Citrus Sinensis ID: 005057

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710------

MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNSSSTSGGNGNTSSVNSEDSEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVNGVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAGFRASSKQGHSQPQACVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGVDSVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARLLHELDELEDSSEKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS

ccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHcccccHHccccccccccccccccHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccEEEEcccccccccHHHHHHccccccccccccccccccEEEEcccc

ccccEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccccEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHEEEcccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccccccHHHHHHHHHHHcccccccccccccEEEEEccccEEEEEEEcccEEEHHHHHHHHHccccccccccccccEEEEEEEEccc

mgctvrekhirttrrtrsvkpefdpccyldkasiSKSILEsglkplsyhlglndpshnsnpnaddhgwgycTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKnghcyggmDVLTNILHNSLAylnssstsggngntssvnsedsepvfndLRQLEEYSLAGMVCLLQQvrphlskgdAMWCLLMSDLHvgrassieipgtnvcggtisnnvdsvsnggvngvvapalcrfhggwgfgsggnaefsvngffsysaemtlprdiecpkrfnlspsMKSLLKRNVAMFAAGFrasskqghsqpqaCVSVMAGRDASLVASGAEvtvencedsknlkdpngvdsVLSKMRdlnidenletitddqKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKASAesneqnhqsntlppgklerakpQGETIARLLHELdeledsseketncdrdciiclkdevsivflpcahqvlcascsdnygkkgkatcpccrvpieqrirvfgass

mgctvrekhirttrrtrsvkpefdpcCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNSSSTSGGNGNTSSVNSEDSEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVNGVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAGFRasskqghsqPQACVSVMAGRDASLVASGAEVtvencedsknlkdpngvdsVLSKMRDLNIDENletitddqkdEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEReetqrlkkgkqtledttMKRLSEMENAlrkasgqvdranAAVRRLETENAEIRAEmeasklsaaeSVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQveeerrskegaeagnkrklEALRLKIEIDFQRHKDDLQRLEQEFSRLKasaesneqnhqsntlppgklerAKPQGETIARLLHELdeledsseketNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS

MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLnssstsggngntssvnsEDSEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTIsnnvdsvsnggvngvvAPALCRFHggwgfgsggNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAGFRASSKQGHSQPQACVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGVDSVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQeeianekekikeLQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARllheldeledsseKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS

*********************EFDPCCYLDKASISKSILESGLKPLSYHLG**************HGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYL************************NDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVNGVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNL******LLKRNVAMFAAG*******************************************************************TIT***KDEIVVTMLHQIKDL******************************************************************************************************VTTCLEVAKREKKCLKRLLAWEK**************************************************************************KIEI*********************************************************************CDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVF****

*******************************************************************WGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNSS*************SEDSEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRA***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************DCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFG***

MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNS********************VFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVNGVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAGF*************CVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGVDSVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQV***************RKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLAR****************KAKELLLAQVEE**********GNKRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLK***************PPGKLERAKPQGETIARLLHELDEL********NCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS

**C**R*K*****RRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPS*********HGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNSS****************SEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPG*********************GVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAG*******************************************LKDPNGVDSVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKAS***************************IARLLHELDEL********NCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGAS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYGGMDVLTNILHNSLAYLNSSSTSGGNGNTSSVNSEDSEPVFNDLRQLEEYSLAGMVCLLQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVNGVVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAAGFRASSKQGHSQPQACVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGVDSVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAESVTTCLEVAKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHQSNTLPPGKLERAKPQGETIARLLHELDELEDSSEKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		716	2.2.26 [Sep-21-2011]
Q8RX22		711	MND1-interacting protein	no	no	0.970	0.977	0.583	0.0
Q0WPJ7		814	Putative E3 ubiquitin-pro	no	no	0.465	0.409	0.340	2e-54
Q9ZVT8		823	Putative E3 ubiquitin-pro	no	no	0.466	0.405	0.356	2e-52
Q7M3S9		943	RING finger protein B OS=	yes	no	0.092	0.069	0.378	8e-05

>sp\|Q8RX22\|MIP1_ARATH MND1-interacting protein 1 OS=Arabidopsis thaliana GN=MIP1 PE=1 SV=1	Back alignment and function desciption

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/732 (58%), Positives = 534/732 (72%), Gaps = 37/732 (5%)

Query: 1   MGCTVREKHIRTTRRTRSVKPEFDP-CCYLDKASISKSILESGLKPLSYHLGLNDP-SHN 58
           MGCTVREKH++ TRR ++     DP  C+++K ++S+SI+E+    L YH GL D  S N
Sbjct: 1   MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVEN----LVYHPGLTDSGSVN 56

Query: 59  SNP---NADDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHC 115
            N    N +++ W YCTEE LEEILLK+LEFLYN+A+SKL+ LGY+E VALKA+L NGHC
Sbjct: 57  LNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHC 116

Query: 116 YGGMDVLTNILHNSLAYLNSSSTSGGNGNTSSVNSED-SEPVFNDLRQLEEYSLAGMVCL 174
           YG +DVLTNI++NSL+YLNS          S+ N ED +E  F DLR LEEYSLAGM+ L
Sbjct: 117 YGELDVLTNIVNNSLSYLNSGGGG----GGSNGNGEDRTETGFTDLRDLEEYSLAGMIYL 172

Query: 175 LQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGT-NVCGGTISNNVDSVSNGG---VNG 230
           LQQV+P+LSKGDAMWCLLMS+LHVGRAS++++P   + C     +NV+ V  GG   + G
Sbjct: 173 LQQVKPNLSKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAG 232

Query: 231 VVAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRN 290
            +APALCRFHGGWGFG+GG  EFS NGF    AE+ L R+I+CPKRFNLSPSMKSLLKRN
Sbjct: 233 FMAPALCRFHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRN 292

Query: 291 VAMFAAGFRASSKQGHSQPQACVS-VMAGRDASLVAS-GAEVTVENCEDSKNLKDPNGVD 348
           VA FAAG+RAS KQ   Q    +    A  D ++V S G +      E+S        V 
Sbjct: 293 VAAFAAGYRASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEES--------VS 344

Query: 349 SVLSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLS 408
           +VL K RDLN+D+NLE++  D KD ++V +LHQ+KD E++VKERKEWA + AMQAA+K+S
Sbjct: 345 TVLEKFRDLNLDDNLESVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVS 404

Query: 409 NDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLET 468
            +L ELK L  ERE  Q LKKGKQ +E++T KR ++ E  LRKA  Q DRAN  VR+LE 
Sbjct: 405 EELAELKTLSSEREGIQLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLEN 464

Query: 469 ENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKE 528
           +NAEIRAE E SKLSA+ES+  C+E +K+EKKCLK+L+AWEKQ  KLQ+EI  EKEKIK 
Sbjct: 465 QNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKA 524

Query: 529 LQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEI 588
           L + LA+I + +KE E+KWRQEQKAKE  LAQ+EEE+RSKE AE  NKRKLE LRLKIE+
Sbjct: 525 LYKTLAQITEYEKEIEAKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIEL 584

Query: 589 DFQRHKDDLQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARLLHELDEL 648
           DFQRHKDD QRLEQE  RLKAS++S+  +  +N   P      K QGE IA+LL E+D+L
Sbjct: 585 DFQRHKDDHQRLEQELGRLKASSDSDSSHISNNAWKP-----KKSQGENIAKLLEEIDKL 639

Query: 649 EDSSEKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKK----GKATCPCCRVP 704
           E S + E N DR+CIIC+KDEVS+VFLPCAHQV+C SCSD++        K TCPCCR  
Sbjct: 640 EGSYDNEANYDRECIICMKDEVSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGL 699

Query: 705 IEQRIRVFGASS 716
           ++QRIR+FGA+S
Sbjct: 700 VQQRIRIFGATS 711

Arabidopsis thaliana (taxid: 3702)

>sp\|Q0WPJ7\|RF298_ARATH Putative E3 ubiquitin-protein ligase RF298 OS=Arabidopsis thaliana GN=RF298 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZVT8\|RF4_ARATH Putative E3 ubiquitin-protein ligase RF4 OS=Arabidopsis thaliana GN=RF4 PE=3 SV=1	Back alignment and function description

>sp\|Q7M3S9\|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		716
255557617		781	synaptonemal complex protein, putative [	0.993	0.910	0.775	0.0
225427250		723	PREDICTED: MND1-interacting protein 1 [V	0.994	0.984	0.742	0.0
224126303		729	predicted protein [Populus trichocarpa]	0.988	0.971	0.754	0.0
224138884		718	predicted protein [Populus trichocarpa]	0.981	0.979	0.755	0.0
449462005		719	PREDICTED: MND1-interacting protein 1-li	0.983	0.979	0.700	0.0
356510649		733	PREDICTED: MND1-interacting protein 1-li	0.983	0.960	0.728	0.0
356563457		721	PREDICTED: MND1-interacting protein 1-li	0.981	0.975	0.730	0.0
147765511		1207	hypothetical protein VITISV_004428 [Viti	0.910	0.540	0.682	0.0
186505512		738	RING-finger domain-containing protein [A	0.979	0.949	0.643	0.0
334184701		711	RING-finger domain-containing protein [A	0.979	0.985	0.643	0.0

>gi\|255557617\|ref\|XP_002519838.1\| synaptonemal complex protein, putative [Ricinus communis] gi\|223540884\|gb\|EEF42442.1\| synaptonemal complex protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/740 (77%), Positives = 643/740 (86%), Gaps = 29/740 (3%)

Query: 1   MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSN 60
           MGCTVREKHIRT RR RS KPEFDPCCY   +SISKSILESGLKPL+YHLGL+DP+H + 
Sbjct: 47  MGCTVREKHIRTNRRARSAKPEFDPCCY--ASSISKSILESGLKPLAYHLGLHDPTHTNP 104

Query: 61  PNA------DDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGH 114
                    +D+GWGYCTEEQLEEILLKNLEFLY EAI+KLV+LGYDED ALKAIL+NGH
Sbjct: 105 NPNSSNANLEDNGWGYCTEEQLEEILLKNLEFLYKEAIAKLVSLGYDEDTALKAILRNGH 164

Query: 115 CYGGMDVLTNILHNSLAYLNSSSTSGGNGNTSSVNSEDSEPVFNDLRQLEEYSLAGMVCL 174
           CYGGMDVLTNILHNSLA+LNS+S  G N ++S  + ++SEPVFNDLRQLEEYSLA MVCL
Sbjct: 165 CYGGMDVLTNILHNSLAHLNSNS--GTNCSSSHGSLDESEPVFNDLRQLEEYSLAAMVCL 222

Query: 175 LQQVRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGTISNNVDSVSNGGVN---GV 231
           LQQVRPHLSKGDAMWCLLMSDLHVGRAS+IEIP  N    T+ ++V+S S+ GV+   GV
Sbjct: 223 LQQVRPHLSKGDAMWCLLMSDLHVGRASTIEIPPGN-GNITVQSSVESFSSNGVDNGVGV 281

Query: 232 VAPALCRFHGGWGFGSGGNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNV 291
           VAPALCRFHGGWGFG+ G +EF+VNGFFSYSAEMTLP+DI+CPKRFNLSPSMKSLLKRNV
Sbjct: 282 VAPALCRFHGGWGFGNEGGSEFAVNGFFSYSAEMTLPKDIDCPKRFNLSPSMKSLLKRNV 341

Query: 292 AMFAAGFRASSKQ----GHSQPQACVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGV 347
           AMFAAGFRA+SKQ      +QP++CV V +G D +  ++G+ V VEN E S+N K+ +GV
Sbjct: 342 AMFAAGFRANSKQMQLQSQAQPESCVGVSSGGDVTPASAGSRVLVENGEVSQNSKNQDGV 401

Query: 348 DSV-----------LSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWA 396
           +SV           LSK  DLN+DENLE   +DQKDE++VT+LHQIKDLERQVKERKEWA
Sbjct: 402 NSVWNKFQDGISSVLSKFSDLNLDENLELAGEDQKDEMIVTLLHQIKDLERQVKERKEWA 461

Query: 397 HQKAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQV 456
           HQKAMQAARKLS+DLTELKMLRMEREETQRLKKGKQTLED+TMKRLSEMENALRKASGQV
Sbjct: 462 HQKAMQAARKLSSDLTELKMLRMEREETQRLKKGKQTLEDSTMKRLSEMENALRKASGQV 521

Query: 457 DRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQ 516
           DRANAAVRRLETENAEIRAEMEASKLS++ES +TC+E  KREKK LK+LLAWEKQK KLQ
Sbjct: 522 DRANAAVRRLETENAEIRAEMEASKLSSSESTSTCMEAVKREKKWLKKLLAWEKQKTKLQ 581

Query: 517 EEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNK 576
           +EIA+EKEKIKELQ+CLA ++Q QKE E+KWRQE K KE +LAQVEEERRSKE AEA NK
Sbjct: 582 DEIADEKEKIKELQRCLAMVEQAQKEAEAKWRQEVKVKEQVLAQVEEERRSKEAAEASNK 641

Query: 577 RKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGE 636
           RKLEALRLKIEIDFQRHKDDLQRLEQE SRLKASAES + NHQ +TLP GK E+ KPQGE
Sbjct: 642 RKLEALRLKIEIDFQRHKDDLQRLEQELSRLKASAESPDLNHQLSTLPSGKPEKTKPQGE 701

Query: 637 TIARLLHELDELEDSSEKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKA 696
           TIARLLHELD+LEDSS+K  NC+RDCIIC+KDEVSIVFLPCAHQV+CASCSDNYGKKGKA
Sbjct: 702 TIARLLHELDKLEDSSDKGANCERDCIICMKDEVSIVFLPCAHQVMCASCSDNYGKKGKA 761

Query: 697 TCPCCRVPIEQRIRVFGASS 716
           TCPCCRVPIEQRIRVFGASS
Sbjct: 762 TCPCCRVPIEQRIRVFGASS 781

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225427250\|ref\|XP_002281049.1\| PREDICTED: MND1-interacting protein 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224126303\|ref\|XP_002329521.1\| predicted protein [Populus trichocarpa] gi\|222870230\|gb\|EEF07361.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224138884\|ref\|XP_002326714.1\| predicted protein [Populus trichocarpa] gi\|222834036\|gb\|EEE72513.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449462005\|ref\|XP_004148732.1\| PREDICTED: MND1-interacting protein 1-like [Cucumis sativus] gi\|449521144\|ref\|XP_004167590.1\| PREDICTED: MND1-interacting protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356510649\|ref\|XP_003524049.1\| PREDICTED: MND1-interacting protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|356563457\|ref\|XP_003549979.1\| PREDICTED: MND1-interacting protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|147765511\|emb\|CAN78110.1\| hypothetical protein VITISV_004428 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|186505512\|ref\|NP_181076.3\| RING-finger domain-containing protein [Arabidopsis thaliana] gi\|22531056\|gb\|AAM97032.1\| unknown protein [Arabidopsis thaliana] gi\|23197948\|gb\|AAN15501.1\| unknown protein [Arabidopsis thaliana] gi\|330254000\|gb\|AEC09094.1\| RING-finger domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334184701\|ref\|NP_001189683.1\| RING-finger domain-containing protein [Arabidopsis thaliana] gi\|330254001\|gb\|AEC09095.1\| RING-finger domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		716
TAIR\|locus:2062374		738	AT2G35330 [Arabidopsis thalian	0.987	0.957	0.601	5.8e-224
TAIR\|locus:2033765		711	AT1G32530 [Arabidopsis thalian	0.970	0.977	0.539	8.6e-191
TAIR\|locus:2139310		814	AT4G03000 [Arabidopsis thalian	0.481	0.423	0.334	1.2e-72
MGI\|MGI:2684789		727	Lrsam1 "leucine rich repeat an	0.382	0.376	0.227	9.9e-11
RGD\|1564403		727	Lrsam1 "leucine rich repeat an	0.385	0.379	0.225	1.3e-10
UNIPROTKB\|J9P525		728	LRSAM1 "Uncharacterized protei	0.069	0.068	0.363	7e-10
UNIPROTKB\|Q08E63		724	LRSAM1 "Uncharacterized protei	0.069	0.069	0.381	1.1e-09
DICTYBASE\|DDB_G0284845		1215	gxcC "armadillo repeat-contain	0.312	0.184	0.268	1.5e-09
ZFIN\|ZDB-GENE-030616-583		1376	acin1a "apoptotic chromatin co	0.377	0.196	0.278	1.8e-09
UNIPROTKB\|E1BF59		4644	LOC786966 "Uncharacterized pro	0.367	0.056	0.238	2e-09

TAIR\|locus:2062374 AT2G35330 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2162 (766.1 bits), Expect = 5.8e-224, P = 5.8e-224
 Identities = 433/720 (60%), Positives = 531/720 (73%)

Query:     1 MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSN 60
             MGCTVREKH+R  R+TRSVKPEFDPCC LD+ ++SKSI+ES LK L YH GL D    SN
Sbjct:    28 MGCTVREKHVRPNRKTRSVKPEFDPCCLLDRTALSKSIVESSLKHLVYHPGLLDSCPESN 87

Query:    61 PNA---DDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALKAILKNGHCYG 117
             P+    D++GWGYCTEEQLE+ILLK+LE+LYNEAISKLV  GYDEDVAL+A+L NG+CYG
Sbjct:    88 PSGSFEDNNGWGYCTEEQLEDILLKHLEYLYNEAISKLVGSGYDEDVALRAVLSNGYCYG 147

Query:   118 GMDVLTNILHNSLAYLXXXXXXXXXXXXXXXXXEDSEPVFNDLRQLEEYSLAGMVCLLQQ 177
             GMDV+TNILHNSLAYL                 + SE VF DLRQLEEYSLAGMV LLQQ
Sbjct:   148 GMDVMTNILHNSLAYLKSNTGEGSNVNNE----DQSETVFTDLRQLEEYSLAGMVYLLQQ 203

Query:   178 VRPHLSKGDAMWCLLMSDLHVGRASSIEIPGTNVCGGT-IXXXXXXXXXXXXXXXXAPAL 236
             V+P+LSKGDAMWCLLMS+LHVGRAS+++IP +     + +                APAL
Sbjct:   204 VKPNLSKGDAMWCLLMSELHVGRASTMDIPSSGKGDSSNVGVGGASSTVNGVGGAIAPAL 263

Query:   237 CRFHXXXXXXXXXNAEFSVNGFFSYSAEMTLPRDIECPKRFNLSPSMKSLLKRNVAMFAA 296
             CRFH           +FS NGF  +S E+TL R+I+CP+RFNLSPSMKSLL+ NVA FAA
Sbjct:   264 CRFHGGWGFGNGKGPKFSGNGFSLHSEELTLQREIDCPRRFNLSPSMKSLLRENVAAFAA 323

Query:   297 GFRASSKQGHSQPQACVSVMAGRDASLVASGAEVTVENCEDSKNLKDPNGVDSVLSKMRD 356
             G+RAS +Q   Q Q   S  +G   SL  + A    E CE            SVL K RD
Sbjct:   324 GYRASMEQ-KKQVQM-QSETSG--TSLSCTAAATHSEKCEQPHVFGSEECFSSVLEKFRD 379

Query:   357 LNIDENLETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELKM 416
             LN+D+N+++  ++ KD+ ++ +L Q++DL++Q+KERK+WA +KAMQAA+K+S++L+ELK 
Sbjct:   380 LNLDDNVDSAPEELKDDALIGLLQQVQDLKKQLKERKDWAQKKAMQAAQKVSDELSELKS 439

Query:   417 LRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAE 476
             LR EREE QR+KKGKQT ED+T+K+LSEMENALRKASGQVD+ANA VR LE E+AEIRAE
Sbjct:   440 LRSEREEIQRVKKGKQTREDSTLKKLSEMENALRKASGQVDKANAVVRALENESAEIRAE 499

Query:   477 MEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQXXXXXXXXXXXXLQQCLARI 536
             MEASKLSA+ES+T C+E +K+EKKCLK+LLAWEKQK KLQ            L + LA+I
Sbjct:   500 MEASKLSASESLTACMEASKKEKKCLKKLLAWEKQKMKLQDEITAEKEKIKALNRALAQI 559

Query:   537 QQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDD 596
              Q++KE E+KWRQEQKAKE +LAQVEEE+RSKE  EA NKRK+E+LRLKIEIDFQRHKDD
Sbjct:   560 TQEEKEYEAKWRQEQKAKEQVLAQVEEEQRSKEAIEASNKRKVESLRLKIEIDFQRHKDD 619

Query:   597 LQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARXXXXXXXXXXXXXKET 656
             LQRLEQE SRL   A S + + QSN     K++  K +GET+++             KE 
Sbjct:   620 LQRLEQELSRLN-KASSTDSSLQSNNTSHTKVKSDKSKGETMSKLLEELNRLDGSYEKEA 678

Query:   657 NCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS 716
             N DR+C+IC+KDEVS+VFLPCAHQV+CASCSD++   GKATCPCCR P++QRIRVFGASS
Sbjct:   679 NYDRECLICMKDEVSVVFLPCAHQVVCASCSDSFMGSGKATCPCCRAPVQQRIRVFGASS 738

GO:0005737 "cytoplasm" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA

TAIR\|locus:2033765 AT1G32530 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139310 AT4G03000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

MGI\|MGI:2684789 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1564403 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P525 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q08E63 LRSAM1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0284845 gxcC "armadillo repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030616-583 acin1a "apoptotic chromatin condensation inducer 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BF59 LOC786966 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		716
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-16
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	2e-13
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-13
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-11
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-08
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	7e-08
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	8e-08
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	8e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-07
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-07
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	2e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-07
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-07
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	7e-07
pfam13514		1118	pfam13514, AAA_27, AAA domain	2e-06
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	4e-06
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	7e-06
pfam01496		707	pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni	7e-06
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	7e-06
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	8e-06
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	1e-05
PRK09510		387	PRK09510, tolA, cell envelope integrity inner memb	2e-05
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	2e-05
TIGR02794		346	TIGR02794, tolA_full, TolA protein	2e-05
smart00184		40	smart00184, RING, Ring finger	2e-05
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	2e-05
TIGR01843		423	TIGR01843, type_I_hlyD, type I secretion membrane	3e-05
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	5e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	6e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	7e-05
COG3064		387	COG3064, TolA, Membrane protein involved in colici	8e-05
TIGR02794		346	TIGR02794, tolA_full, TolA protein	1e-04
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	1e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	2e-04
TIGR02794		346	TIGR02794, tolA_full, TolA protein	2e-04
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	2e-04
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	2e-04
COG4487		438	COG4487, COG4487, Uncharacterized protein conserve	3e-04
COG1579		239	COG1579, COG1579, Zn-ribbon protein, possibly nucl	3e-04
TIGR02680		1353	TIGR02680, TIGR02680, TIGR02680 family protein	4e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	5e-04
pfam00769		244	pfam00769, ERM, Ezrin/radixin/moesin family	6e-04
PHA02929		238	PHA02929, PHA02929, N1R/p28-like protein; Provisio	7e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	7e-04
pfam04156		186	pfam04156, IncA, IncA protein	7e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	9e-04
TIGR00618		1042	TIGR00618, sbcc, exonuclease SbcC	9e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
TIGR02794		346	TIGR02794, tolA_full, TolA protein	0.001
COG1579		239	COG1579, COG1579, Zn-ribbon protein, possibly nucl	0.001
TIGR02680		1353	TIGR02680, TIGR02680, TIGR02680 family protein	0.001
pfam10174		774	pfam10174, Cast, RIM-binding protein of the cytoma	0.001
PRK04863		1486	PRK04863, mukB, cell division protein MukB; Provis	0.001
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	0.001
COG1293		564	COG1293, COG1293, Predicted RNA-binding protein ho	0.001
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.002
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	0.002
COG3064		387	COG3064, TolA, Membrane protein involved in colici	0.002
pfam10174		774	pfam10174, Cast, RIM-binding protein of the cytoma	0.002
COG1269		660	COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su	0.002
PRK05035		695	PRK05035, PRK05035, electron transport complex pro	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.003
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.003
PRK11637		428	PRK11637, PRK11637, AmiB activator; Provisional	0.003
pfam13514		1118	pfam13514, AAA_27, AAA domain	0.004
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	0.004
pfam05557		722	pfam05557, MAD, Mitotic checkpoint protein	0.004
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.004

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

 Score = 82.8 bits (205), Expect = 4e-16
 Identities = 63/320 (19%), Positives = 124/320 (38%), Gaps = 50/320 (15%)

Query: 351 LSKMRDLNIDENLETITDDQKDEIVVTMLHQIKDLERQVK----------ERKEWAHQ-- 398
             K+      ENL+ + D     I+  +  Q+K LERQ +          E +E      
Sbjct: 178 ERKLER--TRENLDRLED-----ILNELERQLKSLERQAEKAERYKELKAELRELELALL 230

Query: 399 --KAMQAARKLSNDLTELKMLRMEREETQRLKKGKQTLEDTTMKRLSEMENALRKASGQV 456
             +  +   +L     ELK    E EE     +  +   +     +SE+E  + +   ++
Sbjct: 231 VLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKEL 290

Query: 457 DRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLA-WEKQKAKL 515
                 + RLE +   +R  +   +    E +   LE  + +   L   LA  E++  +L
Sbjct: 291 YALANEISRLEQQKQILRERLANLERQLEE-LEAQLEELESKLDELAEELAELEEKLEEL 349

Query: 516 QEEIANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGN 575
           +EE+ + + +++EL                    E +  E  L ++EE+  +     A  
Sbjct: 350 KEELESLEAELEEL------------------EAELEELESRLEELEEQLETLRSKVAQL 391

Query: 576 KRKLEALRLKIEIDFQRHKDDLQRLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQG 635
           + ++ +L  +I    +R +  L+RLE    RL+   E   +  +       +L+  + + 
Sbjct: 392 ELQIASLNNEI----ERLEARLERLEDRRERLQQEIEELLKKLEEA-----ELKELQAEL 442

Query: 636 ETIARLLHELDELEDSSEKE 655
           E +   L EL E  +  E+ 
Sbjct: 443 EELEEELEELQEELERLEEA 462

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|205692 pfam13514, AAA_27, AAA domain	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233973 TIGR02680, TIGR02680, TIGR02680 family protein	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|216108 pfam00769, ERM, Ezrin/radixin/moesin family	Back alignment and domain information

>gnl\|CDD\|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|217933 pfam04156, IncA, IncA protein	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|129705 TIGR00618, sbcc, exonuclease SbcC	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233973 TIGR02680, TIGR02680, TIGR02680 family protein	Back alignment and domain information

>gnl\|CDD\|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone	Back alignment and domain information

>gnl\|CDD\|235316 PRK04863, mukB, cell division protein MukB; Provisional	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone	Back alignment and domain information

>gnl\|CDD\|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|236942 PRK11637, PRK11637, AmiB activator; Provisional	Back alignment and domain information

>gnl\|CDD\|205692 pfam13514, AAA_27, AAA domain	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|218636 pfam05557, MAD, Mitotic checkpoint protein	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		716
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	99.78
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	99.03
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.92
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	98.91
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.42
PHA02929		238	N1R/p28-like protein; Provisional	98.39
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.39
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	98.34
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.32
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.27
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.18
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.17
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.15
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.11
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.11
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.06
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.06
PHA02926		242	zinc finger-like protein; Provisional	98.04
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.03
PRK02224		880	chromosome segregation protein; Provisional	98.02
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	97.99
PRK03918		880	chromosome segregation protein; Provisional	97.99
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	97.98
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.97
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.91
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	97.91
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.91
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.89
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.83
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	97.82
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	97.82
PF14634		44	zf-RING_5: zinc-RING finger domain	97.82
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.81
PRK02224		880	chromosome segregation protein; Provisional	97.8
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	97.75
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.74
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.73
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.72
KOG0971		1243	consensus Microtubule-associated protein dynactin	97.64
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.62
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	97.6
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	97.56
PRK11637		428	AmiB activator; Provisional	97.55
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.55
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	97.54
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.52
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.51
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.49
PRK11637		428	AmiB activator; Provisional	97.48
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.47
PRK03918		880	chromosome segregation protein; Provisional	97.47
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	97.45
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	97.45
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.35
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.34
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	97.33
KOG0996		1293	consensus Structural maintenance of chromosome pro	97.31
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.28
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.27
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.25
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.25
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.2
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	97.19
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.19
PF00038		312	Filament: Intermediate filament protein; InterPro:	97.18
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.18
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	97.16
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	97.12
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.04
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.04
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	97.03
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	97.02
KOG0933		1174	consensus Structural maintenance of chromosome pro	96.98
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	96.97
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	96.96
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	96.94
KOG0933		1174	consensus Structural maintenance of chromosome pro	96.94
PRK04863		1486	mukB cell division protein MukB; Provisional	96.93
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	96.93
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	96.93
PHA02562		562	46 endonuclease subunit; Provisional	96.88
KOG0996		1293	consensus Structural maintenance of chromosome pro	96.87
PRK04778		569	septation ring formation regulator EzrA; Provision	96.85
PHA02562		562	46 endonuclease subunit; Provisional	96.84
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	96.83
PRK09039		343	hypothetical protein; Validated	96.78
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	96.77
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.76
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	96.74
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	96.72
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.71
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	96.68
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	96.67
PRK04863		1486	mukB cell division protein MukB; Provisional	96.67
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	96.65
KOG0971		1243	consensus Microtubule-associated protein dynactin	96.62
PRK10698		222	phage shock protein PspA; Provisional	96.6
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	96.58
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	96.57
KOG4807		593	consensus F-actin binding protein, regulates actin	96.56
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	96.55
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	96.54
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	96.51
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.48
COG5152		259	Uncharacterized conserved protein, contains RING a	96.47
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	96.39
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	96.36
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	96.35
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	96.31
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.31
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.31
KOG0018		1141	consensus Structural maintenance of chromosome pro	96.29
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	96.22
PRK01156		895	chromosome segregation protein; Provisional	96.18
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.17
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.16
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	96.12
PRK09039		343	hypothetical protein; Validated	96.11
PRK04778		569	septation ring formation regulator EzrA; Provision	96.08
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	96.06
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	96.05
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	96.03
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	95.95
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	95.91
COG4372		499	Uncharacterized protein conserved in bacteria with	95.9
COG4372		499	Uncharacterized protein conserved in bacteria with	95.89
PRK00106		535	hypothetical protein; Provisional	95.88
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	95.79
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	95.78
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	95.78
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	95.77
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	95.76
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	95.75
KOG4403		575	consensus Cell surface glycoprotein STIM, contains	95.74
KOG0964		1200	consensus Structural maintenance of chromosome pro	95.68
COG5236		493	Uncharacterized conserved protein, contains RING Z	95.62
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	95.59
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	95.58
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	95.58
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	95.57
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	95.53
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	95.5
COG4942		420	Membrane-bound metallopeptidase [Cell division and	95.35
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	95.35
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	95.24
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	95.19
KOG2660		331	consensus Locus-specific chromosome binding protei	95.19
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	95.15
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.09
KOG0963		629	consensus Transcription factor/CCAAT displacement	95.08
KOG0825		1134	consensus PHD Zn-finger protein [General function	95.04
KOG0979		1072	consensus Structural maintenance of chromosome pro	94.9
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	94.84
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	94.83
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	94.78
PF00038		312	Filament: Intermediate filament protein; InterPro:	94.77
PF13514		1111	AAA_27: AAA domain	94.64
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	94.55
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	94.51
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	94.49
KOG0964		1200	consensus Structural maintenance of chromosome pro	94.37
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	94.25
COG4477		570	EzrA Negative regulator of septation ring formatio	94.25
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	94.21
PF15358		558	TSKS: Testis-specific serine kinase substrate	93.98
KOG2991		330	consensus Splicing regulator [RNA processing and m	93.76
KOG2072		988	consensus Translation initiation factor 3, subunit	93.74
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	93.63
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	93.62
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	93.6
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	93.58
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	93.58
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	93.51
PRK01156		895	chromosome segregation protein; Provisional	93.5
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	93.43
KOG1003		205	consensus Actin filament-coating protein tropomyos	93.41
PTZ00121		2084	MAEBL; Provisional	93.22
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	93.08
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	93.02
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	93.0
COG2433		652	Uncharacterized conserved protein [Function unknow	92.99
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	92.98
KOG1937		521	consensus Uncharacterized conserved protein [Funct	92.9
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	92.89
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	92.86
PF04641		260	Rtf2: Rtf2 RING-finger	92.84
PRK10929		1109	putative mechanosensitive channel protein; Provisi	92.77
PF10186		302	Atg14: UV radiation resistance protein and autopha	92.76
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	92.72
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	92.72
KOG4673		961	consensus Transcription factor TMF, TATA element m	92.69
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	92.61
KOG3002		299	consensus Zn finger protein [General function pred	92.54
KOG0297		391	consensus TNF receptor-associated factor [Signal t	92.53
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	92.47
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	92.43
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	92.36
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	92.26
KOG3039		303	consensus Uncharacterized conserved protein [Funct	92.24
KOG1002		791	consensus Nucleotide excision repair protein RAD16	92.21
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	92.09
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	92.07
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	92.05
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	92.03
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	91.76
KOG1001		674	consensus Helicase-like transcription factor HLTF/	91.76
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	91.74
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	91.73
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	91.73
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	91.44
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	91.13
PRK12704		520	phosphodiesterase; Provisional	90.9
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	90.88
KOG0979		1072	consensus Structural maintenance of chromosome pro	90.87
PTZ00121		2084	MAEBL; Provisional	90.74
KOG1937		521	consensus Uncharacterized conserved protein [Funct	90.63
PRK10246		1047	exonuclease subunit SbcC; Provisional	90.55
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.52
KOG0249		916	consensus LAR-interacting protein and related prot	90.35
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	90.25
KOG4673		961	consensus Transcription factor TMF, TATA element m	90.17
PLN03188		1320	kinesin-12 family protein; Provisional	90.14
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	90.1
PF15556		252	Zwint: ZW10 interactor	89.88
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	89.82
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	89.65
KOG0249		916	consensus LAR-interacting protein and related prot	89.64
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.64
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	89.61
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	89.33
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	89.32
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.05
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	88.8
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	88.51
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	88.39
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	88.35
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	88.31
KOG2113		394	consensus Predicted RNA binding protein, contains	88.18
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	88.15
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	88.13
PF10186		302	Atg14: UV radiation resistance protein and autopha	87.75
PTZ00266		1021	NIMA-related protein kinase; Provisional	87.6
PRK00106		535	hypothetical protein; Provisional	87.6
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	87.59
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	87.49
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	87.32
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	87.18
COG5185		622	HEC1 Protein involved in chromosome segregation, i	87.17
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	87.01
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	86.87
KOG0018		1141	consensus Structural maintenance of chromosome pro	86.77
KOG4367		699	consensus Predicted Zn-finger protein [Function un	86.55
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	86.37
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	86.24
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	85.94
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	85.91
KOG2113		394	consensus Predicted RNA binding protein, contains	85.84
KOG4572		1424	consensus Predicted DNA-binding transcription fact	85.62
KOG1003		205	consensus Actin filament-coating protein tropomyos	85.59
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	85.52
KOG2891		445	consensus Surface glycoprotein [General function p	85.35
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	85.3
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	85.19
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	85.12
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	84.97
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	84.94
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	84.79
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	84.79
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	84.66
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	84.66
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	84.57
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	84.54
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	84.49
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	84.06
KOG0288		459	consensus WD40 repeat protein TipD [General functi	83.89
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	83.78
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	83.67
KOG3842		429	consensus Adaptor protein Pellino [Signal transduc	83.26
PF04710		416	Pellino: Pellino; InterPro: IPR006800 Pellino is i	83.23
PF14662		193	CCDC155: Coiled-coil region of CCDC155	83.05
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	82.91
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	82.76
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	82.66
PF02845		42	CUE: CUE domain; InterPro: IPR003892 This domain m	82.62
PF13166		712	AAA_13: AAA domain	82.46
smart00546		43	CUE Domain that may be involved in binding ubiquit	82.45
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	82.39
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	82.15
cd07627		216	BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of	82.14
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	82.12
KOG4364		811	consensus Chromatin assembly factor-I [Chromatin s	82.05
PRK00409		782	recombination and DNA strand exchange inhibitor pr	81.98
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	81.86
PF05262		489	Borrelia_P83: Borrelia P83/100 protein; InterPro:	81.46
PRK10884		206	SH3 domain-containing protein; Provisional	81.45
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	81.44
KOG1103		561	consensus Predicted coiled-coil protein [Function	81.4
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	81.37
KOG4364		811	consensus Chromatin assembly factor-I [Chromatin s	81.31
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	81.28
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	81.24
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	81.1
KOG3579		352	consensus Predicted E3 ubiquitin ligase [Posttrans	81.03
PLN02939		977	transferase, transferring glycosyl groups	81.0
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	80.81
KOG1103		561	consensus Predicted coiled-coil protein [Function	80.57
PRK11281		1113	hypothetical protein; Provisional	80.5
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	80.27
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	80.1
COG5219		1525	Uncharacterized conserved protein, contains RING Z	80.08
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	80.05
COG5222		427	Uncharacterized conserved protein, contains RING Z	80.02
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	80.01

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.78  E-value=2.1e-16  Score=181.37  Aligned_cols=307  Identities=19%  Similarity=0.254  Sum_probs=189.9

Q ss_pred             cCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcHHHHH--HHHHhHHHHHHHHHhhhhhHH---HH
Q 005057          364 ETITDDQKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDLTELK--MLRMEREETQRLKKGKQTLED---TT  438 (716)
Q Consensus       364 ~~v~~d~k~e~~~~l~~~~~~l~~~~~~~~~wa~~k~~qaa~~L~~~~~Elk--~LR~ekee~e~lkkekqeLEe---~t  438 (716)
                      .-+|++.+|++-.++...+..+-.++..|.+-...+.-+.+    .|..+.+  ..-.+.++.++..+.-+.|..   .+
T Consensus       384 k~~~ke~~~~~~~ka~~E~e~l~q~l~~~~k~e~~e~~k~~----~d~~~r~~~~~~~~~e~Lqk~~~~~k~ll~e~~t~  459 (698)
T KOG0978|consen  384 KSLLKEQRDKLQVKARAETESLLQRLKALDKEERSEIRKQA----LDDAERQIRQVEELSEELQKKEKNFKCLLSEMETI  459 (698)
T ss_pred             hCCCHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh----hHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56788888888888888888888888888765554443222    2222211  111222222222222222111   11


Q ss_pred             HHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005057          439 MKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESVTTCLEVAKREKKCLKRLLAWEKQKAKLQEE  518 (716)
Q Consensus       439 ~krLselE~el~k~~~qle~a~~~~~~Le~e~a~lr~e~Ea~k~~a~e~~~~~~e~~erekk~~k~l~~~Ekq~~~LqeE  518 (716)
                      -.-..+|+.++.++..|++..+-.+++||.+.....+....+..+...+...+..+.....+...++..+|+|...++..
T Consensus       460 gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~~~~~~~i~~leeq~~~lt~~  539 (698)
T KOG0978|consen  460 GSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASVDKLELKIGKLEEQERGLTSN  539 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHh
Confidence            24457799999999999999999999999999988888888888888888888888888888888888888888877776


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhhhhHHHH
Q 005057          519 IANEKEKIKELQQCLARIQQDQKETESKWRQEQKAKELLLAQVEEERRSKEGAEAGNKRKLEALRLKIEIDFQRHKDDLQ  598 (716)
Q Consensus       519 l~~~k~KI~~le~el~qakq~~~~~e~~~kqee~~keea~~~~e~er~erE~aE~~~k~k~e~~~~KaE~E~qr~k~~l~  598 (716)
                      .......+..+...++..+...-.+       ....+.+-..++...+..++++...        ...+.++...+-...
T Consensus       540 ~~~l~~el~~~~~~le~~kk~~~e~-------~~~~~~Lq~~~ek~~~~le~i~~~~--------~e~~~ele~~~~k~~  604 (698)
T KOG0978|consen  540 ESKLIKELTTLTQSLEMLKKKAQEA-------KQSLEDLQIELEKSEAKLEQIQEQY--------AELELELEIEKFKRK  604 (698)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHH
Confidence            6665555555555544433221111       1111222222333333334333211        112222333334455


Q ss_pred             HHHHHHHHHhhhhccccccccCCCCCCCccccCCCchhHHHHHHHHHhhhhhccccccCCccccccccccccceEEecCC
Q 005057          599 RLEQEFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARLLHELDELEDSSEKETNCDRDCIICLKDEVSIVFLPCA  678 (716)
Q Consensus       599 ~LekELe~Lk~k~~s~~~s~e~~~Lp~~~~e~~~~q~e~~~~ll~el~~~e~~~~~~~~~~~~C~IC~~~~~~vvllpCg  678 (716)
                      +++.|+++|+.+....+... +          ..   .....+..++...        .....|++|.++++++||+.||
T Consensus       605 rleEE~e~L~~kle~~k~~~-~----------~~---s~d~~L~EElk~y--------K~~LkCs~Cn~R~Kd~vI~kC~  662 (698)
T KOG0978|consen  605 RLEEELERLKRKLERLKKEE-S----------GA---SADEVLAEELKEY--------KELLKCSVCNTRWKDAVITKCG  662 (698)
T ss_pred             HHHHHHHHHHHHHHHhcccc-c----------cc---cccHHHHHHHHHH--------HhceeCCCccCchhhHHHHhcc
Confidence            66666666665542211110 0          00   0122233333332        3367999999999999999999


Q ss_pred             CcccChhhHHHhcccCCCCCCCCCccccc--eEEee
Q 005057          679 HQVLCASCSDNYGKKGKATCPCCRVPIEQ--RIRVF  712 (716)
Q Consensus       679 H~vfC~~C~~~~~~~r~~~CP~CR~~i~~--~i~i~  712 (716)
                      |+ ||..|+..++..|+++||.|+.+|..  +.+||
T Consensus       663 H~-FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  663 HV-FCEECVQTRYETRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hH-HHHHHHHHHHHHhcCCCCCCCCCCCcccccccC
Confidence            99 99999999999999999999999954  56665

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF15358 TSKS: Testis-specific serine kinase substrate	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>PF15556 Zwint: ZW10 interactor	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG2891 consensus Surface glycoprotein [General function prediction only]	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms]	Back alignment and domain information

>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		716
4auq_B		62	Structure Of Birc7-Ubch5b-Ub Complex. Length = 62		9e-07
3t6p_A		345	Iap Antagonist-Induced Conformational Change In Cia		2e-06
3eb5_A		74	Structure Of The Ciap2 Ring Domain Length = 74		2e-06

>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62

Back alignment and structure

Iteration: 1
 Score = 52.4 bits (124), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 6/54 (11%)
Query: 659 DRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVF 712
           +R C +CL   VSIVF+PC H V CA C+      G   CP CR P+  R+R F
Sbjct: 13  ERTCKVCLDRAVSIVFVPCGHLV-CAECA-----PGLQLCPICRAPVRSRVRTF 60

PyMOL of 4auq

>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345

Back alignment and structure

>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		716
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-18
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	6e-12
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	4e-09
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-08
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-07
2ea5_A		68	Cell growth regulator with ring finger domain prot	1e-17
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	1e-15
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	5e-15
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	1e-14
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	2e-14
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-14
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-13
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	3e-14
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	1e-08
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-07
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	6e-07
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-05
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	3e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	8e-07
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	9e-07
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	6e-05
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	9e-07
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-04
2xs1_A		704	Programmed cell death 6-interacting protein; prote	2e-06
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	2e-06
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	1e-05
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	7e-05
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	1e-05
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	2e-05
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	2e-05
1z6u_A		150	NP95-like ring finger protein isoform B; structura	2e-05
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	2e-05
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	3e-05
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	5e-05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	6e-05
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	6e-05
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	8e-05
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	9e-05
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	1e-04
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	1e-04
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	2e-04
3haj_A		486	Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR,	2e-04
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	3e-04
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	3e-04
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	4e-04
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	4e-04
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	6e-04
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	7e-04

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

 Score = 88.4 bits (219), Expect = 3e-18
 Identities = 43/293 (14%), Positives = 105/293 (35%), Gaps = 24/293 (8%)

Query: 370  QKDEIVVTMLHQIKDLERQVKERKEWAHQKAMQAARKLSNDL-TELKMLRMEREETQRLK 428
            Q  +  +    + +       +  E  H +  +    L   L  E ++     E   RL 
Sbjct: 860  QAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLA 919

Query: 429  KGKQTLEDTTMKRLSEMENALRKASGQVDRANAAVRRLETENAEIRAEMEASKLSAAESV 488
              KQ LE    + L EME  + +   +  +  A  ++++ +  ++  ++E  + +  +  
Sbjct: 920  AKKQELE----EILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQK-- 973

Query: 489  TTCLEVAKREKKCLKRLLAWEKQKAKLQEEIANEKEKIKELQQCLARIQQDQKETESKWR 548
               L++ K       ++   E     ++++     ++ K L++ ++ +  +  E E K +
Sbjct: 974  ---LQLEKVTAD--GKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAK 1028

Query: 549  QEQKAKELLLAQVEEERRSKEGAEAGN------KRKLEALRLKIEIDFQRHKDDLQRLEQ 602
               K K    + + E     +  E         KRKLE     +       +  +  L+ 
Sbjct: 1029 NLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKA 1088

Query: 603  EFSRLKASAESNEQNHQSNTLPPGKLERAKPQGETIARLLHELDELEDSSEKE 655
            + ++ +   ++     +  T       +       I  L   + +L++  E E
Sbjct: 1089 QLAKKEEELQAALARLEDETSQKNNALK------KIRELESHISDLQEDLESE 1135

PyMOL of 1i84

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		716
2ea5_A		68	Cell growth regulator with ring finger domain prot	99.25
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	99.19
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	99.18
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	99.14
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.04
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.98
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	98.92
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.69
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.68
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.68
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.67
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.66
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.65
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.64
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.64
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.63
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.6
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.59
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.59
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.57
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.57
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.55
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.54
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.53
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.53
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.53
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.52
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.51
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.51
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.51
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.5
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.5
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.49
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.49
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.47
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.47
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.46
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.45
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.41
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.41
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.4
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.4
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.4
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.39
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.39
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.38
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.35
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.32
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.31
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.3
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.22
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.2
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.18
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.18
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.18
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.17
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.16
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.15
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.04
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	97.97
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	97.94
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	97.82
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.76
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.72
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	97.68
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	97.6
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.6
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	97.58
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.56
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.47
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	97.35
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	97.0
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	96.96
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	96.91
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	96.83
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	96.62
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.45
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	96.18
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	96.08
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	95.95
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	95.8
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	95.59
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	95.52
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	95.46
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	95.2
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	95.06
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	94.95
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	94.37
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	94.36
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	93.89
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	93.73
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	93.6
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	93.45
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	93.3
3i00_A		120	HIP-I, huntingtin-interacting protein 1; transcrip	93.26
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	92.75
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	92.74
2e7s_A		135	RAB guanine nucleotide exchange factor SEC2; coile	92.25
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	90.87
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	90.08
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	89.33
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	88.78
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	87.94
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	87.42
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	86.57
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	85.4
1otr_A		49	Protein CUE2; protein-protein complex, cell cycle;	85.08
3bas_A		89	Myosin heavy chain, striated muscle/general contro	85.06
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	84.37
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	84.02
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	83.74
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	82.61
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	82.13
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	81.99
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	81.8
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	81.65
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	81.49
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	81.38
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	81.22
1m1j_B		464	Fibrinogen beta chain; coiled coils, disulfide rin	80.97
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	80.4
4h22_A		103	Leucine-rich repeat flightless-interacting protei;	80.21

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

Probab=99.25  E-value=3.7e-12  Score=106.29  Aligned_cols=54  Identities=35%  Similarity=0.907  Sum_probs=49.8

Q ss_pred             CccccccccccccceEEecCCCcccChhhHHHhcccCCCCCCCCCccccceEEeeccCC
Q 005057          658 CDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVFGASS  716 (716)
Q Consensus       658 ~~~~C~IC~~~~~~vvllpCgH~vfC~~C~~~~~~~r~~~CP~CR~~i~~~i~i~~a~~  716 (716)
                      ....|+||++.+.+++|+||||.+||..|+..+     ..||+||.+|..++++|.+.|
T Consensus        14 ~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~-----~~CP~CR~~i~~~~~i~~~~s   67 (68)
T 2ea5_A           14 NSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYF-----QQCPMCRQFVQESFALSGPSS   67 (68)
T ss_dssp             CSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHC-----SSCTTTCCCCCCEECCCSSCC
T ss_pred             CCCCCCCcCcCCCCEEEECCCChhhhHHHHhcC-----CCCCCCCcchhceEEeecCCC
Confidence            467899999999999999999999999999964     789999999999999998765

PyMOL of 2ea5

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B*	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		716
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	8e-10
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	6e-06
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	1e-05
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	1e-05
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	1e-05
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	1e-05
d1f5na1		300	a.114.1.1 (A:284-583) Interferon-induced guanylate	2e-05
d1f5na1		300	a.114.1.1 (A:284-583) Interferon-induced guanylate	6e-04
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	2e-05
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	5e-05
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-04
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	4e-04
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	0.001

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.5 bits (128), Expect = 8e-10
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 646 DELEDSSEKETNCDRDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPI 705
           ++ E   E  +     C IC +++  +   PC H ++C SC  ++ +     CP CR  I
Sbjct: 11  EQYELYCEMGSTFQL-CKICAENDKDVKIEPCGH-LMCTSCLTSWQESEGQGCPFCRCEI 68

Query: 706 EQRIRVF 712
           +    + 
Sbjct: 69  KGTEPIV 75

PyMOL of d1fbva4

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		716
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.89
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.74
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.68
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.61
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.6
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.58
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.58
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.47
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.43
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.4
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.33
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.18
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.15
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.15
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.05
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.85
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	96.8
d1f5na1		300	Interferon-induced guanylate-binding protein 1 (GB	84.83
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	84.08

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.89  E-value=3.4e-10  Score=95.06  Aligned_cols=52  Identities=27%  Similarity=0.743  Sum_probs=46.2

Q ss_pred             cccccccccccceEEecCCCcccChhhHHHhcccCCCCCCCCCccccceEEee
Q 005057          660 RDCIICLKDEVSIVFLPCAHQVLCASCSDNYGKKGKATCPCCRVPIEQRIRVF  712 (716)
Q Consensus       660 ~~C~IC~~~~~~vvllpCgH~vfC~~C~~~~~~~r~~~CP~CR~~i~~~i~i~  712 (716)
                      ..|.||++...+++++||||. ||..|+..|...+...||+||..|.....++
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            469999999999999999999 9999999998766678999999998765553

PyMOL of d1fbva4

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure