Citrus Sinensis ID: 005128

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---

MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEcHHHHccccccccEEEccccccHHHHHHHHccccEEEEEEEEEcccccccccEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccEEEEcccccccccccEEEEEEccccccccccccccEEEEEccEEEcEEEEEccEEEEEcccccccEEEEEEEEcccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccc

cccHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccEEEEEcccEEEEEEccccccEEcccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccHEEEcccEEEEEccccccccEEEEEEEcccEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHccccccccHcccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccHHccccHHEcccccccccccccHHHHHHHHHcHHHHHHHHHHHcHcHHHccEEEEc

maqtrryvpnqqLDLEQILQEAQYRWLRPTEICEILRNYqkfhltpdppvrppagslflfDRKALRYFRkdghrwrkkkdgktVKEAHEKLKAGSIDVLHCYyahgednenfqRRSYWMLDGQLEHIVLVHYREVKegyksgrsaadpgsqiessqtsSARSLAQanssapaaqtshasipnkidwngqavssefedvdsghgsgtpsVAQSIYGSMSQNASLVAASIaglpelsrhpqwfagskinhgsgssmwpqidnssrnatSVLDqhghqnfyvgqpsgadfithkltdarlasdstianigtcgerlITDIdvhavttssqgASQVLLEHNFNLinnqcqncpvpevtvasvsqagikpkeelgelkkldsfgrwmdqeiggdcddslmasdsgnywntldaenddkevsSLSHHMQLemdslgpslsqeqlfsirdfspdwaysgaETKVLIIGMFLgtkklssdtkwgcmfgeievpaevltdnvircqapshaagrvpfyitgsnrlacsevrefeyrekpskagypvaskiapeDEVRLQTRLAKFLyldperkwfdctiedcnkcklkNTIYSmrgdsekdwgrvdespmaiegdcpnsRDKLIQNLLRNRLCEWLVWkiheggkgpnviddggQGVVHLAAALGyewamrpiiatgvspnfrdargrTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

maqtrryvpnqqldLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRyfrkdghrwrkkkdgktvkeaheklkagsidvLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKsgrsaadpgsqIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSqagikpkeelgelkkldSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPshaagrvpfyitGSNRLACSEVREFEyrekpskagypvaskiapedeVRLQTRLAKFlyldperkwfdctiedcnkcklkntiysmrgdsekdwGRVDESpmaiegdcpnsrDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQANSSAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPkeelgelkklDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

************LDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWR*************KLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK***************************************************************************************VAASIAGL*******QWFA******************************GHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQA***********KKLDSFGRWMDQEIGGDC***********YW**********************************LFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEY**********V***IAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMR************************RDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLL**

*********NQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRK************KLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGY**************************************************************************************************************************************************************************************************************************************************************************************************************RDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEY*E*****************EVRLQTRL***********************************************************KLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDG***************HEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGY**************************************ASIPNKIDWNGQAVS**************PSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLTDARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

****RRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKE****************************************************************************************************************************************************************************GERLITD**VH***************************************************LKKLDSFGRWMDQEIG********************************************SLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFD********CKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRIQHQHFLEGKLLLI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		713	2.2.26 [Sep-21-2011]
Q8GSA7		1032	Calmodulin-binding transc	yes	no	0.931	0.643	0.395	1e-134
Q6NPP4		1050	Calmodulin-binding transc	no	no	0.424	0.288	0.380	5e-62
Q9FY74		1007	Calmodulin-binding transc	no	no	0.253	0.179	0.564	3e-58
Q9FYG2		1016	Calmodulin-binding transc	no	no	0.345	0.242	0.371	6e-41
Q9LSP8		838	Calmodulin-binding transc	no	no	0.235	0.200	0.446	9e-35
O23463		923	Calmodulin-binding transc	no	no	0.218	0.169	0.521	4e-33
Q9Y6Y1		1673	Calmodulin-binding transc	yes	no	0.159	0.068	0.428	8e-19
A2A891		1682	Calmodulin-binding transc	yes	no	0.159	0.067	0.428	9e-19
O94983		1202	Calmodulin-binding transc	no	no	0.161	0.095	0.416	5e-17
Q80Y50		1208	Calmodulin-binding transc	no	no	0.161	0.095	0.4	3e-15

>sp\|Q8GSA7\|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1	Back alignment and function desciption

 Score =  480 bits (1235), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 289/731 (39%), Positives = 404/731 (55%), Gaps = 67/731 (9%)

Query: 1   MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLF 60
           MA+ RR+ P  +LD+ QIL EA++RWLRP EICEIL+NYQ+F ++ +PP  P +GS+F+F
Sbjct: 1   MAEARRFSPVHELDVGQILSEARHRWLRPPEICEILQNYQRFQISTEPPTTPSSGSVFMF 60

Query: 61  DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWML 120
           DRK LRYFRKDGH WRKKKDGKTVKEAHE+LKAGS+DVLHCYYAHG+DNENFQRRSYW+L
Sbjct: 61  DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL 120

Query: 121 DGQLEHIVLVHYREVKEGYKS------------GRSAADPGSQIESSQTSSARSLAQANS 168
             +L HIV VHY EVK    S             RS  + G  + S     A      N 
Sbjct: 121 QEELSHIVFVHYLEVKGSRVSTSFNRMQRTEDAARSPQETGDALTSEHDGYASCSFNQND 180

Query: 169 SAPAAQTSHASIPNKIDWNGQAVSSEFEDVDSG---HGSGT---------PSVAQSIYGS 216
            +  +QT+ ++  N         S E ED +S    HGS T         P+   ++ G 
Sbjct: 181 HSNHSQTTDSASVNGFH------SPELEDAESAYNQHGSSTAYSHQELQQPATGGNLTGF 234

Query: 217 MSQNASLVAASIAGLPELSRHPQWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQN 276
                  +    +   EL   P   +   ++  S +   P + N  +N  S+ D    + 
Sbjct: 235 DPYYQISLTPRDSYQKELRTIPVTDSSIMVDK-SKTINSPGVTNGLKNRKSI-DSQTWEE 292

Query: 277 FYVGQPSGADFI------THKLTDARLASDSTIANIGTCGERLIT--DIDVHAVTTSSQG 328
                 SG + +       H++ D  L S  T+ +  +  E ++   + ++++  TS + 
Sbjct: 293 ILGNCGSGVEALPLQPNSEHEVLDQILESSFTMQDFASLQESMVKSQNQELNSGLTSDRT 352

Query: 329 ASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPKEELGE--LKKLDSFGRWMDQEI 386
                 +   N I+N   N   P   ++++ Q  +     LGE  LKK+DSF RWM +E+
Sbjct: 353 VWFQGQDMELNAISNLASNEKAP--YLSTMKQHLLHGA--LGEEGLKKMDSFNRWMSKEL 408

Query: 387 G-----GDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHMQLEMDS--LGPSLSQEQLF 439
           G      D ++S   S S  YW  +++E+      S  H+ + +MD   + PSLS+EQLF
Sbjct: 409 GDVGVIADANESFTQSSSRTYWEEVESED-----GSNGHNSRRDMDGYVMSPSLSKEQLF 463

Query: 440 SIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAP 499
           SI DFSP WAY G E  V + G FL T++ +   +W CMFG+ EVPA+V+++ +++C AP
Sbjct: 464 SINDFSPSWAYVGCEVVVFVTGKFLKTREETEIGEWSCMFGQTEVPADVISNGILQCVAP 523

Query: 500 SHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASKIAPEDEVRLQTRLAKFLYL 559
            H AGRVPFY+T SNRLACSEVREFEY+   S+     A   +  D   L+ R  K L  
Sbjct: 524 MHEAGRVPFYVTCSNRLACSEVREFEYKVAESQVFDREADDESTID--ILEARFVKLLCS 581

Query: 560 DPERKW-FDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDESPMAIEGDCPNSRDKLIQNL 618
             E          D ++   K ++     D + D   ++E          N ++ L+Q  
Sbjct: 582 KSENTSPVSGNDSDLSQLSEKISLLLFENDDQLDQMLMNEISQ------ENMKNNLLQEF 635

Query: 619 LRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARG 678
           L+  L  WL+ KI EGGKGP+V+D+GGQGV+H AA+LGY WA+ P I  GVS +FRD  G
Sbjct: 636 LKESLHSWLLQKIAEGGKGPSVLDEGGQGVLHFAASLGYNWALEPTIIAGVSVDFRDVNG 695

Query: 679 RTALHWASYFG 689
            TALHWA++FG
Sbjct: 696 WTALHWAAFFG 706

Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q6NPP4\|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1	Back alignment and function description

>sp\|Q9FY74\|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2	Back alignment and function description

>sp\|Q9FYG2\|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1	Back alignment and function description

>sp\|Q9LSP8\|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1	Back alignment and function description

>sp\|O23463\|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2	Back alignment and function description

>sp\|Q9Y6Y1\|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4	Back alignment and function description

>sp\|A2A891\|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1	Back alignment and function description

>sp\|O94983\|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3	Back alignment and function description

>sp\|Q80Y50\|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		713
225432151		1018	PREDICTED: calmodulin-binding transcript	0.970	0.679	0.650	0.0
255556532		999	calmodulin-binding transcription activat	0.949	0.677	0.625	0.0
224112060		933	predicted protein [Populus trichocarpa]	0.894	0.683	0.623	0.0
356564670		999	PREDICTED: calmodulin-binding transcript	0.962	0.686	0.590	0.0
449485221		989	PREDICTED: calmodulin-binding transcript	0.917	0.661	0.553	0.0
449460391		890	PREDICTED: calmodulin-binding transcript	0.798	0.639	0.535	0.0
365927834		939	calmodulin-binding transcription factor	0.863	0.656	0.479	1e-169
242036649		994	hypothetical protein SORBIDRAFT_01g04448	0.887	0.636	0.422	1e-136
218192235		989	hypothetical protein OsI_10332 [Oryza sa	0.886	0.639	0.423	1e-136
357113656		1034	PREDICTED: calmodulin-binding transcript	0.931	0.642	0.423	1e-136

>gi\|225432151\|ref\|XP_002274846.1\| PREDICTED: calmodulin-binding transcription activator 1 [Vitis vinifera] gi\|297736797\|emb\|CBI25998.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/713 (65%), Positives = 541/713 (75%), Gaps = 21/713 (2%)

Query: 1   MAQTRRYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLF 60
           MA++RRYVPNQQLDLEQIL EAQ+RWLRPTEICEILRNYQKF +TPDPPV PPAGSLFLF
Sbjct: 1   MAESRRYVPNQQLDLEQILLEAQHRWLRPTEICEILRNYQKFLITPDPPVTPPAGSLFLF 60

Query: 61  DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWML 120
           DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGS+DVLHCYYAHGEDNENFQRRSYWML
Sbjct: 61  DRKALRYFRKDGHRWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWML 120

Query: 121 DGQLEHIVLVHYREVKEGYKSGRSA-----ADPGSQIESSQTSSARSLAQANSSAPAAQT 175
           D QLEHIVLVHYRE+KEGYK+  S      A P SQI + Q SSA  L+Q N+     Q 
Sbjct: 121 DEQLEHIVLVHYREIKEGYKTSTSVPRLPNAVPASQIGTIQGSSAPCLSQGNAPTVTGQI 180

Query: 176 SHASIPNKIDWNGQAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELS 235
           S+AS PN  DW+GQ +SSEFED DSG   GT S+AQ I GS+  NASL     +G   LS
Sbjct: 181 SYASSPNTADWSGQTLSSEFEDGDSGDDPGTSSLAQPILGSVFYNASLPTHEASGFAGLS 240

Query: 236 RHP--QWFAGSKINHGSGSSMWPQIDNSSRNATSVLDQHGHQNFYVGQPSGADFITHKLT 293
           R+      AG   +HG+ +S+  +I  SS   +SV DQ     F   QP+GADFIT+KLT
Sbjct: 241 RNQLGSGLAGVHFSHGASTSVQDEIHGSS---SSVHDQ----KFGFEQPNGADFITNKLT 293

Query: 294 DARLASDSTIANIGTCGERLITDIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEV 353
           DARL SD T+ N    G+ L   +D+  +T +SQ A Q  LEHNF+L++ Q QNC    V
Sbjct: 294 DARLDSDRTVQNFAARGDGLSPALDIKGLTAASQRAVQGPLEHNFHLVHPQFQNCSSSHV 353

Query: 354 TVASVSQAGIKPKEE------LGELKKLDSFGRWMDQEIGGDCDDSLMASDSGNYWNTLD 407
              S +    K KE+       GELKKLDSFGRWMD+EIGGDCDDSLMASDSGNYWNTLD
Sbjct: 354 ADTSTAHIENKSKEDGANNDASGELKKLDSFGRWMDKEIGGDCDDSLMASDSGNYWNTLD 413

Query: 408 AENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTK 467
            +NDDKEVSSLS HMQL++DSL PSLSQEQLF+I DFSPDWAYS  ETKVLIIG FLG  
Sbjct: 414 TQNDDKEVSSLSRHMQLDIDSLAPSLSQEQLFTINDFSPDWAYSEDETKVLIIGTFLGGM 473

Query: 468 KLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYR 527
           + S++TKW CMFGEIEV AEVLT+NVIRC AP HA GRVPFY+T SNRLACSEVREFEYR
Sbjct: 474 EHSTNTKWCCMFGEIEVSAEVLTNNVIRCHAPLHAPGRVPFYVTCSNRLACSEVREFEYR 533

Query: 528 EKPSKAGYPVASKIAPEDEVRLQTRLAKFLYLDPERKWFDCTIEDCNKCKLKNTIYSMRG 587
           EKPS+  + +A +  PED+V+ Q +LAK L+L  ERKW DC+IE+C+KCK+K+ IYS + 
Sbjct: 534 EKPSRVAFSMAVRSTPEDDVQFQIQLAKMLHLGQERKWLDCSIEECDKCKIKSDIYSKKD 593

Query: 588 DSEKDWGRVDESPMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQG 647
           D + DW  ++ +   I G+  N RD LI+NLL++RL EWLV K+HEG +GP+V+D  GQG
Sbjct: 594 DIKNDWEELEMAKDFI-GNHVNPRDVLIKNLLKDRLFEWLVCKVHEGVRGPHVLDGKGQG 652

Query: 648 VVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGSWEQLRVRLRI 700
           V+HLAAALGYEWAM PII  GVSPNFRDARGRT LHWASYFG  E +   +++
Sbjct: 653 VIHLAAALGYEWAMGPIIVAGVSPNFRDARGRTGLHWASYFGREETVIALVKL 705

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255556532\|ref\|XP_002519300.1\| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi\|223541615\|gb\|EEF43164.1\| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224112060\|ref\|XP_002316071.1\| predicted protein [Populus trichocarpa] gi\|222865111\|gb\|EEF02242.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356564670\|ref\|XP_003550574.1\| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|449485221\|ref\|XP_004157104.1\| PREDICTED: calmodulin-binding transcription activator 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449460391\|ref\|XP_004147929.1\| PREDICTED: calmodulin-binding transcription activator 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|365927834\|gb\|AEX07777.1\| calmodulin-binding transcription factor SR4 [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|242036649\|ref\|XP_002465719.1\| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor] gi\|241919573\|gb\|EER92717.1\| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|218192235\|gb\|EEC74662.1\| hypothetical protein OsI_10332 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|357113656\|ref\|XP_003558617.1\| PREDICTED: calmodulin-binding transcription activator 1-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		713
TAIR\|locus:2060405		1032	SR1 "signal responsive 1" [Ara	0.586	0.405	0.357	4.3e-124
TAIR\|locus:2173368		1050	AT5G64220 [Arabidopsis thalian	0.215	0.146	0.672	5e-112
TAIR\|locus:2019534		1016	AT1G67310 [Arabidopsis thalian	0.345	0.242	0.378	5.6e-76
TAIR\|locus:2130125		923	AT4G16150 [Arabidopsis thalian	0.218	0.169	0.521	5.9e-68
UNIPROTKB\|Q9Y6Y1		1673	CAMTA1 "Calmodulin-binding tra	0.159	0.068	0.428	3.8e-29
UNIPROTKB\|F1PDC5		1596	CAMTA1 "Uncharacterized protei	0.143	0.063	0.448	8.8e-27
MGI\|MGI:2140230		1682	Camta1 "calmodulin binding tra	0.159	0.067	0.428	2.3e-26
UNIPROTKB\|O94983		1202	CAMTA2 "Calmodulin-binding tra	0.161	0.095	0.416	3e-24
UNIPROTKB\|E1BH04		1196	Bt.24734 "Uncharacterized prot	0.161	0.096	0.416	3.7e-24
UNIPROTKB\|F1P8J0		1204	CAMTA2 "Uncharacterized protei	0.161	0.095	0.416	6e-24

TAIR\|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 668 (240.2 bits), Expect = 4.3e-124, Sum P(2) = 4.3e-124
 Identities = 161/450 (35%), Positives = 240/450 (53%)

Query:   256 PQIDNSSRNATSVLDQHGHQNFYVGQPSGADFIT------HKLTDARLASDSTIANIGTC 309
             P + N  +N  S+ D    +       SG + +       H++ D  L S  T+ +  + 
Sbjct:   273 PGVTNGLKNRKSI-DSQTWEEILGNCGSGVEALPLQPNSEHEVLDQILESSFTMQDFASL 331

Query:   310 GERLIT--DIDVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVTVASVSQAGIKPXX 367
              E ++   + ++++  TS +       +   N I+N   N   P ++  ++ Q  +    
Sbjct:   332 QESMVKSQNQELNSGLTSDRTVWFQGQDMELNAISNLASNEKAPYLS--TMKQHLLHGAL 389

Query:   368 XXXXXXXXDSFGRWMDQEIG-----GDCDDSLMASDSGNYWNTLDAENDDKEVSSLSHHM 422
                     DSF RWM +E+G      D ++S   S S  YW  +++E+      S  H+ 
Sbjct:   390 GEEGLKKMDSFNRWMSKELGDVGVIADANESFTQSSSRTYWEEVESED-----GSNGHNS 444

Query:   423 QLEMDS--LGPSLSQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFG 480
             + +MD   + PSLS+EQLFSI DFSP WAY G E  V + G FL T++ +   +W CMFG
Sbjct:   445 RRDMDGYVMSPSLSKEQLFSINDFSPSWAYVGCEVVVFVTGKFLKTREETEIGEWSCMFG 504

Query:   481 EIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSKAGYPVASK 540
             + EVPA+V+++ +++C AP H AGRVPFY+T SNRLACSEVREFEY+   S+     A  
Sbjct:   505 QTEVPADVISNGILQCVAPMHEAGRVPFYVTCSNRLACSEVREFEYKVAESQVFDREADD 564

Query:   541 IAPEDEVRLQTRLAKFLYLDPERKW-FDCTIEDCNKCKLKNTIYSMRGDSEKDWGRVDES 599
              +  D   L+ R  K L    E          D ++   K ++     D + D   ++E 
Sbjct:   565 ESTIDI--LEARFVKLLCSKSENTSPVSGNDSDLSQLSEKISLLLFENDDQLDQMLMNE- 621

Query:   600 PMAIEGDCPNSRDKLIQNLLRNRLCEWLVWKIHEGGKGPNVIDDGGQGVVHLAAALGYEW 659
                I  +  N ++ L+Q  L+  L  WL+ KI EGGKGP+V+D+GGQGV+H AA+LGY W
Sbjct:   622 ---ISQE--NMKNNLLQEFLKESLHSWLLQKIAEGGKGPSVLDEGGQGVLHFAASLGYNW 676

Query:   660 AMRPIIATGVSPNFRDARGRTALHWASYFG 689
             A+ P I  GVS +FRD  G TALHWA++FG
Sbjct:   677 ALEPTIIAGVSVDFRDVNGWTALHWAAFFG 706

GO:0003677 "DNA binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM;IEA

GO:0005516 "calmodulin binding" evidence=TAS;IPI

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

GO:0042742 "defense response to bacterium" evidence=IGI;IMP

GO:0010150 "leaf senescence" evidence=IMP

GO:0050832 "defense response to fungus" evidence=IGI

TAIR\|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PDC5 CAMTA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:2140230 Camta1 "calmodulin binding transcription activator 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P8J0 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		713
pfam03859		119	pfam03859, CG-1, CG-1 domain	5e-68
smart01076		118	smart01076, CG-1, CG-1 domains are highly conserve	5e-62
pfam01833		84	pfam01833, TIG, IPT/TIG domain	2e-07
cd00204		126	cd00204, ANK, ankyrin repeats; ankyrin repeats med	6e-07
pfam12796		91	pfam12796, Ank_2, Ankyrin repeats (3 copies)	3e-06
PHA03095		471	PHA03095, PHA03095, ankyrin-like protein; Provisio	4e-05
cd00204		126	cd00204, ANK, ankyrin repeats; ankyrin repeats med	6e-05
pfam13637		54	pfam13637, Ank_4, Ankyrin repeats (many copies)	6e-05
cd00204		126	cd00204, ANK, ankyrin repeats; ankyrin repeats med	6e-04
cd00102		89	cd00102, IPT, Immunoglobulin-like fold, Plexins, T	0.001

>gnl\|CDD\|217766 pfam03859, CG-1, CG-1 domain	Back alignment and domain information

 Score =  218 bits (557), Expect = 5e-68
 Identities = 80/119 (67%), Positives = 98/119 (82%)

Query: 18  ILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRK 77
           +L EA+ RWLRP EI  IL+N++K  +T +PP RPP+GSLFL++RK +RYFRKDG+ W+K
Sbjct: 1   LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60

Query: 78  KKDGKTVKEAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVK 136
           KKDGKT +EAHEKLK G ++VL+CYYAHGEDN  FQRR YW+LD  LEHIVLVHY  VK
Sbjct: 61  KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119

CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl\|CDD\|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues	Back alignment and domain information

>gnl\|CDD\|216730 pfam01833, TIG, IPT/TIG domain	Back alignment and domain information

>gnl\|CDD\|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>gnl\|CDD\|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies)	Back alignment and domain information

>gnl\|CDD\|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>gnl\|CDD\|222277 pfam13637, Ank_4, Ankyrin repeats (many copies)	Back alignment and domain information

>gnl\|CDD\|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>gnl\|CDD\|238050 cd00102, IPT, Immunoglobulin-like fold, Plexins, Transcription factors (IPT)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		713
KOG0520		975	consensus Uncharacterized conserved protein, conta	100.0
PF03859		118	CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain	100.0
cd01175		85	IPT_COE IPT domain of the COE family (Col/Olf-1/EB	99.59
KOG4412		226	consensus 26S proteasome regulatory complex, subun	99.56
PF12796		89	Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02	99.38
KOG0512		228	consensus Fetal globin-inducing factor (contains a	99.3
KOG4412		226	consensus 26S proteasome regulatory complex, subun	99.25
PF01833		85	TIG: IPT/TIG domain; InterPro: IPR002909 This fami	99.21
PF13637		54	Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A	99.21
PF13857		56	Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A	99.17
PHA02736		154	Viral ankyrin protein; Provisional	99.17
KOG0515		752	consensus p53-interacting protein 53BP/ASPP, conta	99.17
KOG0509		600	consensus Ankyrin repeat and DHHC-type Zn-finger d	99.15
PHA02743		166	Viral ankyrin protein; Provisional	99.15
PHA02875		413	ankyrin repeat protein; Provisional	99.13
KOG0509		600	consensus Ankyrin repeat and DHHC-type Zn-finger d	99.13
PHA02884		300	ankyrin repeat protein; Provisional	99.13
PHA02859		209	ankyrin repeat protein; Provisional	99.11
PHA02791		284	ankyrin-like protein; Provisional	99.11
PHA02743		166	Viral ankyrin protein; Provisional	99.11
PHA02795		437	ankyrin-like protein; Provisional	99.11
PHA02946		446	ankyin-like protein; Provisional	99.1
KOG4214		117	consensus Myotrophin and similar proteins [Transcr	99.09
PHA02741		169	hypothetical protein; Provisional	99.07
PHA02878		477	ankyrin repeat protein; Provisional	99.06
PHA03095		471	ankyrin-like protein; Provisional	99.06
PHA02859		209	ankyrin repeat protein; Provisional	99.05
KOG0508		615	consensus Ankyrin repeat protein [General function	99.04
cd01179		85	IPT_plexin_repeat2 Second repeat of the IPT domain	99.04
cd00102		89	IPT Immunoglobulin-like fold, Plexins, Transcripti	99.02
PHA02878		477	ankyrin repeat protein; Provisional	99.01
PHA02791		284	ankyrin-like protein; Provisional	99.01
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	99.01
PHA03095		471	ankyrin-like protein; Provisional	99.0
PHA02874		434	ankyrin repeat protein; Provisional	98.99
PHA02874		434	ankyrin repeat protein; Provisional	98.99
PLN03192		823	Voltage-dependent potassium channel; Provisional	98.97
PHA02798		489	ankyrin-like protein; Provisional	98.97
PHA02798		489	ankyrin-like protein; Provisional	98.97
PHA03100		480	ankyrin repeat protein; Provisional	98.96
PHA02730		672	ankyrin-like protein; Provisional	98.95
PLN03192		823	Voltage-dependent potassium channel; Provisional	98.93
KOG4177		1143	consensus Ankyrin [Cell wall/membrane/envelope bio	98.93
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	98.92
PHA02741		169	hypothetical protein; Provisional	98.92
PHA03100		480	ankyrin repeat protein; Provisional	98.91
PHA02875		413	ankyrin repeat protein; Provisional	98.88
PHA02716		764	CPXV016; CPX019; EVM010; Provisional	98.87
PHA02989		494	ankyrin repeat protein; Provisional	98.86
KOG0502		296	consensus Integral membrane ankyrin-repeat protein	98.86
PHA02989		494	ankyrin repeat protein; Provisional	98.83
PHA02716		764	CPXV016; CPX019; EVM010; Provisional	98.83
COG0666		235	Arp FOG: Ankyrin repeat [General function predicti	98.83
KOG0510		929	consensus Ankyrin repeat protein [General function	98.82
KOG1710		396	consensus MYND Zn-finger and ankyrin repeat protei	98.81
KOG0514		452	consensus Ankyrin repeat protein [General function	98.8
PHA02946		446	ankyin-like protein; Provisional	98.77
PHA02876		682	ankyrin repeat protein; Provisional	98.77
KOG0505		527	consensus Myosin phosphatase, regulatory subunit [	98.75
PHA02736		154	Viral ankyrin protein; Provisional	98.75
KOG0505		527	consensus Myosin phosphatase, regulatory subunit [	98.73
cd00603		90	IPT_PCSR IPT domain of Plexins and Cell Surface Re	98.73
PHA02876		682	ankyrin repeat protein; Provisional	98.73
PHA02917		661	ankyrin-like protein; Provisional	98.7
KOG4177		1143	consensus Ankyrin [Cell wall/membrane/envelope bio	98.69
PHA02730		672	ankyrin-like protein; Provisional	98.68
PHA02795		437	ankyrin-like protein; Provisional	98.68
KOG0508		615	consensus Ankyrin repeat protein [General function	98.67
PHA02917		661	ankyrin-like protein; Provisional	98.66
smart00429		90	IPT ig-like, plexins, transcription factors.	98.66
PHA02792		631	ankyrin-like protein; Provisional	98.65
PF13857		56	Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A	98.62
cd01180		94	IPT_plexin_repeat1 First repeat of the IPT domain	98.62
PHA02884		300	ankyrin repeat protein; Provisional	98.61
KOG0510		929	consensus Ankyrin repeat protein [General function	98.53
cd00204		126	ANK ankyrin repeats; ankyrin repeats mediate prote	98.53
KOG0502		296	consensus Integral membrane ankyrin-repeat protein	98.5
KOG0705		749	consensus GTPase-activating protein Centaurin gamm	98.48
PF12796		89	Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02	98.46
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	98.45
TIGR00870		743	trp transient-receptor-potential calcium channel p	98.44
PHA02792		631	ankyrin-like protein; Provisional	98.44
KOG0514		452	consensus Ankyrin repeat protein [General function	98.39
PF00023		33	Ank: Ankyrin repeat Hereditary spherocytosis; Inte	98.38
COG0666		235	Arp FOG: Ankyrin repeat [General function predicti	98.37
cd02849		81	CGTase_C_term Cgtase (cyclodextrin glycosyltransfe	98.34
KOG0512		228	consensus Fetal globin-inducing factor (contains a	98.32
cd01181		99	IPT_plexin_repeat3 Third repeat of the IPT domain	98.31
KOG0783		1267	consensus Uncharacterized conserved protein, conta	98.29
KOG0507		854	consensus CASK-interacting adaptor protein (caskin	98.29
PF13606		30	Ank_3: Ankyrin repeat	98.28
TIGR00870		743	trp transient-receptor-potential calcium channel p	98.28
cd00204		126	ANK ankyrin repeats; ankyrin repeats mediate prote	98.27
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	98.17
KOG0818		669	consensus GTPase-activating proteins of the GIT fa	98.07
KOG0522		560	consensus Ankyrin repeat protein [General function	98.03
KOG0506		622	consensus Glutaminase (contains ankyrin repeat) [A	98.02
PF00023		33	Ank: Ankyrin repeat Hereditary spherocytosis; Inte	98.0
cd00604		81	IPT_CGTD IPT domain (domain D) of cyclodextrin gly	97.99
KOG1710		396	consensus MYND Zn-finger and ankyrin repeat protei	97.91
PF13606		30	Ank_3: Ankyrin repeat	97.9
KOG3676		782	consensus Ca2+-permeable cation channel OSM-9 and	97.79
KOG4214		117	consensus Myotrophin and similar proteins [Transcr	97.71
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	97.57
PF13637		54	Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A	97.56
KOG0507		854	consensus CASK-interacting adaptor protein (caskin	97.56
KOG0511		516	consensus Ankyrin repeat protein [General function	97.53
KOG3676		782	consensus Ca2+-permeable cation channel OSM-9 and	97.29
KOG2384		223	consensus Major histocompatibility complex protein	97.21
KOG0782		1004	consensus Predicted diacylglycerol kinase [Signal	97.14
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	97.11
cd00602		101	IPT_TF IPT domain of eukaryotic transcription fact	96.42
smart00248		30	ANK ankyrin repeats. Ankyrin repeats are about 33	96.26
KOG0506		622	consensus Glutaminase (contains ankyrin repeat) [A	96.16
KOG0521		785	consensus Putative GTPase activating proteins (GAP	96.13
KOG0818		669	consensus GTPase-activating proteins of the GIT fa	95.94
KOG0522		560	consensus Ankyrin repeat protein [General function	95.91
KOG0521		785	consensus Putative GTPase activating proteins (GAP	95.84
KOG0783		1267	consensus Uncharacterized conserved protein, conta	95.8
KOG3610		1025	consensus Plexins (functional semaphorin receptors	95.49
KOG0515		752	consensus p53-interacting protein 53BP/ASPP, conta	95.26
cd01178		101	IPT_NFAT IPT domain of the NFAT family of transcri	95.16
cd01176		97	IPT_RBP-Jkappa IPT domain of the recombination sig	94.76
cd01177		102	IPT_NFkappaB IPT domain of the transcription facto	94.71
KOG3609		822	consensus Receptor-activated Ca2+-permeable cation	94.7
KOG0782		1004	consensus Predicted diacylglycerol kinase [Signal	94.58
smart00248		30	ANK ankyrin repeats. Ankyrin repeats are about 33	94.16
KOG0520		975	consensus Uncharacterized conserved protein, conta	93.69
KOG2505		591	consensus Ankyrin repeat protein [General function	92.77
KOG0705		749	consensus GTPase-activating protein Centaurin gamm	91.63
KOG0511		516	consensus Ankyrin repeat protein [General function	90.76
PF08549		669	SWI-SNF_Ssr4: Fungal domain of unknown function (D	90.58
KOG3836		605	consensus HLH transcription factor EBF/Olf-1 and r	87.83
KOG2505		591	consensus Ankyrin repeat protein [General function	82.65

>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=2e-105  Score=922.68  Aligned_cols=618  Identities=35%  Similarity=0.541  Sum_probs=403.9

Q ss_pred             CCCCCCcccHHHHHHHHHHhhCChHHHHHHHHcccccccCCCCCCCCCCCceEeeehhhhhhhhccccceeecCCCcchH
Q 005128            6 RYVPNQQLDLEQILQEAQYRWLRPTEICEILRNYQKFHLTPDPPVRPPAGSLFLFDRKALRYFRKDGHRWRKKKDGKTVK   85 (713)
Q Consensus         6 ~~~~~~~l~~~~~~~~~~~rwl~~~ei~~il~~~~~~~~~~~~~~~p~~gs~~l~~r~~~~~fr~dg~~w~kkk~g~~~~   85 (713)
                      -|...+.||+..|++|++.|||+|+||++||+||++|.++.+||+||.+||+||||||+|||||||||+|||||||||+|
T Consensus        16 ~~~sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~WkKkkDGKtir   95 (975)
T KOG0520|consen   16 PFKSLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHNWKKKKDGKTIR   95 (975)
T ss_pred             chhhhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchhhhhcCCCCcCh
Confidence            34556889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhcccCCEeeEEEEeeccccCccccceeeeeccCCCceEEEEeeeeccCCCCCCCCCCCCCCccccccccCcccccc
Q 005128           86 EAHEKLKAGSIDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYREVKEGYKSGRSAADPGSQIESSQTSSARSLAQ  165 (713)
Q Consensus        86 e~h~~lk~~~~~~~~~~y~h~~~~~~f~rr~y~~l~~~~~~ivlvhy~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~  165 (713)
                      ||||||||||+|+||||||||++||||||||||||++.++||||||||||++.+...+......+.+-|-   ..     
T Consensus        96 EaHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~~~~~~~~~~s~~sd---~~-----  167 (975)
T KOG0520|consen   96 EAHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDAAKGAGEIFSSIISD---KA-----  167 (975)
T ss_pred             HHHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeecccccccccCccccccccccc---cc-----
Confidence            9999999999999999999999999999999999999999999999999996443222222211111000   00     


Q ss_pred             cCCCCCccCCCCCCCccccccCC-cccccccccccCCCCCCCCCccccccccccccchhhhhcccCCccccCCCCcccCC
Q 005128          166 ANSSAPAAQTSHASIPNKIDWNG-QAVSSEFEDVDSGHGSGTPSVAQSIYGSMSQNASLVAASIAGLPELSRHPQWFAGS  244 (713)
Q Consensus       166 ~~s~~~~~~~~~~~s~~~~~~~~-~~~~se~ed~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (713)
                          .+..+..+..+|    .-- +.  +..+|+++++..+.+..+.+..|.                            
T Consensus       168 ----~S~~~~~~q~~~----~~~~~~--s~~~~v~~i~s~~~~~~~g~~~~~----------------------------  209 (975)
T KOG0520|consen  168 ----WSLNQLAGQLSP----IFHNHS--SVNEDVAEINSNQTGNALGSVFGN----------------------------  209 (975)
T ss_pred             ----ccHHHhhcccCc----chhccc--chHHHHHHHhhhccccccccccCc----------------------------
Confidence                011133333333    100 11  447777776655443333222110                            


Q ss_pred             CCCCCCCCCCCCCCCCCc-cccccccccCCCCCcccCCCCCccccc--cccccc----ccccCccccccCccccccccc-
Q 005128          245 KINHGSGSSMWPQIDNSS-RNATSVLDQHGHQNFYVGQPSGADFIT--HKLTDA----RLASDSTIANIGTCGERLITD-  316 (713)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~-w~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~----~~~~~~~~~~~~~~~~~~~~~-  316 (713)
                        ...|.. +++..+... |..+...+..    ..+..|....+..  +.....    ....... .|.+....+.+.+ 
T Consensus       210 --s~~h~i-~~~~~~s~~~~~~~p~s~~s----~~~~~~~~~~~~~~~~~~~~rs~~~s~~te~l-~n~~~~~~~~g~s~  281 (975)
T KOG0520|consen  210 --SRNHRI-RLHEVNSLDPLYKLPVSDDS----LNLSAPKPIDLPKGPTSVKQRSSSPSYFTEIL-GNAPSGLVSQGNSL  281 (975)
T ss_pred             --chhhhh-cccccCCccccccccccCCc----cccccCCCcccccCCcchhhcCCCCcchhhhc-ccCCCccccccccc
Confidence              000000 011111111 2222222110    0000000000000  000000    0000000 0000000000000 


Q ss_pred             -c---ccccccccccccchhhhccccccccccccCCCCCccc--cc----cccc-cC---CCCcc--ccccccccCcchh
Q 005128          317 -I---DVHAVTTSSQGASQVLLEHNFNLINNQCQNCPVPEVT--VA----SVSQ-AG---IKPKE--ELGELKKLDSFGR  380 (713)
Q Consensus       317 -~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~----~~~~-~~---~~~~~--~~~~lkk~dSf~r  380 (713)
                       +   ....|+.........+.-.+|..+++...........  ..    ..+. ..   ...+.  .++|||+.|||+|
T Consensus       282 s~~l~~i~~~~~~~~~~~~~p~~~nf~~~ss~~s~~~~~~~g~g~~~~~~sa~~~~~P~~~~~~~~~~~~~l~sgdsf~~  361 (975)
T KOG0520|consen  282 SSSLQRISSFTGLDNAAYEQPNSQNFEPNSSLNSHVTGQSYGQGLQARSPSATSESRPITSAADAALSELGLKSGDSFSR  361 (975)
T ss_pred             ccchhhcccccccccccccCCccccccccccCCCCccccccCccccCCCcccccccCCcchhhccccccccccccccccc
Confidence             0   0001110000000000001111111111000000000  00    0000 11   11221  2789999999999


Q ss_pred             hhhhhhccCcCCCcccCCC-CCcccccccccCCcccccccccccccccccCCCcccCCceEEEeecCCCccCCCCeEEEE
Q 005128          381 WMDQEIGGDCDDSLMASDS-GNYWNTLDAENDDKEVSSLSHHMQLEMDSLGPSLSQEQLFSIRDFSPDWAYSGAETKVLI  459 (713)
Q Consensus       381 wm~~el~~~~~~~~~~~ss-~~~w~~~~~~~~~~~~s~~~~~~~ld~~~~~~s~sq~qlfsI~d~SP~wgy~~ggtKVlI  459 (713)
                      ||+ .+++ ..|.. ++++ +.+|....  +...+.+          ..++|| +++|+|+|+||||+|+|++||+||+|
T Consensus       362 ~~~-t~~e-~~d~~-q~~s~~~~~~p~~--~~~~~~~----------s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV  425 (975)
T KOG0520|consen  362 WAS-TFGE-ISDLG-QDPSGEAVWTPEN--DPMGPPG----------SFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLV  425 (975)
T ss_pred             hhh-hhcc-cccCC-CCCccccccccCC--CcCCCcc----------cccCCC-CCcceeeeeccCcccccCCCCcEEEE
Confidence            996 7777 44444 3333 55676662  2222221          226777 44999999999999999999999999


Q ss_pred             EeccccCCCCCCCCceEEEeCCeecceEeeecceeeeecCCCCCceeEEEEEeC-CccccccceeeeecCCCCCCCCCcc
Q 005128          460 IGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGS-NRLACSEVREFEYREKPSKAGYPVA  538 (713)
Q Consensus       460 ~G~f~~~~~~~~~~~~~cmFGd~eVpaei~q~GVLrC~~PPh~pG~V~l~Vt~~-n~~~cSev~eFEYr~~~~~~~~~~~  538 (713)
                      +|.+    ++.+..+|+||||+++|||++||+|||||+||||.||+|+|||+|+ ++.+|||+|+|+|...+.+..+..+
T Consensus       426 ~G~~----~~~~~~~ysc~Fg~~~VPAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s  501 (975)
T KOG0520|consen  426 TGFP----QDETRSNYSCMFGEQRVPAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLS  501 (975)
T ss_pred             ecCc----cccCCCceEEEeCCccccHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccc
Confidence            9983    4557889999999999999999999999999999999999999999 9999999999999998887765433


Q ss_pred             ccCCChHHHHHHHHHHHhhccCC-ccccccccccccchhh--hhHHHhhhccCCCccccc-cccCcccccCCC---CchH
Q 005128          539 SKIAPEDEVRLQTRLAKFLYLDP-ERKWFDCTIEDCNKCK--LKNTIYSMRGDSEKDWGR-VDESPMAIEGDC---PNSR  611 (713)
Q Consensus       539 ~~~~~~~E~~Lq~Rl~~LL~l~~-~~~~~~~s~~~~ek~~--l~~ki~sl~~~~~d~w~~-l~dalk~~~~~~---~~~~  611 (713)
                      . .....++.|+.|+..|+.-.. .......++...+..+  ++.++..+    .++|.. +   ++...++.   ..++
T Consensus       502 ~-~d~~~~~sl~~rl~~~~~r~~~~~~s~~~~~n~~~~~~~~l~skv~~l----~~~~~~r~---~~~~~~~~~~~~~~r  573 (975)
T KOG0520|consen  502 W-EDFLFQMSLLHRLETMLNRKQSILSSKPSTENTSDAESGNLASKVVHL----LNEWAYRL---LKSISENLSSSVNFR  573 (975)
T ss_pred             c-ccchhhhHHHHHHHHHHHHhHhHhhccCCccccccccchhHHHHHHHH----HHHHHHHH---HhhHhhhccccCCCc
Confidence            1 222333445555555544111 1122344455555555  77777766    456766 5   33333332   7889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhC-CCCCCcccCCCCcHHHHHHHhCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHHcCC
Q 005128          612 DKLIQNLLRNRLCEWLVWKIHEG-GKGPNVIDDGGQGVVHLAAALGYEWAMRPIIATGVSPNFRDARGRTALHWASYFGS  690 (713)
Q Consensus       612 d~LLq~lLk~kl~ewLvekLle~-Gad~N~~D~~G~TpLHlAA~lG~~~~V~lLL~~GadvN~rD~~G~TPLH~Aa~~G~  690 (713)
                      +.+|+.++++.+++||++++++- |......|.+|++.+|++|.+|+.|++.+++..|..++++|.+||||||||+.+||
T Consensus       574 ~~lllhL~a~~lyawLie~~~e~~~~~~~eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~  653 (975)
T KOG0520|consen  574 DMLLLHLLAELLYAWLIEKVIEWAGSGDLELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGR  653 (975)
T ss_pred             chHHHHHHHHHhHHHHHHHHhcccccCchhhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCH
Confidence            99999999999999999999996 88888999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCcc
Q 005128          691 WEQLRVRLRIQHQHF  705 (713)
Q Consensus       691 ~eiV~lLL~~GADi~  705 (713)
                      +++++.|++.|++.-
T Consensus       654 e~l~a~l~~lga~~~  668 (975)
T KOG0520|consen  654 EKLVASLIELGADPG  668 (975)
T ss_pred             HHHHHHHHHhccccc
Confidence            999999999998754

>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []	Back alignment and domain information

>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors	Back alignment and domain information

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain	Back alignment and domain information

>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription]	Back alignment and domain information

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold	Back alignment and domain information

>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A	Back alignment and domain information

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A	Back alignment and domain information

>PHA02736 Viral ankyrin protein; Provisional	Back alignment and domain information

>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]	Back alignment and domain information

>PHA02743 Viral ankyrin protein; Provisional	Back alignment and domain information

>PHA02875 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]	Back alignment and domain information

>PHA02884 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02859 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02791 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02743 Viral ankyrin protein; Provisional	Back alignment and domain information

>PHA02795 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02946 ankyin-like protein; Provisional	Back alignment and domain information

>KOG4214 consensus Myotrophin and similar proteins [Transcription]	Back alignment and domain information

>PHA02741 hypothetical protein; Provisional	Back alignment and domain information

>PHA02878 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA03095 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02859 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0508 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR)	Back alignment and domain information

>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT)	Back alignment and domain information

>PHA02878 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02791 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>PHA03095 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02874 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02874 ankyrin repeat protein; Provisional	Back alignment and domain information

>PLN03192 Voltage-dependent potassium channel; Provisional	Back alignment and domain information

>PHA02798 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02798 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA03100 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02730 ankyrin-like protein; Provisional	Back alignment and domain information

>PLN03192 Voltage-dependent potassium channel; Provisional	Back alignment and domain information

>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>PHA02741 hypothetical protein; Provisional	Back alignment and domain information

>PHA03100 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02875 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02716 CPXV016; CPX019; EVM010; Provisional	Back alignment and domain information

>PHA02989 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only]	Back alignment and domain information

>PHA02989 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02716 CPXV016; CPX019; EVM010; Provisional	Back alignment and domain information

>COG0666 Arp FOG: Ankyrin repeat [General function prediction only]	Back alignment and domain information

>KOG0510 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0514 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02946 ankyin-like protein; Provisional	Back alignment and domain information

>PHA02876 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PHA02736 Viral ankyrin protein; Provisional	Back alignment and domain information

>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins	Back alignment and domain information

>PHA02876 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02917 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PHA02730 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02795 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0508 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02917 ankyrin-like protein; Provisional	Back alignment and domain information

>smart00429 IPT ig-like, plexins, transcription factors	Back alignment and domain information

>PHA02792 ankyrin-like protein; Provisional	Back alignment and domain information

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A	Back alignment and domain information

>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR)	Back alignment and domain information

>PHA02884 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0510 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only]	Back alignment and domain information

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]	Back alignment and domain information

>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00870 trp transient-receptor-potential calcium channel protein	Back alignment and domain information

>PHA02792 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0514 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature	Back alignment and domain information

>COG0666 Arp FOG: Ankyrin repeat [General function prediction only]	Back alignment and domain information

>cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain	Back alignment and domain information

>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription]	Back alignment and domain information

>cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR)	Back alignment and domain information

>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]	Back alignment and domain information

>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms]	Back alignment and domain information

>PF13606 Ank_3: Ankyrin repeat	Back alignment and domain information

>TIGR00870 trp transient-receptor-potential calcium channel protein	Back alignment and domain information

>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0522 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism]	Back alignment and domain information

>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature	Back alignment and domain information

>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes	Back alignment and domain information

>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PF13606 Ank_3: Ankyrin repeat	Back alignment and domain information

>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG4214 consensus Myotrophin and similar proteins [Transcription]	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A	Back alignment and domain information

>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0511 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only]	Back alignment and domain information

>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and recombination signal J-kappa binding protein (RBP-Jkappa)	Back alignment and domain information

>smart00248 ANK ankyrin repeats	Back alignment and domain information

>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0522 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]	Back alignment and domain information

>KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors	Back alignment and domain information

>cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa)	Back alignment and domain information

>cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors	Back alignment and domain information

>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]	Back alignment and domain information

>smart00248 ANK ankyrin repeats	Back alignment and domain information

>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown]	Back alignment and domain information

>KOG2505 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0511 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PF08549 SWI-SNF_Ssr4: Fungal domain of unknown function (DUF1750); InterPro: IPR013859 This is a fungal protein of unknown function	Back alignment and domain information

>KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription]	Back alignment and domain information

>KOG2505 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		713
2cxk_A		95	Crystal Structure Of The Tig Domain Of Human Calmod		2e-09
4hb5_A		169	Crystal Structure Of Engineered Protein. Northeast		8e-05
4gmr_A		169	Crystal Structure Of Engineered Protein. Northeast		3e-04
4atz_D		154	Ad5 Knob In Complex With A Designed Ankyrin Repeat		5e-04

>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95

Back alignment and structure

Iteration: 1

Score = 61.6 bits (148), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 6/93 (6%) Query: 441 IRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPS 500 + D+SP+W+Y KVLI G + + + C+F +I VPA ++ V+RC P+ Sbjct: 9 VTDYSPEWSYPEGGVKVLITGPWQ-----EASNNYSCLFDQISVPASLIQPGVLRCYCPA 63 Query: 501 HAAGRVPFYITGSNRLACSEVREFEYREKPSKA 533 H G V + +N++ + V FEY+ PS Sbjct: 64 HDTGLVTLQVAFNNQIISNSVV-FEYKSGPSSG 95

PyMOL of 2cxk

>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169

Back alignment and structure

>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169

Back alignment and structure

>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		713
2cxk_A		95	Camta1, calmodulin binding transcription activator	1e-36
3muj_A		138	Transcription factor COE3; immunoglobulin like fol	3e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
3mlp_A		402	Transcription factor COE1; transcription factor, p	2e-06
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	2e-05
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	3e-05
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	1e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	2e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	4e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	5e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	6e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	7e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	9e-04
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	2e-05
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	2e-04
2uzx_B		727	Hepatocyte growth factor receptor; signaling prote	2e-05
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	5e-05
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	5e-04
1s70_B		299	130 kDa myosin-binding subunit of smooth muscle my	6e-05
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	7e-05
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	9e-05
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	3e-04
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	7e-04
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	1e-04
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	6e-04
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	1e-04
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	1e-04
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	2e-04
3hra_A		201	Ankyrin repeat family protein; structural protein;	1e-04
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	1e-04
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	4e-04
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	1e-04
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	6e-04
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	1e-04
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	4e-04
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	7e-04
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	2e-04
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	2e-04
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	2e-04
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	5e-04
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	2e-04
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	5e-04
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	8e-04
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	2e-04
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	7e-04
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	2e-04
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	3e-04
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	8e-04
3b7b_A		237	Euchromatic histone-lysine N-methyltransferase 1;	3e-04
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	3e-04
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	9e-04
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	4e-04
3d9h_A		285	CDNA FLJ77766, highly similar to HOMO sapiens anky	4e-04
3v30_A		172	DNA-binding protein rfxank; structural genomics co	7e-04
3aji_A		231	26S proteasome non-ATPase regulatory subunit 10; g	8e-04

>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95	Back alignment and structure

 Score =  131 bits (330), Expect = 1e-36
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 6/99 (6%)

Query: 434 SQEQLFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNV 493
           S      + D+SP+W+Y     KVLI G +       +   + C+F +I VPA ++   V
Sbjct: 2   SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQ-----EASNNYSCLFDQISVPASLIQPGV 56

Query: 494 IRCQAPSHAAGRVPFYITGSNRLACSEVREFEYREKPSK 532
           +RC  P+H  G V   +  +N++  + V  FEY+  PS 
Sbjct: 57  LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEYKSGPSS 94

PyMOL of 2cxk

>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A Length = 402	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156	Back alignment and structure

>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A Length = 727	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222	Back alignment and structure

>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179	Back alignment and structure

>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351	Back alignment and structure

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327	Back alignment and structure

>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285	Back alignment and structure

>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172	Back alignment and structure

>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		713
2cxk_A		95	Camta1, calmodulin binding transcription activator	99.93
1n0q_A		93	3ANK, 3 ankyrin repeats; structural protein; 1.26A	99.56
3aaa_C		123	Myotrophin, protein V-1; actin capping protein, ba	99.53
4gpm_A		169	Engineered protein OR264; de novo protein, structu	99.53
4gpm_A		169	Engineered protein OR264; de novo protein, structu	99.51
2jab_A		136	H10-2-G3; HER2, darpin, ankyrin repeat protein, me	99.47
3c5r_A		137	BARD-1, BRCA1-associated ring domain protein 1; an	99.46
4b93_B		269	Ankyrin repeat domain-containing protein 27; endoc	99.43
3twr_A		165	Tankyrase-2; ankyrin repeat, protein-protein inter	99.43
1ycs_B		239	53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres	99.42
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	99.41
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	99.41
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	99.41
1awc_B		153	Protein (GA binding protein beta 1); complex (tran	99.41
2l6b_A		115	NR1C; ankyrin, consensus, repeat protein, ising mo	99.41
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	99.4
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	99.4
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	99.39
3v30_A		172	DNA-binding protein rfxank; structural genomics co	99.38
2y1l_E		169	Darpin-8.4; hydrolase-inhibitor complex, DEVD darp	99.37
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	99.37
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	99.36
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	99.36
2vge_A		229	RELA-associated inhibitor; iaspp, nucleus, apoptos	99.36
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	99.36
2y1l_E		169	Darpin-8.4; hydrolase-inhibitor complex, DEVD darp	99.35
1n0r_A		126	4ANK, 4 ankyrin repeats; structural protein; 1.50A	99.35
1n0r_A		126	4ANK, 4 ankyrin repeats; structural protein; 1.50A	99.35
1ihb_A		162	P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit	99.35
1n0q_A		93	3ANK, 3 ankyrin repeats; structural protein; 1.26A	99.34
2rfm_A		192	Putative ankyrin repeat protein TV1425; ANK repeat	99.34
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	99.34
1ihb_A		162	P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit	99.33
2jab_A		136	H10-2-G3; HER2, darpin, ankyrin repeat protein, me	99.33
1s70_B		299	130 kDa myosin-binding subunit of smooth muscle my	99.32
2zgd_A		110	3 repeat synthetic ankyrin; ankyrin repeat, hydrox	99.31
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	99.31
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	99.31
4g8k_A		337	2-5A-dependent ribonuclease; ankyrin-repeat domain	99.31
2dzn_A		228	Probable 26S proteasome regulatory subunit P28; an	99.3
1dcq_A		278	PYK2-associated protein beta; zinc-binding module,	99.3
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	99.29
1k1a_A		241	B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa	99.29
1awc_B		153	Protein (GA binding protein beta 1); complex (tran	99.29
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	99.29
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	99.29
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	99.29
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	99.29
3twr_A		165	Tankyrase-2; ankyrin repeat, protein-protein inter	99.27
1dcq_A		278	PYK2-associated protein beta; zinc-binding module,	99.27
3aji_A		231	26S proteasome non-ATPase regulatory subunit 10; g	99.27
3c5r_A		137	BARD-1, BRCA1-associated ring domain protein 1; an	99.27
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	99.26
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	99.26
2rfm_A		192	Putative ankyrin repeat protein TV1425; ANK repeat	99.26
4hbd_A		276	KN motif and ankyrin repeat domain-containing Pro;	99.26
3v30_A		172	DNA-binding protein rfxank; structural genomics co	99.26
2b0o_E		301	UPLC1; arfgap, structural genomics, structural gen	99.25
3b7b_A		237	Euchromatic histone-lysine N-methyltransferase 1;	99.24
3jxi_A		260	Vanilloid receptor-related osmotically activated p	99.24
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	99.23
2etb_A		256	Transient receptor potential cation channel subfam	99.23
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	99.22
3jue_A		368	Arfgap with coiled-coil, ANK repeat and PH domain	99.22
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	99.21
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	99.21
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	99.21
2zgd_A		110	3 repeat synthetic ankyrin; ankyrin repeat, hydrox	99.2
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	99.2
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	99.2
2rfa_A		232	Transient receptor potential cation channel subfa	99.2
2rfa_A		232	Transient receptor potential cation channel subfa	99.2
3aji_A		231	26S proteasome non-ATPase regulatory subunit 10; g	99.19
2b0o_E		301	UPLC1; arfgap, structural genomics, structural gen	99.19
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	99.19
2dzn_A		228	Probable 26S proteasome regulatory subunit P28; an	99.19
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	99.18
3muj_A		138	Transcription factor COE3; immunoglobulin like fol	99.18
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	99.17
2pnn_A		273	Transient receptor potential cation channel subfa	99.17
4b93_B		269	Ankyrin repeat domain-containing protein 27; endoc	99.17
4g8k_A		337	2-5A-dependent ribonuclease; ankyrin-repeat domain	99.17
3d9h_A		285	CDNA FLJ77766, highly similar to HOMO sapiens anky	99.16
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	99.16
3hra_A		201	Ankyrin repeat family protein; structural protein;	99.16
3d9h_A		285	CDNA FLJ77766, highly similar to HOMO sapiens anky	99.16
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	99.16
4hbd_A		276	KN motif and ankyrin repeat domain-containing Pro;	99.15
2l6b_A		115	NR1C; ankyrin, consensus, repeat protein, ising mo	99.15
3kea_A		285	K1L; tropism, ANK repeat, viral protein; 2.30A {Va	99.15
2vge_A		229	RELA-associated inhibitor; iaspp, nucleus, apoptos	99.15
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	99.15
2etb_A		256	Transient receptor potential cation channel subfam	99.15
2pnn_A		273	Transient receptor potential cation channel subfa	99.15
3hra_A		201	Ankyrin repeat family protein; structural protein;	99.14
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	99.14
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	99.13
3jxi_A		260	Vanilloid receptor-related osmotically activated p	99.12
1s70_B		299	130 kDa myosin-binding subunit of smooth muscle my	99.12
1ycs_B		239	53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres	99.11
1k1a_A		241	B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa	99.1
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	99.1
3b7b_A		237	Euchromatic histone-lysine N-methyltransferase 1;	99.09
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	99.09
2fo1_E		373	LIN-12 protein; beta-barrel, protein-DNA complex,	99.08
3kea_A		285	K1L; tropism, ANK repeat, viral protein; 2.30A {Va	99.06
2fo1_E		373	LIN-12 protein; beta-barrel, protein-DNA complex,	99.05
3jue_A		368	Arfgap with coiled-coil, ANK repeat and PH domain	99.05
3aaa_C		123	Myotrophin, protein V-1; actin capping protein, ba	99.05
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	99.03
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	99.02
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	99.02
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	99.0
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	98.96
3mlp_A		402	Transcription factor COE1; transcription factor, p	98.84
2aja_A		376	Ankyrin repeat family protein; NESG, Q5ZSV0, struc	98.52
2aja_A		376	Ankyrin repeat family protein; NESG, Q5ZSV0, struc	98.47
1uad_C		99	RSEC5, exocyst complex component SEC5; small GTP-b	98.16
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	98.03
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	97.84
3kya_A		496	Putative phosphatase; structural genomics, joint c	97.79
2uzx_B		727	Hepatocyte growth factor receptor; signaling prote	97.54
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.52
2uzx_B		727	Hepatocyte growth factor receptor; signaling prote	97.28
2yrp_A		114	Nuclear factor of activated T-cells, cytoplasmic 4	97.13
1ikn_C		119	P50D, protein (NF-kappa-B P50D subunit); transcrip	95.19
1my7_A		114	NF-kappab P65 (RELA) subunit; immunoglobulin, IG,	94.84
1u36_A		106	DNA-binding, nuclear factor NF-kappa-B P105 subuni	94.63
1zk9_A		110	Transcription factor RELB; NF-KB, transcription fa	94.09
1oy3_C		136	Transcription factor P65; protein-protein complex,	93.1
3iag_C		422	Recombining binding protein suppressor of hairless	92.67
1a3q_A		285	Protein (nuclear factor kappa-B P52); transcriptio	90.55
2v2t_A		288	RELB, transcription factor RELB; 4-diphosphocytidy	90.47
3orj_A		439	Sugar-binding protein; structural genomics, joint	90.14
1ikn_A		286	P65, protein (NF-kappa-B P65 subunit); transcripti	89.34
1nfk_A		325	Protein (nuclear factor kappa-B (NF-KB)); NF-KB P5	89.31
1p7h_L		286	Nuclear factor of activated T-cells, cytoplasmic 2	88.84
1svc_P		365	Protein (nuclear factor kappa-B (NF-KB)); DNA-bind	88.5
2o61_A		540	Transcription factor P65/interferon regulatory FA	87.08
1gji_A		275	C-REL protein, C-REL proto-oncogene protein; NF-KB	85.96
1imh_C		281	NF-AT5, tonebp, nuclear factor of activated T cell	85.85

>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1	Back alignment and structure

Probab=99.93  E-value=1.2e-26  Score=206.67  Aligned_cols=88  Identities=34%  Similarity=0.719  Sum_probs=81.2

Q ss_pred             ceEEEeecCCCccCCCCeEEEEEeccccCCCCCCCCceEEEeCCeecceEeeecceeeeecCCCCCceeEEEEEeCCccc
Q 005128          438 LFSIRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLA  517 (713)
Q Consensus       438 lfsI~d~SP~wgy~~ggtKVlI~G~f~~~~~~~~~~~~~cmFGd~eVpaei~q~GVLrC~~PPh~pG~V~l~Vt~~n~~~  517 (713)
                      +++|+||+|+|||..|||||+|+|.||..     ..+|.||||+++||++++++|+|||++|||.||+|+|+|+|+++..
T Consensus         6 ~~~Itd~sP~~gp~sGGTkv~I~G~~L~~-----gs~~~~~fG~~~vpa~~~s~~vl~C~tPp~~~G~v~~~v~~d~~~~   80 (95)
T 2cxk_A            6 SGMVTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQII   80 (95)
T ss_dssp             CSCCCEEECSEECTTCCCEEEEESSCCCC-----SSCEEEEETTEEEECEEEETTEEEEECCCCCSEEEEEEEEETTEEC
T ss_pred             cEEEEEECCCcccCCCCEEEEEEeECCCC-----CccEEEEECCEEEeEEEeECCEEEEEecCCCCceEeEEEEECCeec
Confidence            56899999999999999999999999965     4589999999999999999999999999999999999999998874


Q ss_pred             cccceeeeecCCCC
Q 005128          518 CSEVREFEYREKPS  531 (713)
Q Consensus       518 cSev~eFEYr~~~~  531 (713)
                       |++++||||+.+.
T Consensus        81 -s~~~~FeY~~~Pt   93 (95)
T 2cxk_A           81 -SNSVVFEYKSGPS   93 (95)
T ss_dssp             -SCCEEEEECCC--
T ss_pred             -CCceEEEEeCCCC
Confidence             9999999998654

PyMOL of 2cxk

>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1	Back alignment and structure

>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A	Back alignment and structure

>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A	Back alignment and structure

>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A	Back alignment and structure

>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C	Back alignment and structure

>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1	Back alignment and structure

>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens}	Back alignment and structure

>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S*	Back alignment and structure

>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A	Back alignment and structure

>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1	Back alignment and structure

>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli}	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1	Back alignment and structure

>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A	Back alignment and structure

>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C*	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A	Back alignment and structure

>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens}	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D	Back alignment and structure

>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C*	Back alignment and structure

>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1	Back alignment and structure

>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1	Back alignment and structure

>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A	Back alignment and structure

>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1	Back alignment and structure

>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A	Back alignment and structure

>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A	Back alignment and structure

>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C	Back alignment and structure

>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1	Back alignment and structure

>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus}	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A	Back alignment and structure

>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A*	Back alignment and structure

>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A	Back alignment and structure

>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A	Back alignment and structure

>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A	Back alignment and structure

>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A	Back alignment and structure

>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S*	Back alignment and structure

>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1	Back alignment and structure

>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A	Back alignment and structure

>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1	Back alignment and structure

>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E*	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis}	Back alignment and structure

>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens}	Back alignment and structure

>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A	Back alignment and structure

>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens}	Back alignment and structure

>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A*	Back alignment and structure

>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A*	Back alignment and structure

>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus}	Back alignment and structure

>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major}	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B	Back alignment and structure

>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E	Back alignment and structure

>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus}	Back alignment and structure

>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus}	Back alignment and structure

>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A	Back alignment and structure

>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens}	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E	Back alignment and structure

>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A	Back alignment and structure

>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A*	Back alignment and structure

>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens}	Back alignment and structure

>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A*	Back alignment and structure

>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens}	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis}	Back alignment and structure

>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens}	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis}	Back alignment and structure

>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens}	Back alignment and structure

>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli}	Back alignment and structure

>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus}	Back alignment and structure

>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens}	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D	Back alignment and structure

>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A	Back alignment and structure

>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A*	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis}	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major}	Back alignment and structure

>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A*	Back alignment and structure

>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1	Back alignment and structure

>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B	Back alignment and structure

>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A	Back alignment and structure

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1	Back alignment and structure

>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A*	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A	Back alignment and structure

>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1	Back alignment and structure

>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus}	Back alignment and structure

>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1	Back alignment and structure

>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A	Back alignment and structure

>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens}	Back alignment and structure

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens}	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A	Back alignment and structure

>3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A	Back alignment and structure

>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1	Back alignment and structure

>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1	Back alignment and structure

>1uad_C RSEC5, exocyst complex component SEC5; small GTP-binding protein, immunogloblin-like fold, beta- sandwich, endocytosis/exocytosis complex; HET: GNP; 2.10A {Rattus norvegicus} SCOP: b.1.18.18 PDB: 1hk6_A	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A	Back alignment and structure

>2yrp_A Nuclear factor of activated T-cells, cytoplasmic 4; beta-sandwich, immunoglobulin-like fold, TIG domain, IPT domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ikn_C P50D, protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1	Back alignment and structure

>1my7_A NF-kappab P65 (RELA) subunit; immunoglobulin, IG, beta-sandwich, beta-sheet, homodimerdna- binding, transcription regulation, activator; 1.49A {Mus musculus} SCOP: b.1.18.1 PDB: 1my5_A 1bft_A	Back alignment and structure

>1u36_A DNA-binding, nuclear factor NF-kappa-B P105 subunit; transcription factor, NF-KB, dimerization domain, intertwined folding; 1.89A {Mus musculus} SCOP: b.1.18.1 PDB: 1u3z_A 1u3y_A 3jv4_B 1bfs_A 1u3j_A 1u42_A 1u41_A 1nfi_B	Back alignment and structure

>1zk9_A Transcription factor RELB; NF-KB, transcription factors, intertwined dimer; 2.18A {Mus musculus} PDB: 1zka_A 3jv6_A 3jv4_A 3jss_A 3juz_A 3jv0_A	Back alignment and structure

>1oy3_C Transcription factor P65; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: b.1.18.1 PDB: 1k3z_A	Back alignment and structure

>3iag_C Recombining binding protein suppressor of hairless; protein-DNA complex, signaling, transcription, notch, activator, alternative splicing; HET: XYL; 2.00A {Mus musculus} PDB: 3brg_C* 3nbn_A 2f8x_C 3v79_C*	Back alignment and structure

>1a3q_A Protein (nuclear factor kappa-B P52); transcription factor, immune response, DNA-protein complex, transcription/DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 3do7_B 3jv6_B 3jv5_A	Back alignment and structure

>2v2t_A RELB, transcription factor RELB; 4-diphosphocytidyl-2C-methyl-D-erythritol, aquifex aeolicus, nucleotide-binding, isoprene biosynthesis; 3.05A {Mus musculus} PDB: 3do7_A	Back alignment and structure

>3orj_A Sugar-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.16A {Bacteroides ovatus}	Back alignment and structure

>1ikn_A P65, protein (NF-kappa-B P65 subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 1nfi_A 2ram_A* 1ram_A* 2i9t_A 1lei_A* 1le9_A 1le5_A* 1vkx_A* 3gut_A	Back alignment and structure

>1nfk_A Protein (nuclear factor kappa-B (NF-KB)); NF-KB P50, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 2v2t_B 1ooa_A 1lei_B* 1le9_B 1le5_B* 2i9t_B 1vkx_B* 3gut_B 2o61_B	Back alignment and structure

>1p7h_L Nuclear factor of activated T-cells, cytoplasmic 2; DNA binding protein, transcription regulation, activator, transcription/DNA complex; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 2o93_L 1a02_N* 1pzu_B 1owr_M 2as5_N 1s9k_C 3qrf_N 1nfa_A 1a66_A*	Back alignment and structure

>1svc_P Protein (nuclear factor kappa-B (NF-KB)); DNA-binding, transcription regulation, activator, nuclear protein, phosphorylation, repeat, DNA; HET: DNA; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3	Back alignment and structure

>2o61_A Transcription factor P65/interferon regulatory FA 7/interferon regulatory factor...; protein-DNA complex, transcription-DNA complex; 2.80A {Homo sapiens}	Back alignment and structure

>1gji_A C-REL protein, C-REL proto-oncogene protein; NF-KB/DNA complex, transcription factor, C-REL homodimer, transcription/DNA complex; 2.85A {Gallus gallus} SCOP: b.1.18.1 b.2.5.3	Back alignment and structure

>1imh_C NF-AT5, tonebp, nuclear factor of activated T cells 5; beta barrel, protein-DNA complex, double helix, DNA encirclement, transcription/DNA complex; 2.86A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		713
d2cxka1		82	b.1.18.1 (A:872-953) Calmodulin binding transcript	4e-12
d1cxla1		87	b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotran	1e-07
d3bmva1		83	b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotran	4e-07
d1qhoa1		81	b.1.18.2 (A:496-576) Five domain "maltogenic" alph	5e-07
d1uadc_		92	b.1.18.18 (C:) Exocyst complex component Sec5, Ral	1e-06
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	3e-06
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	4e-06
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	1e-05
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	6e-05
d2fo1e1		277	d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele	6e-06
d2fo1e1		277	d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele	0.004
d1cyga1		83	b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotran	7e-06
d1s70b_		291	d.211.1.1 (B:) Myosin phosphatase targeting subuni	2e-05
d1s70b_		291	d.211.1.1 (B:) Myosin phosphatase targeting subuni	0.003
d1wdya_		285	d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas	3e-05
d1wdya_		285	d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas	0.003
d1sw6a_		301	d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker	4e-05
d1sw6a_		301	d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker	1e-04
d1k1aa_		228	d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId:	6e-05
d1oy3d_		255	d.211.1.1 (D:) Transcription factor inhibitor I-ka	7e-05
d1oy3d_		255	d.211.1.1 (D:) Transcription factor inhibitor I-ka	0.003
d1awcb_		153	d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {	6e-04
d1uoha_		223	d.211.1.1 (A:) 26S proteasome non-ATPase regulator	0.001
d1bd8a_		156	d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma	0.003
d1ot8a_		209	d.211.1.1 (A:) Neurogenic locus notch receptor dom	0.004

>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure


class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain
domain: Calmodulin binding transcription activator 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.3 bits (145), Expect = 4e-12
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 441 IRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPS 500
           + D+SP+W+Y     KVLI G +       +   + C+F +I VPA ++   V+RC  P+
Sbjct: 2   VTDYSPEWSYPEGGVKVLITGPWQ-----EASNNYSCLFDQISVPASLIQPGVLRCYCPA 56

Query: 501 HAAGRVPFYITGSNRLACSEVREFEYR 527
           H  G V   +  +N++  + V  FEY+
Sbjct: 57  HDTGLVTLQVAFNNQIISNSV-VFEYK 82

PyMOL of d2cxka1

>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} Length = 87	Back information, alignment and structure

>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Length = 83	Back information, alignment and structure

>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 81	Back information, alignment and structure

>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 92	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Length = 83	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255	Back information, alignment and structure

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223	Back information, alignment and structure

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		713
d2cxka1		82	Calmodulin binding transcription activator 1 {Huma	99.74
d1ycsb1		130	53BP2 {Human (Homo sapiens) [TaxId: 9606]}	99.61
d1myoa_		118	Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]	99.54
d1dcqa1		154	Pyk2-associated protein beta {Mouse (Mus musculus)	99.4
d1wdya_		285	RNase L, 2-5a-dependent ribonuclease {Human (Homo	99.38
d1dcqa1		154	Pyk2-associated protein beta {Mouse (Mus musculus)	99.32
d1bi7b_		125	Cell cycle inhibitor p16ink4A {Human (Homo sapiens	99.31
d1bi7b_		125	Cell cycle inhibitor p16ink4A {Human (Homo sapiens	99.28
d1awcb_		153	GA bindinig protein (GABP) beta 1 {Mouse (Mus musc	99.26
d1ot8a_		209	Neurogenic locus notch receptor domain {Fruit fly	99.25
d1oy3d_		255	Transcription factor inhibitor I-kappa-B-beta, IKB	99.23
d1uoha_		223	26S proteasome non-ATPase regulatory subunit 10, g	99.23
d2fo1e1		277	Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	99.21
d1bd8a_		156	Cell cycle inhibitor p19ink4D {Human (Homo sapiens	99.2
d1awcb_		153	GA bindinig protein (GABP) beta 1 {Mouse (Mus musc	99.2
d1n11a_		408	Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	99.18
d1k1aa_		228	bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	99.17
d1n11a_		408	Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	99.14
d1oy3d_		255	Transcription factor inhibitor I-kappa-B-beta, IKB	99.13
d2fo1e1		277	Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	99.12
d1s70b_		291	Myosin phosphatase targeting subunit 1, MYPT1 {Chi	99.11
d1ot8a_		209	Neurogenic locus notch receptor domain {Fruit fly	99.1
d1ixva_		229	26S proteasome non-ATPase regulatory subunit 10, g	99.08
d2ajaa1		346	Hypothetical protein LPG2416 {Legionella pneumophi	99.04
d1uoha_		223	26S proteasome non-ATPase regulatory subunit 10, g	99.03
d1sw6a_		301	Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch	99.03
d1ixva_		229	26S proteasome non-ATPase regulatory subunit 10, g	99.01
d1ihba_		156	p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]	98.99
d1bd8a_		156	Cell cycle inhibitor p19ink4D {Human (Homo sapiens	98.98
d1s70b_		291	Myosin phosphatase targeting subunit 1, MYPT1 {Chi	98.96
d1k1aa_		228	bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	98.96
d1ihba_		156	p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]	98.96
d1ycsb1		130	53BP2 {Human (Homo sapiens) [TaxId: 9606]}	98.96
d1myoa_		118	Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]	98.95
d1qhoa1		81	Five domain "maltogenic" alpha-amylase (glucan 1,4	98.89
d1iknd_		221	I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606	98.87
d1iknd_		221	I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606	98.85
d1sw6a_		301	Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch	98.78
d1p7hl1		103	T-cell transcription factor NFAT1 (NFATC2) {Human	98.76
d2ajaa1		346	Hypothetical protein LPG2416 {Legionella pneumophi	98.74
d1cxla1		87	Cyclomaltodextrin glycanotransferase, domain D {Ba	98.73
d1uadc_		92	Exocyst complex component Sec5, Ral-binding domain	98.68
d3bmva1		83	Cyclomaltodextrin glycanotransferase, domain D {Th	98.61
d1wdya_		285	RNase L, 2-5a-dependent ribonuclease {Human (Homo	98.53
d1cyga1		83	Cyclomaltodextrin glycanotransferase, domain D {Ba	98.52
d3brda1		119	DNA-binding protein LAG-1 (CSL) {Caenorhabditis el	98.46
d1imhc1		101	T-cell transcription factor NFAT5 (TONEBP) {Human	97.16
d1gjia1		100	p65 subunit of NF-kappa B (NFKB), dimerization dom	96.47
d1my7a_		107	p65 subunit of NF-kappa B (NFKB), dimerization dom	95.92
d1u36a_		104	p50 subunit of NF-kappa B transcription factor {Hu	95.69
d1a3qa1		101	p52 subunit of NF-kappa B (NFKB) {Human (Homo sapi	95.66

>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain
domain: Calmodulin binding transcription activator 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.74  E-value=1.4e-18  Score=147.63  Aligned_cols=81  Identities=33%  Similarity=0.776  Sum_probs=74.3

Q ss_pred             EEeecCCCccCCCCeEEEEEeccccCCCCCCCCceEEEeCCeecceEeeecceeeeecCCCCCceeEEEEEeCCcccccc
Q 005128          441 IRDFSPDWAYSGAETKVLIIGMFLGTKKLSSDTKWGCMFGEIEVPAEVLTDNVIRCQAPSHAAGRVPFYITGSNRLACSE  520 (713)
Q Consensus       441 I~d~SP~wgy~~ggtKVlI~G~f~~~~~~~~~~~~~cmFGd~eVpaei~q~GVLrC~~PPh~pG~V~l~Vt~~n~~~cSe  520 (713)
                      |++|+|.||++.|||+|+|.|.+|..     ...+.|+||+..+++.+++++.|+|.+|||.||.|+|.|+.+++..+++
T Consensus         2 It~isP~~G~~~GGt~V~I~G~~f~~-----~~~~~c~fG~~~~~~~~vs~~~i~C~tP~~~~G~v~v~Vs~ng~~~s~~   76 (82)
T d2cxka1           2 VTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNS   76 (82)
T ss_dssp             CCEEECSEECTTCCCEEEEESSCCCC-----SSCEEEEETTEEEECEEEETTEEEEECCCCCSEEEEEEEEETTEECSCC
T ss_pred             EeEEcCCceeCCCCEEEEEEEccccc-----cceEEEEEEeeecceEEEeeeEEEEEcCcccceeEEEEEEECCEEeccC
Confidence            89999999999999999999999964     4579999999999999999999999999999999999999988766544


Q ss_pred             ceeeeec
Q 005128          521 VREFEYR  527 (713)
Q Consensus       521 v~eFEYr  527 (713)
                       ..||||
T Consensus        77 -~~F~Yr   82 (82)
T d2cxka1          77 -VVFEYK   82 (82)
T ss_dssp             -EEEEEC
T ss_pred             -cEEEeC
Confidence             589997

PyMOL of d2cxka1

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}	Back information, alignment and structure

>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]}	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}	Back information, alignment and structure

>d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure