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF
**************************************************LLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERP****RPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIP************************VRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQL****MTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDI****
**************************************LKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTN**********HVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYI**********************RPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHA***********WAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF
*****************************************QRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEE******************RPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF
***********************************EPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQ********RHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGE****************NAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEE**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPFPAENGxxxxxxxxxxxxxxxxxxxxxxxxxxxPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query724 2.2.26 [Sep-21-2011]
P93231 960 Vacuolar protein sorting- N/A no 0.998 0.753 0.850 0.0
P93043 980 Vacuolar protein sorting- yes no 0.944 0.697 0.818 0.0
P49754 854 Vacuolar protein sorting- yes no 0.893 0.757 0.377 1e-133
Q5KU39 853 Vacuolar protein sorting- yes no 0.893 0.758 0.378 1e-133
Q9P7N3 871 Vacuolar protein sorting- yes no 0.896 0.745 0.321 3e-99
Q19954 901 Vacuolar protein sorting- yes no 0.890 0.715 0.260 1e-61
Q618H8 898 Vacuolar protein sorting- N/A no 0.911 0.734 0.269 7e-60
P38959 992 Vacuolar protein sorting- yes no 0.912 0.666 0.229 2e-47
>sp|P93231|VPS41_SOLLC Vacuolar protein sorting-associated protein 41 homolog OS=Solanum lycopersicum GN=VPS41 PE=2 SV=1 Back     alignment and function desciption
 Score = 1263 bits (3269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/727 (85%), Positives = 668/727 (91%), Gaps = 4/727 (0%)

Query: 1   MAPFPAENGVEGDDEREEEEEEDEDEEEEEEEEEEEPRLKYQRMGGSLPSLLANDAASCV 60
           M+P P+ENG++  D+  +EEEED +EEE EEEEE+EPRLKYQRMG S+PSLL+ DAA+C+
Sbjct: 1   MSPKPSENGID-GDDERDEEEEDSEEEEAEEEEEDEPRLKYQRMGASVPSLLSADAATCI 59

Query: 61  AVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVIN 120
           AVAERMIALGTH G VHILDFLGNQVKEF AHTAAVNDL FD DGEYVGSCSDDGSVVIN
Sbjct: 60  AVAERMIALGTHGGAVHILDFLGNQVKEFAAHTAAVNDLCFDTDGEYVGSCSDDGSVVIN 119

Query: 121 SLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSG 180
           SLFTDE+MKF+YHRPMKAI+LDPDY R  SRRFV GGLAG LYLN KKWLGYRDQVLHSG
Sbjct: 120 SLFTDERMKFEYHRPMKAIALDPDYARTSSRRFVTGGLAGQLYLNVKKWLGYRDQVLHSG 179

Query: 181 EGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLL 240
           EGP+H VKWRTSL+AWAND GVKVYDA+NDQRITFIERPRG PRPELLLPH+VWQDD+LL
Sbjct: 180 EGPIHAVKWRTSLVAWANDTGVKVYDASNDQRITFIERPRGIPRPELLLPHIVWQDDSLL 239

Query: 241 VIGWGTYIKIASIKTNQSNVANGTYRHVGM---NQVDIVASFQTSYYISGIAPFGDCLVV 297
           VIGWGT +KIA I+T QS  ANGTY+H+ M   NQVDIVASFQTSY+ISGIAPFGD LV+
Sbjct: 240 VIGWGTSVKIALIRTTQSKGANGTYKHMSMSSLNQVDIVASFQTSYFISGIAPFGDSLVI 299

Query: 298 LAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSL 357
           LAYIPGEEDGEK+FSST+PSRQGNAQRPEVR+VTWNNDEL TDALPV GFEHYKAKDYSL
Sbjct: 300 LAYIPGEEDGEKDFSSTIPSRQGNAQRPEVRVVTWNNDELATDALPVHGFEHYKAKDYSL 359

Query: 358 AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVE 417
           AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHI WLL+HGWHEKAL AVE
Sbjct: 360 AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHINWLLQHGWHEKALEAVE 419

Query: 418 AGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL 477
           A QG+SELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL
Sbjct: 420 ANQGQSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL 479

Query: 478 VPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNS 537
           VPY+PTENPRLRDTAYEVALVALATNPSFHK LLSTVKSWPP IYS  PV SAIEPQ+N+
Sbjct: 480 VPYIPTENPRLRDTAYEVALVALATNPSFHKDLLSTVKSWPPRIYSTTPVFSAIEPQINT 539

Query: 538 SSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLD 597
           SSMTD LKEALAELYVIDG ++KAF+LYADLMKP +FDFIE HNLHDA+REKV+QLM++D
Sbjct: 540 SSMTDPLKEALAELYVIDGQHDKAFALYADLMKPDLFDFIEKHNLHDAVREKVLQLMMID 599

Query: 598 CKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQV 657
           CKRAV LLIQ +DLI PSEVV+QL+ ARDKCD RYFLHLYLH+LFEVN HAGKD+HDMQV
Sbjct: 600 CKRAVLLLIQQRDLIPPSEVVSQLIAARDKCDYRYFLHLYLHSLFEVNLHAGKDYHDMQV 659

Query: 658 ELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKL 717
           ELYADYD KMLL FLRSSQHYTLEKAYEICVK+DLL+EQVFILGRMGN K ALAVIIN+L
Sbjct: 660 ELYADYDPKMLLTFLRSSQHYTLEKAYEICVKKDLLKEQVFILGRMGNAKQALAVIINRL 719

Query: 718 GDIEEVF 724
           GDIEE  
Sbjct: 720 GDIEEAI 726
Required for vacuolar assembly and vacuolar traffic.
Solanum lycopersicum (taxid: 4081)
>sp|P93043|VPS41_ARATH Vacuolar protein sorting-associated protein 41 homolog OS=Arabidopsis thaliana GN=VPS41 PE=3 SV=3 Back     alignment and function description
>sp|P49754|VPS41_HUMAN Vacuolar protein sorting-associated protein 41 homolog OS=Homo sapiens GN=VPS41 PE=1 SV=3 Back     alignment and function description
>sp|Q5KU39|VPS41_MOUSE Vacuolar protein sorting-associated protein 41 homolog OS=Mus musculus GN=Vps41 PE=2 SV=1 Back     alignment and function description
>sp|Q9P7N3|VPS41_SCHPO Vacuolar protein sorting-associated protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps41 PE=3 SV=2 Back     alignment and function description
>sp|Q19954|VPS41_CAEEL Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis elegans GN=vps-41 PE=3 SV=4 Back     alignment and function description
>sp|Q618H8|VPS41_CAEBR Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis briggsae GN=vps-41 PE=3 SV=1 Back     alignment and function description
>sp|P38959|VPS41_YEAST Vacuolar protein sorting-associated protein 41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS41 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query724
255565515 955 vacuolar protein sorting vps41, putative 0.995 0.754 0.872 0.0
359479329 960 PREDICTED: vacuolar protein sorting-asso 0.947 0.714 0.891 0.0
356539325 957 PREDICTED: vacuolar protein sorting-asso 0.997 0.754 0.870 0.0
297734881 908 unnamed protein product [Vitis vinifera] 0.937 0.747 0.890 0.0
224104751 952 predicted protein [Populus trichocarpa] 0.997 0.758 0.874 0.0
356544684 957 PREDICTED: vacuolar protein sorting-asso 0.997 0.754 0.867 0.0
350536253 960 vacuolar protein sorting-associated prot 0.998 0.753 0.850 0.0
449443388 960 PREDICTED: vacuolar protein sorting-asso 0.946 0.713 0.871 0.0
449516828 960 PREDICTED: vacuolar protein sorting-asso 0.946 0.713 0.871 0.0
224058957 951 predicted protein [Populus trichocarpa] 0.980 0.746 0.858 0.0
>gi|255565515|ref|XP_002523748.1| vacuolar protein sorting vps41, putative [Ricinus communis] gi|223537052|gb|EEF38688.1| vacuolar protein sorting vps41, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/732 (87%), Positives = 686/732 (93%), Gaps = 11/732 (1%)

Query: 1   MAPFPAENGVEGDDEREEEEEEDEDEEEEEEEEEEE-------PRLKYQRMGGSLPSLLA 53
           M+P P ENGV+GDDEREEEEEE+E++++  E+E+EE       PRLKYQRMGGS+P+LL+
Sbjct: 1   MSPIPPENGVDGDDEREEEEEEEEEDDDVNEDEDEEEEEEEEEPRLKYQRMGGSIPTLLS 60

Query: 54  NDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSD 113
           NDAASC+AVAERMIALGT  GTVHILDFLGNQVKEF AHTAAVNDLSFD++GEY+GSCSD
Sbjct: 61  NDAASCIAVAERMIALGTLDGTVHILDFLGNQVKEFAAHTAAVNDLSFDIEGEYIGSCSD 120

Query: 114 DGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYR 173
           DGSVVI+SLFTDEKMKFDYHRPMKAI+LDP+Y+RK SRRFVAGGLAGHLY NSKKWLGYR
Sbjct: 121 DGSVVIHSLFTDEKMKFDYHRPMKAIALDPEYSRKTSRRFVAGGLAGHLYFNSKKWLGYR 180

Query: 174 DQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLV 233
           DQVLHSGEGP+H VKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLV
Sbjct: 181 DQVLHSGEGPIHAVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLV 240

Query: 234 WQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHV---GMNQVDIVASFQTSYYISGIAP 290
           WQDD+LLVIGWGT +KIASI+ N+    NGTY+ +    MN+VDIVASFQTSYYISGIAP
Sbjct: 241 WQDDSLLVIGWGTSVKIASIRANEHKGTNGTYKPLPAASMNKVDIVASFQTSYYISGIAP 300

Query: 291 FGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHY 350
           FGD LVVLAYIPGE DGEKEFSST+PSRQGNAQRPEVRI+TWNNDEL TDALPV GFEHY
Sbjct: 301 FGDSLVVLAYIPGE-DGEKEFSSTIPSRQGNAQRPEVRIITWNNDELATDALPVHGFEHY 359

Query: 351 KAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHE 410
           KAKDYSLAH+PFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHI WLL+H WHE
Sbjct: 360 KAKDYSLAHSPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHITWLLQHNWHE 419

Query: 411 KALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAH 470
           KALAAVEAGQ RSELLDEVGSRYLDHLIVERKYA+AASLCPKLL+GSASAWERWVFHFAH
Sbjct: 420 KALAAVEAGQARSELLDEVGSRYLDHLIVERKYAQAASLCPKLLQGSASAWERWVFHFAH 479

Query: 471 LRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISA 530
           LRQLPVLVPY+PTENPRLRDTAYEVALVALATNPSFHK LLSTVKSWPPVIYSALPVISA
Sbjct: 480 LRQLPVLVPYIPTENPRLRDTAYEVALVALATNPSFHKDLLSTVKSWPPVIYSALPVISA 539

Query: 531 IEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKV 590
           IEPQLN+SSMTDALKEALAELYVIDG YE+A SLYADLMKP IFDF+E HNLHDAIREKV
Sbjct: 540 IEPQLNTSSMTDALKEALAELYVIDGQYERASSLYADLMKPEIFDFVEKHNLHDAIREKV 599

Query: 591 VQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGK 650
           VQLM+LDCKRAV LLIQN+DLI P+EVV+QLL AR+KCDSRYFLHLYLH+LFE NPHAGK
Sbjct: 600 VQLMMLDCKRAVPLLIQNRDLIPPAEVVSQLLAARNKCDSRYFLHLYLHSLFEANPHAGK 659

Query: 651 DFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHAL 710
           DFHDMQVELYADYD KMLLPFLRSSQHYTLEKAY+IC+KRDLLREQVFILGRMGN+K AL
Sbjct: 660 DFHDMQVELYADYDPKMLLPFLRSSQHYTLEKAYDICIKRDLLREQVFILGRMGNSKKAL 719

Query: 711 AVIINKLGDIEE 722
           AVIINKLGDIEE
Sbjct: 720 AVIINKLGDIEE 731

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359479329|ref|XP_002273250.2| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|356539325|ref|XP_003538149.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Glycine max] Back     alignment and taxonomy information
>gi|297734881|emb|CBI17115.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224104751|ref|XP_002313553.1| predicted protein [Populus trichocarpa] gi|222849961|gb|EEE87508.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544684|ref|XP_003540777.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Glycine max] Back     alignment and taxonomy information
>gi|350536253|ref|NP_001233981.1| vacuolar protein sorting-associated protein 41 homolog [Solanum lycopersicum] gi|2499115|sp|P93231.1|VPS41_SOLLC RecName: Full=Vacuolar protein sorting-associated protein 41 homolog gi|1835788|gb|AAB60857.1| VPS41 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449443388|ref|XP_004139459.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516828|ref|XP_004165448.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|224058957|ref|XP_002299663.1| predicted protein [Populus trichocarpa] gi|222846921|gb|EEE84468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query724
TAIR|locus:2200008 980 VPS41 "AT1G08190" [Arabidopsis 0.944 0.697 0.818 5.8e-311
UNIPROTKB|F1SSB8 854 VPS41 "Uncharacterized protein 0.465 0.394 0.389 8.1e-125
MGI|MGI:1929215 853 Vps41 "vacuolar protein sortin 0.472 0.400 0.388 1.7e-124
UNIPROTKB|A3KN15 854 VPS41 "VPS41 protein" [Bos tau 0.472 0.400 0.385 1.7e-124
UNIPROTKB|P49754 854 VPS41 "Vacuolar protein sortin 0.472 0.400 0.388 2.1e-124
RGD|1560511719 Vps41 "vacuolar protein sortin 0.472 0.475 0.385 7.2e-124
UNIPROTKB|E2R6C3 854 VPS41 "Uncharacterized protein 0.472 0.400 0.383 1.2e-123
ZFIN|ZDB-GENE-030131-6671 855 vps41 "vacuolar protein sortin 0.465 0.394 0.374 2.2e-122
DICTYBASE|DDB_G0286803 1087 vps41 "7-fold repeat in clathr 0.928 0.618 0.369 8.5e-120
UNIPROTKB|F1NMR8 854 VPS41 "Uncharacterized protein 0.472 0.400 0.374 1.2e-119
TAIR|locus:2200008 VPS41 "AT1G08190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2983 (1055.1 bits), Expect = 5.8e-311, P = 5.8e-311
 Identities = 573/700 (81%), Positives = 624/700 (89%)

Query:    37 PRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAV 96
             PRLKYQRMGG++P+LL+NDAASC+AVA RMIALGTH GTV ILD LGNQVKEF AHTA V
Sbjct:    42 PRLKYQRMGGNVPALLSNDAASCIAVAARMIALGTHDGTVRILDLLGNQVKEFRAHTAPV 101

Query:    97 NDLSFDVDGEYVGSCSDDGSVVINSLFTD-EKMKFDYHRPMKAISLDPDYTRKMSRRFVA 155
             ND++FD +GEY+GSCSDDGSVVINSLFTD EKMKFDYHRPMKAISLDPDYT+K S+RFVA
Sbjct:   102 NDINFDTEGEYIGSCSDDGSVVINSLFTDDEKMKFDYHRPMKAISLDPDYTKKQSKRFVA 161

Query:   156 GGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITF 215
             GGLAGHLY+NSKKW G +DQVLHSGEGP+H VKWR SLIAWAND GVKVYD A DQR+TF
Sbjct:   162 GGLAGHLYMNSKKWFGNKDQVLHSGEGPIHSVKWRGSLIAWANDVGVKVYDTAKDQRVTF 221

Query:   216 IERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMN---Q 272
             IE+PRGSPRPE LLPHLVWQDDTLLVIGWGT +KIASIK++Q     GT+R + M+   Q
Sbjct:   222 IEKPRGSPRPEALLPHLVWQDDTLLVIGWGTSVKIASIKSDQQQT--GTFRQIQMSSLTQ 279

Query:   273 VDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLP-SRQGNAQRPEVRIVT 331
             VDIVASFQTSYYISGIAPFGD LV+LAYIP E DGEKEFSST   SRQGNAQRPE+RIV+
Sbjct:   280 VDIVASFQTSYYISGIAPFGDSLVILAYIPIEGDGEKEFSSTTTLSRQGNAQRPEIRIVS 339

Query:   332 WNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIA 391
             WNNDELT DALPV GFEHYKAKDYSLAHAPF GSSYAGGQWAAGDEPLYYIVSPKDVVIA
Sbjct:   340 WNNDELTMDALPVHGFEHYKAKDYSLAHAPFPGSSYAGGQWAAGDEPLYYIVSPKDVVIA 399

Query:   392 KPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCP 451
             KPRDAEDHI WLL+HG+HEKALAAVEA +GR+EL+D+VG+ YLDHLIVERKYAEAASLCP
Sbjct:   400 KPRDAEDHINWLLQHGFHEKALAAVEASEGRTELIDKVGAGYLDHLIVERKYAEAASLCP 459

Query:   452 KLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLL 511
             KLLRGSASAWERWVFHFA LRQLPVLVPYMPT+NPRL+DT YEVALVALATNPS+HK LL
Sbjct:   460 KLLRGSASAWERWVFHFAQLRQLPVLVPYMPTDNPRLKDTVYEVALVALATNPSYHKELL 519

Query:   512 STVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKP 571
             S VKSWP  +YSAL VISAIEPQLN+SSMTDALKEALAELYVIDG Y+KAFSLYADL+KP
Sbjct:   520 SAVKSWPRSVYSALTVISAIEPQLNTSSMTDALKEALAELYVIDGQYQKAFSLYADLLKP 579

Query:   572 YIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARD----- 626
              +FDFIE ++LH+AIR KVVQLMLLDCKRA  L IQN+DLI PSEVV QLL A       
Sbjct:   580 EVFDFIEKYSLHEAIRGKVVQLMLLDCKRATVLFIQNRDLIPPSEVVPQLLKAGKNPQVL 639

Query:   627 ----KCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEK 682
                 KCDSRY+L+LYLHALFEV+   GKDFHDMQVELYA+YD KMLLPFLRSSQHY LEK
Sbjct:   640 KAGKKCDSRYYLYLYLHALFEVSHDTGKDFHDMQVELYAEYDTKMLLPFLRSSQHYKLEK 699

Query:   683 AYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEE 722
             AYE+CVK+D LREQVF+LGRMGN K ALAVIINKLGDIEE
Sbjct:   700 AYELCVKKDFLREQVFVLGRMGNAKQALAVIINKLGDIEE 739
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0006623 "protein targeting to vacuole" evidence=TAS
GO:0009630 "gravitropism" evidence=IMP
UNIPROTKB|F1SSB8 VPS41 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1929215 Vps41 "vacuolar protein sorting 41 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN15 VPS41 "VPS41 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P49754 VPS41 "Vacuolar protein sorting-associated protein 41 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1560511 Vps41 "vacuolar protein sorting 41 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6C3 VPS41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6671 vps41 "vacuolar protein sorting 41 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286803 vps41 "7-fold repeat in clathrin and VPS proteins repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMR8 VPS41 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P93231VPS41_SOLLCNo assigned EC number0.85000.99860.7531N/Ano
P93043VPS41_ARATHNo assigned EC number0.81850.94470.6979yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022129001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (965 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00024931001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (1006 aa)
      • 0.475
GSVIVG00029140001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (912 aa)
      • 0.463
GSVIVG00018148001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (428 aa)
      • 0.403

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query724
smart00299140 smart00299, CLH, Clathrin heavy chain repeat homol 1e-17
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 3e-11
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
smart0032040 smart00320, WD40, WD40 repeats 4e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 1e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 1e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-05
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 2e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 2e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 2e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-04
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 5e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 7e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 7e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.001
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.002
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.003
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.004
pfam00183529 pfam00183, HSP90, Hsp90 protein 0.004
>gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology Back     alignment and domain information 
 Score = 80.0 bits (198), Expect = 1e-17
 Identities = 33/119 (27%), Positives = 48/119 (40%), Gaps = 8/119 (6%)

Query: 605 LIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVN-PHAGKDFHDMQVELYADY 663
           L++  D I  SEVV                 L  +    +             +ELYA Y
Sbjct: 1   LLEVSDPIDVSEVVELFE------KRNLLEELIPYLESALKLNSENPALQTKLIELYAKY 54

Query: 664 DLKMLLPFL-RSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIE 721
           D +  +  L   S HY +EK  ++C K  L  E V +  + GN K A+  +I  LG+ E
Sbjct: 55  DPQKEIERLDNKSNHYDIEKVGKLCEKAKLYEEAVELYKKDGNFKDAIVTLIEHLGNYE 113

Length = 140
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 724
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 100.0
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 100.0
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 99.96
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 99.95
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.92
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.92
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.92
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.92
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.91
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.9
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.9
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.89
KOG0263707 consensus Transcription initiation factor TFIID, s 99.88
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.87
KOG0286343 consensus G-protein beta subunit [General function 99.87
KOG0286343 consensus G-protein beta subunit [General function 99.87
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.86
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.86
KOG0296399 consensus Angio-associated migratory cell protein 99.86
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.86
KOG0295406 consensus WD40 repeat-containing protein [Function 99.85
KOG0315311 consensus G-protein beta subunit-like protein (con 99.85
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.85
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.84
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.84
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.84
KOG0315311 consensus G-protein beta subunit-like protein (con 99.84
KOG0266456 consensus WD40 repeat-containing protein [General 99.84
KOG0772641 consensus Uncharacterized conserved protein, conta 99.83
KOG0266456 consensus WD40 repeat-containing protein [General 99.83
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.83
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.83
PTZ00421493 coronin; Provisional 99.82
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.82
PTZ00421493 coronin; Provisional 99.81
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.81
KOG0645312 consensus WD40 repeat protein [General function pr 99.81
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.81
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.81
KOG0295406 consensus WD40 repeat-containing protein [Function 99.81
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.8
PTZ00420568 coronin; Provisional 99.8
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.8
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.8
PTZ00420568 coronin; Provisional 99.8
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.8
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.8
smart00299140 CLH Clathrin heavy chain repeat homology. 99.79
KOG0645312 consensus WD40 repeat protein [General function pr 99.79
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.79
KOG0283712 consensus WD40 repeat-containing protein [Function 99.79
PLN00181793 protein SPA1-RELATED; Provisional 99.78
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.78
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.77
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.77
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.77
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.76
KOG0643327 consensus Translation initiation factor 3, subunit 99.76
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.76
KOG0269839 consensus WD40 repeat-containing protein [Function 99.76
KOG0289506 consensus mRNA splicing factor [General function p 99.75
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.75
KOG0283712 consensus WD40 repeat-containing protein [Function 99.75
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.74
KOG0293519 consensus WD40 repeat-containing protein [Function 99.74
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.74
KOG0294362 consensus WD40 repeat-containing protein [Function 99.74
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.74
PLN00181793 protein SPA1-RELATED; Provisional 99.74
KOG0296399 consensus Angio-associated migratory cell protein 99.73
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.73
KOG0300481 consensus WD40 repeat-containing protein [Function 99.73
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.73
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.73
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.72
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.72
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.72
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.71
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.71
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.71
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.7
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.69
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.69
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.68
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.68
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.68
KOG0270463 consensus WD40 repeat-containing protein [Function 99.68
KOG0270463 consensus WD40 repeat-containing protein [Function 99.68
KOG0302440 consensus Ribosome Assembly protein [General funct 99.68
KOG0641350 consensus WD40 repeat protein [General function pr 99.67
KOG4283397 consensus Transcription-coupled repair protein CSA 99.67
KOG0301745 consensus Phospholipase A2-activating protein (con 99.67
KOG0289506 consensus mRNA splicing factor [General function p 99.67
KOG0302440 consensus Ribosome Assembly protein [General funct 99.67
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.67
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.66
KOG0772641 consensus Uncharacterized conserved protein, conta 99.66
KOG0300481 consensus WD40 repeat-containing protein [Function 99.66
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.66
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.66
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.65
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 99.65
KOG4328498 consensus WD40 protein [Function unknown] 99.65
KOG0301745 consensus Phospholipase A2-activating protein (con 99.65
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.65
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.64
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.64
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.64
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.63
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.63
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.63
KOG2055514 consensus WD40 repeat protein [General function pr 99.63
KOG0294362 consensus WD40 repeat-containing protein [Function 99.61
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.61
KOG0646476 consensus WD40 repeat protein [General function pr 99.61
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.6
KOG1273405 consensus WD40 repeat protein [General function pr 99.6
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.6
KOG0267825 consensus Microtubule severing protein katanin p80 99.6
KOG0269839 consensus WD40 repeat-containing protein [Function 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.57
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 99.57
KOG0646476 consensus WD40 repeat protein [General function pr 99.57
KOG0267 825 consensus Microtubule severing protein katanin p80 99.57
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.56
KOG1274 933 consensus WD40 repeat protein [General function pr 99.55
KOG0303472 consensus Actin-binding protein Coronin, contains 99.55
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.54
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.53
KOG2048691 consensus WD40 repeat protein [General function pr 99.53
KOG2096420 consensus WD40 repeat protein [General function pr 99.53
KOG1274 933 consensus WD40 repeat protein [General function pr 99.53
KOG1539910 consensus WD repeat protein [General function pred 99.52
KOG0641350 consensus WD40 repeat protein [General function pr 99.52
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.51
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.51
KOG0639705 consensus Transducin-like enhancer of split protei 99.51
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.5
KOG1188376 consensus WD40 repeat protein [General function pr 99.5
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.5
KOG0293519 consensus WD40 repeat-containing protein [Function 99.49
KOG2096420 consensus WD40 repeat protein [General function pr 99.48
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.48
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.48
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.47
KOG2048691 consensus WD40 repeat protein [General function pr 99.47
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.47
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.47
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.47
KOG2055514 consensus WD40 repeat protein [General function pr 99.46
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.45
KOG0303472 consensus Actin-binding protein Coronin, contains 99.44
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.44
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.43
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.41
KOG0643327 consensus Translation initiation factor 3, subunit 99.41
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 99.4
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.39
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.38
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.37
KOG0771398 consensus Prolactin regulatory element-binding pro 99.36
KOG4283397 consensus Transcription-coupled repair protein CSA 99.35
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.34
KOG0639705 consensus Transducin-like enhancer of split protei 99.33
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 99.33
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.32
KOG4328498 consensus WD40 protein [Function unknown] 99.3
KOG0649325 consensus WD40 repeat protein [General function pr 99.29
KOG2106626 consensus Uncharacterized conserved protein, conta 99.29
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.29
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.28
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.27
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.27
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.23
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.22
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.22
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.22
KOG1273405 consensus WD40 repeat protein [General function pr 99.2
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.18
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.18
KOG1539910 consensus WD repeat protein [General function pred 99.18
KOG1310758 consensus WD40 repeat protein [General function pr 99.18
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.15
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.14
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.14
KOG2106626 consensus Uncharacterized conserved protein, conta 99.13
PRK01742429 tolB translocation protein TolB; Provisional 99.13
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.13
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.1
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.1
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.09
KOG1963792 consensus WD40 repeat protein [General function pr 99.08
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.06
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.06
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.05
KOG4227609 consensus WD40 repeat protein [General function pr 99.04
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.04
KOG1188376 consensus WD40 repeat protein [General function pr 99.02
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.0
PRK01742429 tolB translocation protein TolB; Provisional 99.0
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.99
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.98
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.97
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.97
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.97
KOG1310758 consensus WD40 repeat protein [General function pr 98.95
KOG2110391 consensus Uncharacterized conserved protein, conta 98.95
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.94
COG2319466 FOG: WD40 repeat [General function prediction only 98.93
PRK05137435 tolB translocation protein TolB; Provisional 98.93
KOG2321703 consensus WD40 repeat protein [General function pr 98.93
KOG2139445 consensus WD40 repeat protein [General function pr 98.92
PRK03629429 tolB translocation protein TolB; Provisional 98.92
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.92
PRK05137435 tolB translocation protein TolB; Provisional 98.92
KOG2111346 consensus Uncharacterized conserved protein, conta 98.92
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.92
PRK04922433 tolB translocation protein TolB; Provisional 98.91
KOG2321703 consensus WD40 repeat protein [General function pr 98.91
PRK11028330 6-phosphogluconolactonase; Provisional 98.9
COG2319466 FOG: WD40 repeat [General function prediction only 98.9
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.9
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.89
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.89
PRK02889427 tolB translocation protein TolB; Provisional 98.89
PRK02889427 tolB translocation protein TolB; Provisional 98.87
KOG2110391 consensus Uncharacterized conserved protein, conta 98.85
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.84
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.8
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.79
KOG2139445 consensus WD40 repeat protein [General function pr 98.79
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.79
KOG2111346 consensus Uncharacterized conserved protein, conta 98.77
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.75
KOG4227609 consensus WD40 repeat protein [General function pr 98.73
KOG3621726 consensus WD40 repeat-containing protein [General 98.72
PRK11028330 6-phosphogluconolactonase; Provisional 98.72
PRK04922433 tolB translocation protein TolB; Provisional 98.69
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.66
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.66
PRK03629429 tolB translocation protein TolB; Provisional 98.66
KOG1963792 consensus WD40 repeat protein [General function pr 98.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.65
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.65
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.63
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.62
PRK00178430 tolB translocation protein TolB; Provisional 98.6
KOG4547541 consensus WD40 repeat-containing protein [General 98.57
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.55
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.55
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.52
PRK01029428 tolB translocation protein TolB; Provisional 98.51
KOG4547541 consensus WD40 repeat-containing protein [General 98.51
PRK00178430 tolB translocation protein TolB; Provisional 98.49
PRK04792448 tolB translocation protein TolB; Provisional 98.49
KOG0771398 consensus Prolactin regulatory element-binding pro 98.48
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.44
KOG1334559 consensus WD40 repeat protein [General function pr 98.42
PRK04792448 tolB translocation protein TolB; Provisional 98.42
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.41
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.4
KOG1409404 consensus Uncharacterized conserved protein, conta 98.39
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.36
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.35
KOG1334559 consensus WD40 repeat protein [General function pr 98.35
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.35
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.33
KOG1409404 consensus Uncharacterized conserved protein, conta 98.29
PF05131147 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPr 98.25
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.24
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.23
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.18
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.17
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.16
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.15
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.09
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.09
KOG2695425 consensus WD40 repeat protein [General function pr 98.07
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.04
PRK04043419 tolB translocation protein TolB; Provisional 98.03
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.03
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.99
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.97
smart00299140 CLH Clathrin heavy chain repeat homology. 97.97
COG4946668 Uncharacterized protein related to the periplasmic 97.95
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.93
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 97.92
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.87
PRK01029428 tolB translocation protein TolB; Provisional 97.86
KOG2695425 consensus WD40 repeat protein [General function pr 97.82
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.8
KOG2315566 consensus Predicted translation initiation factor 97.8
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.79
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.77
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.77
PRK04043419 tolB translocation protein TolB; Provisional 97.76
COG4946668 Uncharacterized protein related to the periplasmic 97.76
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.76
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 97.73
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.61
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.61
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.61
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.6
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.59
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.58
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.56
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.54
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.52
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.49
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 97.47
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.46
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.46
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.45
KOG19121062 consensus WD40 repeat protein [General function pr 97.44
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.43
KOG2315566 consensus Predicted translation initiation factor 97.41
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.4
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.4
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.38
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.37
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.33
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.29
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.28
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.26
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 97.24
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.23
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.2
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.2
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.17
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.14
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.13
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.01
KOG2314698 consensus Translation initiation factor 3, subunit 96.99
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.99
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.98
PLN03077 857 Protein ECB2; Provisional 96.92
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.83
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.8
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.79
PLN03218 1060 maturation of RBCL 1; Provisional 96.76
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.73
PLN03077 857 Protein ECB2; Provisional 96.7
KOG2314698 consensus Translation initiation factor 3, subunit 96.65
KOG2395644 consensus Protein involved in vacuole import and d 96.65
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 96.64
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.64
KOG1008783 consensus Uncharacterized conserved protein, conta 96.57
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.52
KOG2076 895 consensus RNA polymerase III transcription factor 96.48
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.46
KOG2395644 consensus Protein involved in vacuole import and d 96.45
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.39
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.38
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.37
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.36
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.34
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.32
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.27
PLN03218 1060 maturation of RBCL 1; Provisional 96.23
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.19
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.16
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.13
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 96.1
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.0
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.92
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.91
KOG3621726 consensus WD40 repeat-containing protein [General 95.82
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.63
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 95.57
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 95.46
KOG2376 652 consensus Signal recognition particle, subunit Srp 95.3
COG5167776 VID27 Protein involved in vacuole import and degra 95.09
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 95.04
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.01
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.96
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.85
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.84
PRK13616591 lipoprotein LpqB; Provisional 94.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.71
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.69
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.59
PRK11788389 tetratricopeptide repeat protein; Provisional 94.39
PHA02713557 hypothetical protein; Provisional 94.31
KOG1008783 consensus Uncharacterized conserved protein, conta 94.1
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 94.09
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 94.03
smart0032040 WD40 WD40 repeats. Note that these repeats are per 93.87
PRK02888635 nitrous-oxide reductase; Validated 93.77
KOG3616 1636 consensus Selective LIM binding factor [Transcript 93.74
COG5167776 VID27 Protein involved in vacuole import and degra 93.56
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 93.41
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.39
PF12816196 Vps8: Golgi CORVET complex core vacuolar protein 8 93.29
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.28
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 93.25
PRK13616591 lipoprotein LpqB; Provisional 93.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.09
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.9
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.89
PF15390671 DUF4613: Domain of unknown function (DUF4613) 92.89
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 92.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 92.58
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.48
KOG2076 895 consensus RNA polymerase III transcription factor 92.41
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 92.27
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.19
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 91.93
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 91.87
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.85
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 91.74
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 91.69
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 91.67
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.6
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 91.44
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 91.38
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.02
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 91.0
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.95
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 90.86
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.83
KOG2444238 consensus WD40 repeat protein [General function pr 90.64
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 90.54
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.35
PHA03098534 kelch-like protein; Provisional 90.32
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.27
PHA02790480 Kelch-like protein; Provisional 90.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 89.99
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 89.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 89.8
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 89.79
KOG2377657 consensus Uncharacterized conserved protein [Funct 89.67
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 89.5
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.5
PRK13684334 Ycf48-like protein; Provisional 89.37
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 89.08
PRK02888635 nitrous-oxide reductase; Validated 88.86
KOG2444238 consensus WD40 repeat protein [General function pr 88.63
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 88.3
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 87.89
PLN00033398 photosystem II stability/assembly factor; Provisio 87.66
PF15390671 DUF4613: Domain of unknown function (DUF4613) 87.62
PRK11788389 tetratricopeptide repeat protein; Provisional 87.55
PRK14574 822 hmsH outer membrane protein; Provisional 87.53
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 87.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 87.45
KOG2247615 consensus WD40 repeat-containing protein [General 86.67
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 86.59
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.53
PHA02713557 hypothetical protein; Provisional 86.43
PRK11189296 lipoprotein NlpI; Provisional 86.28
PF1337173 TPR_9: Tetratricopeptide repeat 86.04
COG3391381 Uncharacterized conserved protein [Function unknow 85.77
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 85.35
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 85.16
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 85.05
COG3391381 Uncharacterized conserved protein [Function unknow 84.95
KOG18971096 consensus Damage-specific DNA binding complex, sub 84.42
PF12816196 Vps8: Golgi CORVET complex core vacuolar protein 8 83.58
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 82.64
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.32
KOG2005 878 consensus 26S proteasome regulatory complex, subun 82.14
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 82.05
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 81.62
PF13512142 TPR_18: Tetratricopeptide repeat 81.54
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 81.44
COG3204316 Uncharacterized protein conserved in bacteria [Fun 81.1
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 80.29
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-108  Score=854.91  Aligned_cols=659  Identities=52%  Similarity=0.900  Sum_probs=615.3

Q ss_pred             CcCCCccceeccCCCccccCCCceEEEEecCCEEEEEeCCCeEEEEecCCCeeEEEcCCccceeEEEEcCCCCEEEEEeC
Q 004914           34 EEEPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSD  113 (724)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~~~~i~~~s~~~~~la~g~~dg~I~i~d~~~~~~~~~~~h~~~V~~l~~s~~g~~l~s~~~  113 (724)
                      +++|.++|.|+++.+..++..+.++|+..++++++.|+.+|.|++++.+|.. .+...|+..      +.+|.+++|||.
T Consensus        19 deePklkY~Ri~n~~~~~~~~D~is~~av~~~~~~~GtH~g~v~~~~~~~~~-~~~~~~s~~------~~~Gey~asCS~   91 (846)
T KOG2066|consen   19 DEEPKLKYERISNLVKNFLQNDAISCCAVHDKFFALGTHRGAVYLTTCQGNP-KTNFDHSSS------ILEGEYVASCSD   91 (846)
T ss_pred             ccCccceehhhhcccHHHHhhhHHHHHHhhcceeeeccccceEEEEecCCcc-ccccccccc------ccCCceEEEecC
Confidence            7899999999999999999999999999999999999999999999999887 555566654      778999999999


Q ss_pred             CCCEEEEeccCCc-eEEEeCCCCeeEEEeCCCCCCCCCCEEEEecCCCeEEEEecccCCccceE-eccCCCCeEEEEEeC
Q 004914          114 DGSVVINSLFTDE-KMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQV-LHSGEGPVHVVKWRT  191 (724)
Q Consensus       114 Dg~v~iwd~~~~~-~~~~~~~~~v~~v~~~p~~~~~~~~~l~~g~~dg~v~l~~~~~~~~~~~~-l~~~~~~V~~l~~~~  191 (724)
                      ||+|.|..+.+.+ ..++.+++|+.+|+++|+|++++++.|++||..| +.++.++|.|++..+ ++...|+|.++.|.|
T Consensus        92 DGkv~I~sl~~~~~~~~~df~rpiksial~Pd~~~~~sk~fv~GG~ag-lvL~er~wlgnk~~v~l~~~eG~I~~i~W~g  170 (846)
T KOG2066|consen   92 DGKVVIGSLFTDDEITQYDFKRPIKSIALHPDFSRQQSKQFVSGGMAG-LVLSERNWLGNKDSVVLSEGEGPIHSIKWRG  170 (846)
T ss_pred             CCcEEEeeccCCccceeEecCCcceeEEeccchhhhhhhheeecCcce-EEEehhhhhcCccceeeecCccceEEEEecC
Confidence            9999999998855 5568999999999999999999899999999999 999999999977665 778899999999999


Q ss_pred             CEEEEEcCCcEEEEEcCCCceEEEecCCCCCCCCCCCCCceeecCCCeEEEEeCCeEEEEEEeeCCCCCCCCccccCCCe
Q 004914          192 SLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMN  271 (724)
Q Consensus       192 ~~la~~~d~~i~i~d~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~~l~~g~d~~i~vw~~~~~~~~~~~~~~~~~~~~  271 (724)
                      ++|||++|-+|++||+.+++.+..++.+...++++.++|.+.|.+...|++||+++|+|..++.+.+.. ..+++-.+..
T Consensus       171 ~lIAWand~Gv~vyd~~~~~~l~~i~~p~~~~R~e~fpphl~W~~~~~LVIGW~d~v~i~~I~~~~s~~-a~~~~~~~~~  249 (846)
T KOG2066|consen  171 NLIAWANDDGVKVYDTPTRQRLTNIPPPSQSVRPELFPPHLHWQDEDRLVIGWGDSVKICSIKKRSSSE-ARSFRLPSLK  249 (846)
T ss_pred             cEEEEecCCCcEEEeccccceeeccCCCCCCCCcccCCCceEecCCCeEEEecCCeEEEEEEecccccc-cccccCCccc
Confidence            999999999999999999999999999999999999999999999999999999999999999554332 2222223455


Q ss_pred             EEEEEEEeeeceEEEeeeecCCceEEEEeecCCCCCcccccCCCCcccCCCCCCeEEEeccCCcccccCcccCCcccccc
Q 004914          272 QVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYK  351 (724)
Q Consensus       272 ~~~~~~~~~~~~~i~gi~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~iv~~~~~~~~~~~~~~~~~~~~~  351 (724)
                      .++..+.|++++.|+|++++++++++|+|.+..+  +...++..|..++...+|++|+++..++|+++|++.+++|+++.
T Consensus       250 ~V~~~s~f~~s~~isGla~lg~qLv~L~f~~~~~--~~e~~s~~~~~r~~~~~peir~~~~~~~Ei~~Dal~~~~~e~~~  327 (846)
T KOG2066|consen  250 KVEIVSHFETSFYISGLAPLGDQLVVLGFDKDIS--EGEFTSARPSSRAKGNRPEIRIVSLNNDEICSDALIVRGFEELS  327 (846)
T ss_pred             eeeeEEEeeeeeeeeccccccceeEEEeeecccc--cccccccchhhhccCCCceEEeccccchhhhhhhhhhcchhhcC
Confidence            8999999999999999999999999999987544  34456677766678889999999999999999999999999999


Q ss_pred             ccCcccccccCCCCCCCCCcccCCCCCEEEEECCCcEEEEeeCCchhhHHHHHhcccHHHHHHHHHhcCCCc--hhHhHH
Q 004914          352 AKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRS--ELLDEV  429 (724)
Q Consensus       352 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~s~~~i~~~~~~~~~d~i~~ll~~~~~~~Al~~~~~~~~~~--~~~~~i  429 (724)
                      ++||||...|             +..+.|||+||+|++++++++.+|||+||+++++|++||.+++.+....  .+..+|
T Consensus       328 ~~DY~L~~~~-------------~~~~~yyIvspkDiV~a~~~~~~Dhi~Wll~~k~yeeAl~~~k~~~~~~~~~~i~kv  394 (846)
T KOG2066|consen  328 INDYHLGGHP-------------KTEPLYYIVSPKDIVVAKERDQEDHIDWLLEKKKYEEALDAAKASIGNEERFVIKKV  394 (846)
T ss_pred             CccccccCCC-------------CCCceEEEecCCceEEEeecCcchhHHHHHHhhHHHHHHHHHHhccCCccccchHHH
Confidence            9999999976             5789999999999999999999999999999999999999999887733  357899


Q ss_pred             HHHHHHHHhccchHHHHHhhhhhhhccChhhHHHHHHHHhhcCCCCcccccCcCCCCCCCHHHHHHHHHHHHcCCccHHH
Q 004914          430 GSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKY  509 (724)
Q Consensus       430 ~~~~~~~l~~~~~~~~Aa~~~~~~~~~~~~~we~~i~~F~~~~~l~~L~~~l~~~~~~l~~~~~~~~L~~~l~~~~~~~~  509 (724)
                      |+.|++||+..|+|++||..|++++|++..+||.|+++|...+++..+.||+|+..++|++.+|+++|..|+.  ++...
T Consensus       395 ~~~yI~HLl~~~~y~~Aas~~p~m~gn~~~eWe~~V~~f~e~~~l~~Ia~~lPt~~~rL~p~vYemvLve~L~--~~~~~  472 (846)
T KOG2066|consen  395 GKTYIDHLLFEGKYDEAASLCPKMLGNNAAEWELWVFKFAELDQLTDIAPYLPTGPPRLKPLVYEMVLVEFLA--SDVKG  472 (846)
T ss_pred             HHHHHHHHHhcchHHHHHhhhHHHhcchHHHHHHHHHHhccccccchhhccCCCCCcccCchHHHHHHHHHHH--HHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999  48999


Q ss_pred             HHHHhhcCCCCccChHHHHHHHhhhhccCcchHHHHHHHHHHHHhcCCHHHHHHHHHHcCCchhhHHHHhcCChHHHHHH
Q 004914          510 LLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREK  589 (724)
Q Consensus       510 ~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ly~~~~~~~~al~~~~~~~~~~~~~~i~~~~l~~~~~~~  589 (724)
                      |.+.++.||..+|++.+++++++.++....++..+.+.|++||...++|.+|+++|+++++.++|++|.+|++++.+.+.
T Consensus       473 F~e~i~~Wp~~Lys~l~iisa~~~q~~q~Se~~~L~e~La~LYl~d~~Y~~Al~~ylklk~~~vf~lI~k~nL~d~i~~~  552 (846)
T KOG2066|consen  473 FLELIKEWPGHLYSVLTIISATEPQIKQNSESTALLEVLAHLYLYDNKYEKALPIYLKLQDKDVFDLIKKHNLFDQIKDQ  552 (846)
T ss_pred             HHHHHHhCChhhhhhhHHHhhcchHHHhhccchhHHHHHHHHHHHccChHHHHHHHHhccChHHHHHHHHHhhHHHHHHH
Confidence            99999999999999999999999999988888899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHccChhHHHHHhhhcCCCCChHHHHHHHhcccccCCchhHHHHHHHHHHhcCCCCChhhHHHHHHHHHhcchhhhH
Q 004914          590 VVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLL  669 (724)
Q Consensus       590 ~~~L~~~~~~~~~~ll~~~~~~~~~~~vi~~l~~~~~~~~~~~~l~~yL~~l~~~~~~~~~~~~~~lv~Ly~~~~~~~ll  669 (724)
                      +..||.++.+.++++|+++.+.++|..|+++++      +.|.+|+.||..++.++......||+.+|+|||+|++.+||
T Consensus       553 Iv~Lmll~skka~~lLldn~d~ip~a~Vveql~------~~P~~l~~YL~kl~~rd~~~~~~y~dk~I~LYAEyDrk~LL  626 (846)
T KOG2066|consen  553 IVLLMLLDSKKAIDLLLDNRDSISPSEVVEQLE------DNPKLLYCYLHKLFKRDHFMGSEYHDKQIELYAEYDRKKLL  626 (846)
T ss_pred             HHHHHccchhhHHHHHhhccccCCHHHHHHHHh------cChHHHHHHHHHHhhcCccccchhhhHHHHHHHHHhHhhhh
Confidence            999999999999999999999999999999999      67899999999999999888999999999999999999999


Q ss_pred             HHhhhcCCCCHHHHHHHHhcCCCchhHHHHHhccCChHHHHHHHHHHhCCccccC
Q 004914          670 PFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEVF  724 (724)
Q Consensus       670 ~fL~~~~~y~~~~al~~c~~~~~~~e~v~Ll~k~g~~~~Al~l~~~~l~d~~~Ai  724 (724)
                      +||+++.+|++++|+++|.+.++++|.||||||||++++||.+||++|+|+++||
T Consensus       627 PFLr~s~~Y~lekA~eiC~q~~~~~E~VYlLgrmGn~k~AL~lII~el~die~AI  681 (846)
T KOG2066|consen  627 PFLRKSQNYNLEKALEICSQKNFYEELVYLLGRMGNAKEALKLIINELRDIEKAI  681 (846)
T ss_pred             HHHHhcCCCCHHHHHHHHHhhCcHHHHHHHHHhhcchHHHHHHHHHHhhCHHHHH
Confidence            9999999999999999999999999999999999999999999999999999997

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF05131 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPro: IPR007810 This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query724
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.92
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.92
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.91
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.91
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.9
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.9
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.9
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.9
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.9
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.9
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.9
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.9
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.9
2pm7_B297 Protein transport protein SEC13, protein transport 99.9
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.89
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.89
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.89
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.88
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.88
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.88
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.88
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.88
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.88
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.87
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.87
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.87
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.87
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.87
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.87
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.87
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.87
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.86
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.86
3jrp_A379 Fusion protein of protein transport protein SEC13 99.86
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.86
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.86
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.86
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.86
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.86
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.86
2pm7_B297 Protein transport protein SEC13, protein transport 99.85
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.85
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.85
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.85
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.85
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.85
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.84
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.84
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.84
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.84
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.84
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.84
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.84
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.84
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.83
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.83
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.83
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.83
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.83
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.83
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.83
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.83
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.82
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.82
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.82
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.82
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.82
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.82
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.82
3jrp_A379 Fusion protein of protein transport protein SEC13 99.82
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.82
3jro_A753 Fusion protein of protein transport protein SEC13 99.81
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.81
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.81
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.81
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.81
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.81
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.81
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.81
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.81
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.81
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.81
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.8
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.8
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.8
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.8
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.8
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.8
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.8
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.8
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.8
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.79
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.79
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.79
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.79
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.79
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.79
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.79
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.79
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.79
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.78
3jro_A753 Fusion protein of protein transport protein SEC13 99.78
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.77
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.77
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.76
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.76
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.75
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.75
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.74
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.72
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.71
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.71
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.71
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.7
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.67
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.65
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.63
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.63
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.63
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.62
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.61
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.59
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.59
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 99.58
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.54
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.5
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.43
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.42
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.42
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.42
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.4
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.4
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.34
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.34
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.33
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.33
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.31
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.3
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.3
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.3
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.27
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.26
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.25
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.23
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.22
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.22
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.21
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.2
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.19
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.17
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.17
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.14
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.12
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.12
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.12
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.11
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.11
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.09
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.06
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.03
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.02
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.99
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.98
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.97
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.96
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.95
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.94
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.94
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.94
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.89
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.89
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.86
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.84
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.82
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.8
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.8
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.78
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.76
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.73
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.73
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.73
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 98.68
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.67
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.66
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.66
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.64
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.63
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.63
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.54
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.54
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.52
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.49
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.47
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.44
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.42
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.39
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.36
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.31
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.26
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.23
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.2
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.19
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.18
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.16
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 98.16
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.16
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.15
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.15
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.12
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.12
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.11
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.11
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.09
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.01
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.92
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.8
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.75
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.71
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.7
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.69
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.68
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.67
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.67
2qe8_A343 Uncharacterized protein; structural genomics, join 97.61
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.53
2qe8_A343 Uncharacterized protein; structural genomics, join 97.52
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.48
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.48
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.45
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.43
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.4
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.4
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.37
2ece_A462 462AA long hypothetical selenium-binding protein; 97.3
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.26
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.26
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.23
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.22
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.22
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.16
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.16
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.11
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.05
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.98
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.98
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 96.97
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.93
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.87
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.85
3v65_B386 Low-density lipoprotein receptor-related protein; 96.85
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.79
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.78
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 96.77
3v65_B386 Low-density lipoprotein receptor-related protein; 96.74
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.73
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.66
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.53
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.52
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.48
2ece_A462 462AA long hypothetical selenium-binding protein; 96.43
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.39
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.35
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.34
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.28
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.27
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.21
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 96.1
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.0
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.98
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 95.89
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.83
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 95.6
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 95.58
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.57
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.57
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.54
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 95.5
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.48
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 95.47
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.43
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.39
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 95.36
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 95.31
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.3
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.19
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.14
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.04
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.0
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 94.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.76
3u4t_A272 TPR repeat-containing protein; structural genomics 94.68
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 94.64
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 94.47
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.2
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.14
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.01
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 94.0
3kya_A496 Putative phosphatase; structural genomics, joint c 93.85
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.63
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 93.05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.96
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.93
2gw1_A 514 Mitochondrial precursor proteins import receptor; 92.69
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.42
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 92.3
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 92.22
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 92.17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.95
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 91.88
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.66
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 91.64
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 91.4
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.34
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 90.82
2gw1_A 514 Mitochondrial precursor proteins import receptor; 90.26
3kya_A496 Putative phosphatase; structural genomics, joint c 90.18
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 89.79
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 89.62
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 89.34
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.31
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 89.26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 89.22
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 89.18
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 88.98
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 88.97
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 88.73
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 88.49
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 88.45
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 88.42
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.04
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 88.03
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 87.87
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 87.78
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 87.76
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 87.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 87.42
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 87.41
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 87.37
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 87.16
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 86.88
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 86.55
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 86.24
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 86.12
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 85.82
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 85.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 85.44
2qx5_A 661 Nucleoporin NIC96; mRNA transport, nuclear pore co 85.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 85.41
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 85.16
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 84.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 84.07
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 83.43
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 83.3
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 82.91
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 82.82
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 82.64
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 82.51
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 82.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 82.42
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 82.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 81.87
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 81.44
3ott_A758 Two-component system sensor histidine kinase; beta 80.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 80.52
4i17_A228 Hypothetical protein; TPR repeats protein, structu 80.44
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 80.34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 80.15
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=99.92  E-value=7.9e-23  Score=220.88  Aligned_cols=190  Identities=21%  Similarity=0.323  Sum_probs=162.3

Q ss_pred             CceEE--EEecCCEEEEEeCCCeEEEEec-CCCeeEEEcCCccceeEEEEcCCCCEEEEEeCCCCEEEEeccCCce-EEE
Q 004914           55 DAASC--VAVAERMIALGTHAGTVHILDF-LGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEK-MKF  130 (724)
Q Consensus        55 ~~i~~--~s~~~~~la~g~~dg~I~i~d~-~~~~~~~~~~h~~~V~~l~~s~~g~~l~s~~~Dg~v~iwd~~~~~~-~~~  130 (724)
                      +.|+|  |+|+++++++|+.||+|++||. ++.....+.+|.+.|++++|+|+|++|++|+.||+|++||+.++.+ ..+
T Consensus       109 ~~V~~~~~~p~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~~l~sgs~D~~i~iwd~~~~~~~~~~  188 (410)
T 1vyh_C          109 SPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTM  188 (410)
T ss_dssp             SCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETTSSCEEECC
T ss_pred             CcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCCEEEEEeCCCeEEEEeCCCCceeEEE
Confidence            44555  7778999999999999999999 6677789999999999999999999999999999999999998665 457


Q ss_pred             eCCC-CeeEEEeCCCCCCCCCCEEEEecCCCeEEEEecccCCccceEeccCCCCeEEEEEe--CCEEEEE-cCCcEEEEE
Q 004914          131 DYHR-PMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWR--TSLIAWA-NDAGVKVYD  206 (724)
Q Consensus       131 ~~~~-~v~~v~~~p~~~~~~~~~l~~g~~dg~v~l~~~~~~~~~~~~l~~~~~~V~~l~~~--~~~la~~-~d~~i~i~d  206 (724)
                      ..|. .|.+++|+|+     +..+++|+.||.|++|+.. .+.....+.+|...|.++.|+  |.+++++ .|+.|++||
T Consensus       189 ~~h~~~V~~v~~~p~-----~~~l~s~s~D~~i~~wd~~-~~~~~~~~~~h~~~v~~~~~~~~g~~l~s~s~D~~v~vwd  262 (410)
T 1vyh_C          189 HGHDHNVSSVSIMPN-----GDHIVSASRDKTIKMWEVQ-TGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWV  262 (410)
T ss_dssp             CCCSSCEEEEEECSS-----SSEEEEEETTSEEEEEETT-TCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEEEE
T ss_pred             cCCCCCEEEEEEeCC-----CCEEEEEeCCCeEEEEECC-CCcEEEEEeCCCccEEEEEECCCCCEEEEEcCCCeEEEEE
Confidence            7888 9999999999     8999999999999999986 566777888899999999998  6777776 799999999


Q ss_pred             cCCCceEEEecCCCCCCCCCCCCCceeecC---------------------CCeEEEE-eCCeEEEEEEeeC
Q 004914          207 AANDQRITFIERPRGSPRPELLLPHLVWQD---------------------DTLLVIG-WGTYIKIASIKTN  256 (724)
Q Consensus       207 ~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~---------------------~~~l~~g-~d~~i~vw~~~~~  256 (724)
                      +.+++....+..+.      ..+.++.|..                     +..+++| .|+.|++||++++
T Consensus       263 ~~~~~~~~~~~~h~------~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~sgs~D~~i~iwd~~~~  328 (410)
T 1vyh_C          263 VATKECKAELREHR------HVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG  328 (410)
T ss_dssp             TTTCCEEEEECCCS------SCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTT
T ss_pred             CCCCceeeEecCCC------ceEEEEEEcCcccccchhhhccccccccCCCCCEEEEEeCCCeEEEEECCCC
Confidence            99998887765443      2355666632                     5678888 8999999998764
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 724
d1b89a_ 336 a.118.1.3 (A:) Clathrin heavy chain proximal leg s 1e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.001
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.004
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.003
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.003
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.003
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 70.3 bits (172), Expect = 1e-13
 Identities = 29/184 (15%), Positives = 60/184 (32%), Gaps = 7/184 (3%)

Query: 542 DALKEALAELYVIDGHYEKAFSLYADLMK-PYIFDFIENHNLHDAIREKVVQLMLLDCKR 600
           + + +A   LY    ++ +  S    L +     D     N     +E  V    +D K 
Sbjct: 27  EKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKE--VCFACVDGKE 84

Query: 601 AVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFL-HLYLHALFEVNPHAGKDFHDMQVEL 659
                +    ++  ++ + +L+N          L  +   AL     H G         L
Sbjct: 85  FRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMG--MFTELAIL 142

Query: 660 YADYDLKMLLPFL-RSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLG 718
           Y+ +  + +   L        + K      +  L  E VF+  +     +A+  ++N   
Sbjct: 143 YSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPT 202

Query: 719 DIEE 722
           D  +
Sbjct: 203 DAWK 206
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query724
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.87
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.87
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.85
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.85
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.85
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.84
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.83
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.83
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.83
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.82
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.82
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.81
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.81
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.8
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.8
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.71
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.71
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.69
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.69
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.68
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.67
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.65
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.64
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.63
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.58
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.57
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.5
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.48
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.32
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.25
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.24
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.24
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.21
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.18
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.16
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.16
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.15
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.99
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.87
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.72
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.63
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.55
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.37
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.14
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.09
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.94
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.93
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.91
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.88
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.77
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.71
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.56
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.46
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.4
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.34
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.34
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.24
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.97
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.95
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.77
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.7
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.65
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.47
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.01
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.9
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.82
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.18
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.45
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 91.4
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 90.53
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.3
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 90.09
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 86.58
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 86.56
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 83.07
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 82.69
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 82.5
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=99.90  E-value=3.7e-22  Score=204.52  Aligned_cols=196  Identities=17%  Similarity=0.209  Sum_probs=160.9

Q ss_pred             ceEE--EEecCCEEEEEeCCCeEEEEecCC-Ce--eEEEcCCccceeEEEEcCCCCEEEEEeCC--CCEEEEeccCCce-
Q 004914           56 AASC--VAVAERMIALGTHAGTVHILDFLG-NQ--VKEFPAHTAAVNDLSFDVDGEYVGSCSDD--GSVVINSLFTDEK-  127 (724)
Q Consensus        56 ~i~~--~s~~~~~la~g~~dg~I~i~d~~~-~~--~~~~~~h~~~V~~l~~s~~g~~l~s~~~D--g~v~iwd~~~~~~-  127 (724)
                      .|+|  |+|+|++||+|+.||+|++||... ..  ...+..|.++|.+++|+|+++++++++.+  ..+++|++.+++. 
T Consensus        60 ~v~~~~~sp~g~~latg~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~~v~~~~~~~~~  139 (311)
T d1nr0a1          60 QTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSN  139 (311)
T ss_dssp             CEEEEEECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCBC
T ss_pred             CEEEEEEeCCCCeEeccccCceEeeeeeeccccccccccccccCcccccccccccccccccccccccccccccccccccc
Confidence            3444  788999999999999999999943 32  35678899999999999999999999864  5699999998654 


Q ss_pred             EEEeCCC-CeeEEEeCCCCCCCCCC-EEEEecCCCeEEEEecccCCccceEeccCCCCeEEEEEe--CCEEEEE-cCCcE
Q 004914          128 MKFDYHR-PMKAISLDPDYTRKMSR-RFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWR--TSLIAWA-NDAGV  202 (724)
Q Consensus       128 ~~~~~~~-~v~~v~~~p~~~~~~~~-~l~~g~~dg~v~l~~~~~~~~~~~~l~~~~~~V~~l~~~--~~~la~~-~d~~i  202 (724)
                      ..+..|. .|++++|+|+     +. .+++|+.||.|++|+.. .+.....+..|..+|+++.|+  +++++++ .|+.+
T Consensus       140 ~~l~~h~~~v~~v~~~~~-----~~~~l~sgs~d~~i~i~d~~-~~~~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v  213 (311)
T d1nr0a1         140 GNLTGQARAMNSVDFKPS-----RPFRIISGSDDNTVAIFEGP-PFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTI  213 (311)
T ss_dssp             BCCCCCSSCEEEEEECSS-----SSCEEEEEETTSCEEEEETT-TBEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCE
T ss_pred             cccccccccccccccccc-----ceeeeccccccccccccccc-ccccccccccccccccccccCccccccccccccccc
Confidence            4577788 9999999998     45 58899999999999875 456666777889999999998  6777766 79999


Q ss_pred             EEEEcCCCceEEEecCCCC-CCCCCCCCCceee-cCCCeEEEE-eCCeEEEEEEeeCC
Q 004914          203 KVYDAANDQRITFIERPRG-SPRPELLLPHLVW-QDDTLLVIG-WGTYIKIASIKTNQ  257 (724)
Q Consensus       203 ~i~d~~~~~~~~~i~~~~~-~~~~~~~~~~l~~-~~~~~l~~g-~d~~i~vw~~~~~~  257 (724)
                      ++||..++.....+..... ...|...+.+++| ++++.|++| .|+.|++||++++.
T Consensus       214 ~~~d~~~~~~~~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~tgs~Dg~v~iwd~~t~~  271 (311)
T d1nr0a1         214 VLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATLK  271 (311)
T ss_dssp             EEEETTTCCEEEECBCTTSSSCSSSSCEEEEEECTTSSEEEEEETTSEEEEEETTTTE
T ss_pred             cccccccccccccccccccccccccccccccccCCCCCEEEEEeCCCeEEEEECCCCc
Confidence            9999999988877655432 3346667888999 678889988 88999999987543
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure