Citrus Sinensis ID: 005186

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710
MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHcccccccEEEEEEcccccccccccccccccccccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccEccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccHHHcccccccccccccccHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHccccccccccccccHHHHHHcccccEEEEEHHHHHHcHHHHHHHHHHHHccccccccccEEEcEcEEEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHcccccHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHEEEEEccccccccccccccccccEEEEc
mesfvpfggffptpsefknplgglcqnvsrcqqcsEKCEQEIIasskggftaSIADQCQSVLpswlqmaepdsnkaldlktKEDGLALRSKITKKWDDICQSLhrtqslqvgsqfptvvGFQFlqdkkenannsgsstnasvnggsyvnvysgipidsenvsasrsvfpfhtvsgakndSLLSKLREkssnadldsggsrspcclsnssvddgsrksptpvtsvttdlglgllgigsaptsnepkepiskdLTERSQelsgccsatvngsisnqlaqssssscpdlncqfdlSNWKTLFRALTEKIDWQDEAISVISQTIAQrrtghedhhgasprrdiwfnftgpdlcgkRKIAIALAEIIYggkenficadlcpqdgemnnppkfyhqvvggdsvqfrGKTLADYVAWELLKKPLSVVylenvdkadVHVQNSLSKaiqtgklpdsygrevsVSNAIFVTASSfvedarilpsemkdckfseEKIYRAKSRLTQILiepalvnrsssqklsasetsegmshqKLLNKrkligrndnpqqhdtsEMVKrahrsptrnldlnlpaeedevlvldsdddrnsdssenTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEghfleeltpgvclppklvln
MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPdsnkaldlktKEDGLALRSKITKKWDDICQSLHrtqslqvgsqFPTVVGFQFLQDKKENAnnsgsstnasvngGSYVNVYSGIPIDSENVSASRSVFPFhtvsgakndslLSKLREKSSnadldsggsrspCCLSnssvddgsrkspTPVTSVTTDLGLGLLGigsaptsnepkepISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQrrtghedhhgasprrdiWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAiqtgklpdsygREVSVSNAIFVTassfvedarilpsemkdckfsEEKIYRAKSRLTQILiepalvnrsssqklsasetsegmshqKLLNkrkligrndnpqqhdtsemvkrahrsptrnldlnlpaeEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLeeltpgvclppklvln
MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKEnannsgsstnasvnggsYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDlglgllgigSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQsssssCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAeedevlvldsdddrnsdssENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
*****PFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQ*****************GLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFL*********************SYVNVYSGIPID**********F***********************************************************LGLGLLG**************************************************DLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQ*************RRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPAL*************************************************************************************SWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPK****
**SFVPFGGFFPTPSE********CQNVSRCQQCSEKCEQEI************************************************KITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDK**********************************************************************************************************************************************************************NWKTLFRALTEKIDWQDEAISVISQTIAQ***************DIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVE**********************KSRLTQILIEPALVNRSSSQKLSAS*****************************************RNLDLNLPAEE*************************DFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVL*
MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKEN********NASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLR***************PCCLS****************SVTTDLGLGLLGIGSA**********************GCCSATVNGSISN***********DLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIA***********ASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVN*******************KLLNKRKLIGRNDN****************PTRNLDLNLPAEEDEVLVLDS***********TKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
********************L*GLCQNVSRCQQCSEKCEQEIIASSKG***********SVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQD*******************************************FHTVSGA*N********************************************SVTTDLGLGLLGIGSAPTSNEP*****KDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query710 2.2.26 [Sep-21-2011]
Q8EU05809 Chaperone protein ClpB OS yes no 0.259 0.227 0.299 2e-12
Q826F2879 Chaperone protein ClpB 2 yes no 0.208 0.168 0.279 1e-11
Q53LY0932 Chaperone protein ClpC3, no no 0.209 0.159 0.294 4e-11
Q2QVG9919 Chaperone protein ClpC2, no no 0.287 0.221 0.254 6e-11
Q7F9I1918 Chaperone protein ClpC1, no no 0.287 0.222 0.258 1e-10
Q72AW6865 Chaperone protein ClpB OS yes no 0.208 0.171 0.308 2e-10
Q9PKA8870 Probable ATP-dependent Cl yes no 0.212 0.173 0.257 2e-10
P0A522848 Probable ATP-dependent Cl yes no 0.216 0.181 0.277 2e-10
P0A523848 Probable ATP-dependent Cl yes no 0.216 0.181 0.277 2e-10
P24428848 Probable ATP-dependent Cl yes no 0.216 0.181 0.277 2e-10
>sp|Q8EU05|CLPB_OCEIH Chaperone protein ClpB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpB PE=3 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 110/224 (49%), Gaps = 40/224 (17%)

Query: 300 RALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIW-FNFTGPDLCGKRKIAIAL 358
           + L +++  Q EA++ +++ I + R G +D     P+R I  F F GP   GK ++A AL
Sbjct: 507 KILHDRVIGQSEAVNAVAKAIRRARAGLKD-----PKRPIGSFIFLGPTGVGKTELARAL 561

Query: 359 AEIIYGGKENFICADLCPQDGE------MNNPPKFYHQVVGGDSVQFRGKTLADYVAWEL 412
           AE+++  ++  I  D+            + +PP +    VG D     G  L + V    
Sbjct: 562 AEVMFADEDAMIRIDMSEYMERHATSRLVGSPPGY----VGYDE----GGQLTEKVR--- 610

Query: 413 LKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARI 472
            +KP SVV L+ V+KA   V N L + ++ G+L DS GR V   N + +  S+      +
Sbjct: 611 -RKPYSVVLLDEVEKAHPEVFNILLQVLEDGRLTDSKGRVVDFRNTVIIMTSN------V 663

Query: 473 LPSEMKDCKF------SEEKIYR-AKSRLTQIL---IEPALVNR 506
             SE+K  K+      +EEK Y+  KS++ + L     P  +NR
Sbjct: 664 GASELKRNKYVGFALDNEEKDYKDMKSKVIEELKKAFRPEFLNR 707
Part of a stress-induced multi-chaperone system, it is involved in the recovery of the cell from heat-induced damage, in cooperation with DnaK, DnaJ and GrpE. Acts before DnaK, in the processing of protein aggregates. Protein binding stimulates the ATPase activity; ATP hydrolysis unfolds the denatured protein aggregates, which probably helps expose new hydrophobic binding sites on the surface of ClpB-bound aggregates, contributing to the solubilization and refolding of denatured protein aggregates by DnaK.
Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) (taxid: 221109)
>sp|Q826F2|CLPB2_STRAW Chaperone protein ClpB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpB2 PE=3 SV=1 Back     alignment and function description
>sp|Q53LY0|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1 Back     alignment and function description
>sp|Q2QVG9|CLPC2_ORYSJ Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2 Back     alignment and function description
>sp|Q7F9I1|CLPC1_ORYSJ Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2 Back     alignment and function description
>sp|Q72AW6|CLPB_DESVH Chaperone protein ClpB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q9PKA8|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|P0A522|CLPC_MYCTU Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium tuberculosis GN=clpC PE=1 SV=1 Back     alignment and function description
>sp|P0A523|CLPC_MYCBO Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|P24428|CLPC_MYCLE Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium leprae (strain TN) GN=clpC PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
255585368 1112 conserved hypothetical protein [Ricinus 0.978 0.625 0.530 0.0
225448447 1105 PREDICTED: uncharacterized protein LOC10 0.978 0.628 0.513 1e-176
147783009 1166 hypothetical protein VITISV_024923 [Viti 0.970 0.590 0.506 1e-171
224112493628 predicted protein [Populus trichocarpa] 0.860 0.972 0.515 1e-156
449499195 1109 PREDICTED: uncharacterized LOC101216395 0.977 0.625 0.452 1e-154
449441584 1123 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.977 0.617 0.439 1e-150
225434576 1106 PREDICTED: uncharacterized protein LOC10 0.985 0.632 0.438 1e-145
356569296 942 PREDICTED: uncharacterized protein LOC10 0.950 0.716 0.433 1e-138
224098627489 predicted protein [Populus trichocarpa] 0.683 0.991 0.542 1e-134
147866119 1088 hypothetical protein VITISV_006557 [Viti 0.960 0.626 0.420 1e-132
>gi|255585368|ref|XP_002533380.1| conserved hypothetical protein [Ricinus communis] gi|223526773|gb|EEF28998.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/722 (53%), Positives = 492/722 (68%), Gaps = 27/722 (3%)

Query: 1    MESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQS 60
            MESF+PFGGFF TPSE    L    Q +SRC  C+EKCEQE++A SKGG  AS+ADQ QS
Sbjct: 406  MESFIPFGGFFSTPSELNGSLSSSYQCISRCHLCNEKCEQEVLAVSKGGCVASVADQYQS 465

Query: 61   VLPSWLQMAEPDSNKALDLKTKEDGLALRSKIT---KKWDDICQSLHRTQ---SLQVGSQ 114
             LPSWLQMAE  +NK LD+KT++DG  L +K+    KKWD IC  LH T+   S  + S 
Sbjct: 466  NLPSWLQMAELGTNKGLDVKTRDDGDVLSAKVAGLQKKWDSICWRLHLTRPQGSNTLPSG 525

Query: 115  FPTVVGFQFLQDKKENA-NNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTV 173
            FPTVVGFQ ++DKK++A   S ++TNA ++G   +NV    PID + +S  +   P    
Sbjct: 526  FPTVVGFQLVEDKKDDAEKGSSNNTNAPLDGNRCMNV----PIDLQKISRRQLGVPLSAA 581

Query: 174  SGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLL 233
            S A  +S+  +    S   D +S G RSPC  SNSS+ DG+R SPT  TSVTTDLGL + 
Sbjct: 582  SVANTESV-KQWERPSKEEDHESDGLRSPCSYSNSSIADGNRASPTSATSVTTDLGLRIS 640

Query: 234  GIGSAPTSNEPKEPISKDLTERSQELSGCCSA---TVNGSISNQLAQSSSSSCPDLNCQF 290
             I    TS + K+P +K   E S++LSG  S     +NGSIS+ LA SSS S  D+  QF
Sbjct: 641  PIS---TSYDTKKPENKHYVELSRDLSGSFSPNNDVINGSISDHLAHSSSFSSLDIGRQF 697

Query: 291  DLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCG 350
            D +++K L RALTEK+  QDEA+ +ISQTIA  RT +E H G+S +RDIWFNF GPD C 
Sbjct: 698  DPTSFKMLVRALTEKVSCQDEAVHLISQTIAHYRTRNERHQGSSLKRDIWFNFLGPDRCS 757

Query: 351  KRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAW 410
            KRKIA ALAEII+G  EN I ADL PQDG +N     + + V    V FRGKT+ DYVA 
Sbjct: 758  KRKIAAALAEIIFGSSENLISADLSPQDGIVN----MHSEEVHAYDVMFRGKTIIDYVAG 813

Query: 411  ELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDA 470
            EL KKPL+VV+LENVDKADV  QNSLS+AI+TGK  DS+GREV ++NAIFVT S+  +D 
Sbjct: 814  ELGKKPLAVVFLENVDKADVQAQNSLSRAIRTGKFSDSHGREVGINNAIFVTTSTLGDDK 873

Query: 471  RILPSEMKD-CKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGM-SHQKLLN 528
            ++  S  KD   +SEE+I R K +  Q+LIE A   +   Q L+ S     + S    +N
Sbjct: 874  KL--SSTKDFSTYSEERILRIKGQPMQMLIEQAPAEKMV-QNLNHSPVMRKVPSSSVFVN 930

Query: 529  KRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTK 588
            KRKL+G N N  +H TSE+ KRAH++ +R LDLNLPAEE+++ ++++ D  N   S N+K
Sbjct: 931  KRKLVGANQNVNRHKTSEVAKRAHKTSSRYLDLNLPAEENDMQIIENGDSDNDSMSSNSK 990

Query: 589  SWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAA 648
            +WLQDF +Q  +IV FK F+FDAL E+IL  IN SF K VGSECLL+ID KV EQLLAAA
Sbjct: 991  AWLQDFLDQLDRIVVFKPFDFDALGERILTGINDSFHKIVGSECLLDIDSKVTEQLLAAA 1050

Query: 649  YLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLV 708
            YLS   RV+E+W+E+VL +GF++  E+YNL+A+SIVKLV+C+G FL+E   G  LP K++
Sbjct: 1051 YLSPRKRVVEEWMEQVLNKGFVEVLERYNLSAHSIVKLVSCKGLFLDEDMAGGHLPSKII 1110

Query: 709  LN 710
            LN
Sbjct: 1111 LN 1112

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448447|ref|XP_002272110.1| PREDICTED: uncharacterized protein LOC100260392 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147783009|emb|CAN72301.1| hypothetical protein VITISV_024923 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112493|ref|XP_002316209.1| predicted protein [Populus trichocarpa] gi|222865249|gb|EEF02380.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449499195|ref|XP_004160747.1| PREDICTED: uncharacterized LOC101216395 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441584|ref|XP_004138562.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101216395 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225434576|ref|XP_002279036.1| PREDICTED: uncharacterized protein LOC100241532 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356569296|ref|XP_003552839.1| PREDICTED: uncharacterized protein LOC100786125 [Glycine max] Back     alignment and taxonomy information
>gi|224098627|ref|XP_002311226.1| predicted protein [Populus trichocarpa] gi|222851046|gb|EEE88593.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147866119|emb|CAN78825.1| hypothetical protein VITISV_006557 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
TAIR|locus:2065074910 AT2G40130 [Arabidopsis thalian 0.284 0.221 0.405 2.8e-36
TAIR|locus:2007412979 AT1G07200 "AT1G07200" [Arabido 0.349 0.253 0.318 2.9e-54
TAIR|locus:20456531002 AT2G29970 [Arabidopsis thalian 0.308 0.218 0.344 1.3e-48
TAIR|locus:2172585990 AT5G57710 [Arabidopsis thalian 0.302 0.217 0.316 5.1e-32
TAIR|locus:2118806924 AT4G30350 "AT4G30350" [Arabido 0.184 0.141 0.353 1.6e-23
TAIR|locus:2079904815 AT3G52490 [Arabidopsis thalian 0.297 0.258 0.245 4.6e-13
UNIPROTKB|Q3A9N1811 CHY_2348 "Negative regulator o 0.318 0.278 0.263 2e-09
TIGR_CMR|CHY_2348811 CHY_2348 "negative regulator o 0.318 0.278 0.263 2e-09
TIGR_CMR|BA_1177866 BA_1177 "ATP-dependent Clp pro 0.247 0.203 0.285 2.8e-09
UNIPROTKB|P0A522848 clpC "Probable ATP-dependent C 0.273 0.228 0.266 4.4e-09
TAIR|locus:2065074 AT2G40130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 2.8e-36, Sum P(3) = 2.8e-36
 Identities = 94/232 (40%), Positives = 129/232 (55%)

Query:   336 RRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGG- 394
             RRD+W N  GPD  GKR++++ LAEI+Y  +  F+  DL   +           Q +GG 
Sbjct:   571 RRDVWLNLVGPDTVGKRRMSLVLAEIVYQSEHRFMAVDLGAAE-----------QGMGGC 619

Query:   395 -DSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREV 453
              D ++ RGKT+ D++   + + P  VV+LEN++KAD  +Q SLSKAI+TGK  DS+GREV
Sbjct:   620 DDPMRLRGKTMVDHIFEVMCRNPFCVVFLENIEKADEKLQMSLSKAIETGKFMDSHGREV 679

Query:   454 SVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLS 513
              + N IFV  SS    A           +SEEK+ R K R  +I IE       SS  L 
Sbjct:   680 GIGNTIFVMTSSSQGSATTT-------SYSEEKLLRVKGRQVEIRIETV-----SS--LP 725

Query:   514 ASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPA 565
                +  G +    +NKRKL+G  +  +  DT E VKR +R+    LDLNLPA
Sbjct:   726 MVRSVYGPTS---VNKRKLMGLGNLQETKDTVESVKRLNRTTNGVLDLNLPA 774
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2007412 AT1G07200 "AT1G07200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045653 AT2G29970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172585 AT5G57710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118806 AT4G30350 "AT4G30350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079904 AT3G52490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3A9N1 CHY_2348 "Negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2348 CHY_2348 "negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1177 BA_1177 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P0A522 clpC "Probable ATP-dependent Clp protease ATP-binding subunit" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029299001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (1067 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 4e-14
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 6e-13
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 6e-08
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 1e-07
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 2e-07
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 2e-06
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 7e-05
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.001
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 75.8 bits (187), Expect = 4e-14
 Identities = 62/222 (27%), Positives = 96/222 (43%), Gaps = 41/222 (18%)

Query: 300 RALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDI-WFNFTGPDLCGKRKIAIAL 358
           R L +++  QDEA+  +S  I + R G  D     P R I  F F GP   GK ++A AL
Sbjct: 487 RRLKKRVIGQDEAVEAVSDAIRRARAGLGD-----PNRPIGSFLFLGPTGVGKTELAKAL 541

Query: 359 AEIIYGGKENFICADLCPQDGEMNNPPKFYHQV----------VGGDSVQFRGKTLADYV 408
           AE ++G ++  I  D+     E        H V          VG +     G  L + V
Sbjct: 542 AEALFGDEQALIRIDM----SEYMEK----HSVSRLIGAPPGYVGYEE----GGQLTEAV 589

Query: 409 AWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVE 468
                +KP SV+ L+ ++KA   V N L + +  G+L D  GR V   N I +  +S   
Sbjct: 590 R----RKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIII-MTSNAG 644

Query: 469 DARILPSEMKDCKFSEEKIYRA-KSRLTQILIE---PALVNR 506
            +  +   ++D    +     A K  + + L +   P  +NR
Sbjct: 645 -SEEI---LRDADGDDFADKEALKEAVMEELKKHFRPEFLNR 682

Length = 786
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 710
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 100.0
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.97
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.95
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.94
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.9
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.88
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.87
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.86
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.86
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.85
COG2204464 AtoC Response regulator containing CheY-like recei 99.85
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.82
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.8
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.77
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.76
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.72
PRK11608326 pspF phage shock protein operon transcriptional ac 99.72
CHL00181287 cbbX CbbX; Provisional 99.72
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.71
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.7
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.7
PRK15424538 propionate catabolism operon regulatory protein Pr 99.69
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.67
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.67
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.66
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.65
COG1221403 PspF Transcriptional regulators containing an AAA- 99.64
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.63
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.63
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.62
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.61
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.59
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.58
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.58
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.57
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.56
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.55
PRK15115444 response regulator GlrR; Provisional 99.54
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.53
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.5
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK13531498 regulatory ATPase RavA; Provisional 99.43
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.41
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.4
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.38
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.37
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.37
PLN03025319 replication factor C subunit; Provisional 99.37
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.37
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.35
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.34
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.34
PRK13342413 recombination factor protein RarA; Reviewed 99.34
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.33
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.33
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.33
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.33
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.29
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK13341 725 recombination factor protein RarA/unknown domain f 99.28
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.27
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.26
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.25
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.25
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.24
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.24
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.24
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.23
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.21
CHL00195489 ycf46 Ycf46; Provisional 99.21
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.21
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.21
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.2
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.19
PRK03992389 proteasome-activating nucleotidase; Provisional 99.19
COG0714329 MoxR-like ATPases [General function prediction onl 99.18
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.18
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK12402337 replication factor C small subunit 2; Reviewed 99.16
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.16
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.15
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.13
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.13
PHA02544316 44 clamp loader, small subunit; Provisional 99.12
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.12
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.11
PRK04195482 replication factor C large subunit; Provisional 99.11
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.11
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.11
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.11
PRK06893229 DNA replication initiation factor; Validated 99.1
PF07726131 AAA_3: ATPase family associated with various cellu 99.09
KOG2028554 consensus ATPase related to the helicase subunit o 99.08
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.08
PRK00440319 rfc replication factor C small subunit; Reviewed 99.08
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.08
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.05
PF00004132 AAA: ATPase family associated with various cellula 99.05
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.05
PRK07940394 DNA polymerase III subunit delta'; Validated 99.05
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.04
PHA02244383 ATPase-like protein 99.04
CHL00176638 ftsH cell division protein; Validated 99.03
PRK13765 637 ATP-dependent protease Lon; Provisional 99.03
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.03
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.03
PRK08727233 hypothetical protein; Validated 99.03
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.02
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.02
PRK08084235 DNA replication initiation factor; Provisional 99.01
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.01
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.01
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.01
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.0
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.0
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.0
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.98
PTZ001121164 origin recognition complex 1 protein; Provisional 98.98
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.98
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.98
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.98
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.97
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.96
PRK09112351 DNA polymerase III subunit delta'; Validated 98.95
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 98.95
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.94
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 98.94
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.94
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.93
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.89
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.86
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.86
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.85
PRK05642234 DNA replication initiation factor; Validated 98.83
PRK07471365 DNA polymerase III subunit delta'; Validated 98.82
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.82
PRK07399314 DNA polymerase III subunit delta'; Validated 98.82
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.81
KOG0736953 consensus Peroxisome assembly factor 2 containing 98.79
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.79
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.79
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.79
PRK10865 857 protein disaggregation chaperone; Provisional 98.78
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.78
PRK05564313 DNA polymerase III subunit delta'; Validated 98.76
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.75
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.75
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.75
CHL00095 821 clpC Clp protease ATP binding subunit 98.75
smart00350509 MCM minichromosome maintenance proteins. 98.74
KOG0731774 consensus AAA+-type ATPase containing the peptidas 98.72
CHL00206 2281 ycf2 Ycf2; Provisional 98.71
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.71
PRK12422445 chromosomal replication initiation protein; Provis 98.71
PRK09862506 putative ATP-dependent protease; Provisional 98.7
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.69
PRK08058329 DNA polymerase III subunit delta'; Validated 98.69
PRK00149450 dnaA chromosomal replication initiation protein; R 98.67
PRK14087450 dnaA chromosomal replication initiation protein; P 98.65
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.65
PRK14088440 dnaA chromosomal replication initiation protein; P 98.61
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 98.6
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.6
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 98.6
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.59
PRK04132846 replication factor C small subunit; Provisional 98.59
PRK08769319 DNA polymerase III subunit delta'; Validated 98.59
PRK14086617 dnaA chromosomal replication initiation protein; P 98.58
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.58
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 98.58
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.58
PRK07993334 DNA polymerase III subunit delta'; Validated 98.56
PRK06871325 DNA polymerase III subunit delta'; Validated 98.55
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.55
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.53
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.52
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.51
PRK05707328 DNA polymerase III subunit delta'; Validated 98.49
PRK06090319 DNA polymerase III subunit delta'; Validated 98.48
PRK06620214 hypothetical protein; Validated 98.47
PRK09087226 hypothetical protein; Validated 98.47
PRK12377248 putative replication protein; Provisional 98.47
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.44
smart00382148 AAA ATPases associated with a variety of cellular 98.43
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.43
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.4
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.39
PRK06964342 DNA polymerase III subunit delta'; Validated 98.38
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.37
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.36
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 98.35
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 98.34
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.33
PRK08699325 DNA polymerase III subunit delta'; Validated 98.28
PRK08116268 hypothetical protein; Validated 98.27
PRK05917290 DNA polymerase III subunit delta'; Validated 98.25
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.19
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.15
PRK06526254 transposase; Provisional 98.06
PRK07276290 DNA polymerase III subunit delta'; Validated 98.03
PRK08939306 primosomal protein DnaI; Reviewed 98.02
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 98.01
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.0
COG0593408 DnaA ATPase involved in DNA replication initiation 97.98
PRK07952244 DNA replication protein DnaC; Validated 97.97
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 97.97
PRK05818261 DNA polymerase III subunit delta'; Validated 97.97
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.95
PRK06835329 DNA replication protein DnaC; Validated 97.95
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.94
PF13173128 AAA_14: AAA domain 97.94
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.94
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 97.94
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.92
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.92
PRK08181269 transposase; Validated 97.91
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.88
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.87
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.84
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.8
PRK09183259 transposase/IS protein; Provisional 97.74
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 97.73
PRK06921266 hypothetical protein; Provisional 97.73
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.7
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.69
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.68
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.67
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 97.65
PRK07132299 DNA polymerase III subunit delta'; Validated 97.64
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.52
KOG0480764 consensus DNA replication licensing factor, MCM6 c 97.5
PRK15455 644 PrkA family serine protein kinase; Provisional 97.47
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.42
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.42
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.37
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.35
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.34
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.26
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.16
PF05729166 NACHT: NACHT domain 97.12
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.06
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.04
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.04
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.02
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.97
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.93
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.92
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.79
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.78
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 96.75
PRK06581263 DNA polymerase III subunit delta'; Validated 96.73
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.72
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.71
PHA02774613 E1; Provisional 96.68
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 96.65
KOG0736 953 consensus Peroxisome assembly factor 2 containing 96.63
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.6
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.59
PRK14974336 cell division protein FtsY; Provisional 96.59
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.58
PRK04296190 thymidine kinase; Provisional 96.57
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.57
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 96.52
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.46
PRK10867433 signal recognition particle protein; Provisional 96.44
TIGR00064272 ftsY signal recognition particle-docking protein F 96.43
PRK10416318 signal recognition particle-docking protein FtsY; 96.42
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 96.41
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.34
PHA00729226 NTP-binding motif containing protein 96.32
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.28
KOG1514767 consensus Origin recognition complex, subunit 1, a 96.28
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.27
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.26
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.22
PRK00131175 aroK shikimate kinase; Reviewed 96.18
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.18
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.13
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.12
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.08
PRK08118167 topology modulation protein; Reviewed 96.04
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.04
KOG0481729 consensus DNA replication licensing factor, MCM5 c 96.03
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 96.02
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.02
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 95.98
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.97
PRK10536262 hypothetical protein; Provisional 95.92
PRK06696223 uridine kinase; Validated 95.9
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.9
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.89
KOG0482721 consensus DNA replication licensing factor, MCM7 c 95.88
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.87
PRK13851344 type IV secretion system protein VirB11; Provision 95.85
PRK13947171 shikimate kinase; Provisional 95.84
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.84
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.8
PRK00771437 signal recognition particle protein Srp54; Provisi 95.77
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 95.71
PRK03839180 putative kinase; Provisional 95.65
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.62
TIGR00959428 ffh signal recognition particle protein. This mode 95.6
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 95.59
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.59
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.59
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.56
PRK10436462 hypothetical protein; Provisional 95.53
PRK07261171 topology modulation protein; Provisional 95.5
PRK00625173 shikimate kinase; Provisional 95.45
PRK03846198 adenylylsulfate kinase; Provisional 95.33
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.33
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.29
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.26
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.23
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.23
PRK06217183 hypothetical protein; Validated 95.22
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.22
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.17
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.17
PF13479213 AAA_24: AAA domain 95.11
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.1
PRK13949169 shikimate kinase; Provisional 95.01
PRK05541176 adenylylsulfate kinase; Provisional 95.01
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.0
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 95.0
PRK13948182 shikimate kinase; Provisional 94.99
PRK13833323 conjugal transfer protein TrbB; Provisional 94.96
COG0703172 AroK Shikimate kinase [Amino acid transport and me 94.94
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.93
PHA01747425 putative ATP-dependent protease 94.92
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.89
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.84
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 94.82
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.76
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 94.76
PRK03731171 aroL shikimate kinase II; Reviewed 94.72
PRK14532188 adenylate kinase; Provisional 94.72
PRK06762166 hypothetical protein; Provisional 94.7
PRK06547172 hypothetical protein; Provisional 94.69
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.68
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 94.67
PRK06067234 flagellar accessory protein FlaH; Validated 94.66
PRK14530215 adenylate kinase; Provisional 94.54
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.54
PF04851184 ResIII: Type III restriction enzyme, res subunit; 94.52
PRK05480209 uridine/cytidine kinase; Provisional 94.49
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.48
PRK05057172 aroK shikimate kinase I; Reviewed 94.48
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.38
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 94.36
PRK13764602 ATPase; Provisional 94.34
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.31
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.24
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.24
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.22
PRK08233182 hypothetical protein; Provisional 94.21
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 94.19
PRK00889175 adenylylsulfate kinase; Provisional 94.18
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 94.17
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 94.17
PLN02200234 adenylate kinase family protein 94.13
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.06
cd03115173 SRP The signal recognition particle (SRP) mediates 94.03
PRK07667193 uridine kinase; Provisional 94.03
PRK14531183 adenylate kinase; Provisional 94.0
PRK02496184 adk adenylate kinase; Provisional 94.0
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 93.99
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.98
PTZ00088229 adenylate kinase 1; Provisional 93.96
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.94
PRK13946184 shikimate kinase; Provisional 93.91
COG1485367 Predicted ATPase [General function prediction only 93.85
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.77
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.75
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.69
PRK09270229 nucleoside triphosphate hydrolase domain-containin 93.68
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 93.67
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 93.63
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.59
PLN02165334 adenylate isopentenyltransferase 93.54
PRK14528186 adenylate kinase; Provisional 93.53
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 93.53
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.52
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.49
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 93.42
PHA02624647 large T antigen; Provisional 93.4
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.39
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 93.38
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 93.36
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.35
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.33
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.32
PF1324576 AAA_19: Part of AAA domain 93.27
PRK04220301 2-phosphoglycerate kinase; Provisional 93.25
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.19
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.1
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.08
PRK00279215 adk adenylate kinase; Reviewed 92.93
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.89
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 92.88
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 92.86
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 92.81
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 92.8
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 92.79
PRK11823446 DNA repair protein RadA; Provisional 92.78
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 92.77
TIGR02237209 recomb_radB DNA repair and recombination protein R 92.76
PRK04182180 cytidylate kinase; Provisional 92.74
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 92.72
PRK10875615 recD exonuclease V subunit alpha; Provisional 92.66
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 92.64
PLN02840421 tRNA dimethylallyltransferase 92.62
PRK14527191 adenylate kinase; Provisional 92.62
cd03246173 ABCC_Protease_Secretion This family represents the 92.61
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 92.58
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 92.56
PRK00300205 gmk guanylate kinase; Provisional 92.54
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 92.45
PRK13975196 thymidylate kinase; Provisional 92.34
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 92.29
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 92.24
PRK05439311 pantothenate kinase; Provisional 92.24
PF1355562 AAA_29: P-loop containing region of AAA domain 92.23
COG4088261 Predicted nucleotide kinase [Nucleotide transport 92.19
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 92.16
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.08
PRK04040188 adenylate kinase; Provisional 92.05
cd01128249 rho_factor Transcription termination factor rho is 92.04
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 92.03
PLN02199303 shikimate kinase 91.96
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.95
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 91.89
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.87
PRK10646153 ADP-binding protein; Provisional 91.83
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 91.82
PLN02674244 adenylate kinase 91.82
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.8
PRK15453290 phosphoribulokinase; Provisional 91.77
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 91.7
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 91.63
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 91.59
cd01394218 radB RadB. The archaeal protein radB shares simila 91.58
PRK12337475 2-phosphoglycerate kinase; Provisional 91.58
PRK13889 988 conjugal transfer relaxase TraA; Provisional 91.56
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 91.43
PRK14526211 adenylate kinase; Provisional 91.41
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 91.28
PF12846304 AAA_10: AAA-like domain 91.24
COG1936180 Predicted nucleotide kinase (related to CMP and AM 91.23
PF13337457 Lon_2: Putative ATP-dependent Lon protease 91.21
PHA02530300 pseT polynucleotide kinase; Provisional 91.18
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 91.1
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 91.09
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 91.08
COG1341398 Predicted GTPase or GTP-binding protein [General f 91.01
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 90.94
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 90.9
PRK09825176 idnK D-gluconate kinase; Provisional 90.84
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 90.81
COG3842352 PotA ABC-type spermidine/putrescine transport syst 90.8
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 90.76
PRK12338319 hypothetical protein; Provisional 90.76
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 90.72
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 90.64
PRK13826 1102 Dtr system oriT relaxase; Provisional 90.63
PRK14738206 gmk guanylate kinase; Provisional 90.59
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 90.57
cd02034116 CooC The accessory protein CooC, which contains a 90.55
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 90.54
PRK01184184 hypothetical protein; Provisional 90.53
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 90.5
PRK14737186 gmk guanylate kinase; Provisional 90.49
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 90.46
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 90.44
PRK00698205 tmk thymidylate kinase; Validated 90.41
PF05609465 LAP1C: Lamina-associated polypeptide 1C (LAP1C); I 90.37
PLN02748468 tRNA dimethylallyltransferase 90.27
PRK13768253 GTPase; Provisional 90.22
PRK09435332 membrane ATPase/protein kinase; Provisional 90.0
PF14516331 AAA_35: AAA-like domain 89.99
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 89.99
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-54  Score=500.12  Aligned_cols=480  Identities=25%  Similarity=0.320  Sum_probs=338.1

Q ss_pred             CccccCccCCCCcCCCCCcCC-CCCCcchhhhhhhHHHHHHHHhhcCCCCccccccccCCcchhhhhccCCCCccccccc
Q 005186            3 SFVPFGGFFPTPSEFKNPLGG-LCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKT   81 (710)
Q Consensus         3 sfvpfggf~~~~~~~~~~~~~-~~~~~~~c~~c~~~~e~e~a~~~~~~~~~~~~~~~~~~lp~~l~~~~~~~~~~~~~~~   81 (710)
                      .+|++|+||+..+.+..+..+ .+....||+.|..+||+|+++..+.         +...||+|||+.+....+      
T Consensus       366 ~e~~hg~~~s~~a~~~a~~~s~~~~t~r~lpd~aidl~dEa~a~~~~---------~~~~lP~wL~~~~~~~~~------  430 (898)
T KOG1051|consen  366 YEVHHGVRISDESLFSAAQLSARYITLSFLPDCAIDLEDEAAALVKS---------QAESLPPWLQNLERVDIK------  430 (898)
T ss_pred             hccccCCcccccccccccchhhhhcccCcCchhcccHHHHHHHHHhh---------hhhhCCHHHHhhhhhhhh------
Confidence            589999999999999999876 4788999999999999999999984         467899999997644322      


Q ss_pred             cchhhhhhHHH---hhhHHHHHHhhhccCCCCCCCCCCccceeecccccccccCCCCCCCCCccCCCcccccccCccCCC
Q 005186           82 KEDGLALRSKI---TKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDS  158 (710)
Q Consensus        82 ~~d~~~~~~~~---~kkw~~~c~~lh~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (710)
                            +...+   +||||   +++|++....++..      ..  +.        .+           |  ++.+    
T Consensus       431 ------~~~e~~~L~kk~d---~~~h~r~~~~~~~~------~~--~~--------~~-----------~--l~~~----  468 (898)
T KOG1051|consen  431 ------LQDEISELQKKWN---QALHKRPSLESLAP------SK--PT--------QQ-----------P--LSAS----  468 (898)
T ss_pred             ------hHHHHHHHHHhhh---hhhccccccccccc------cc--cc--------cc-----------c--chhh----
Confidence                  33344   99999   99999876332111      00  00        00           0  1111    


Q ss_pred             cccccCCcccccccccccccchhhhhhhhcccccccCCCCCCCCccCCCCC-CCCCCCCCCCCCCcccccccccccCCCC
Q 005186          159 ENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSS-VDDGSRKSPTPVTSVTTDLGLGLLGIGS  237 (710)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~s~~~~~~v~tdl~lg~~~~~~  237 (710)
                         .             ...-++    .++..         ..+.++-..+ .....  .| ...++.|||+.|.   +.
T Consensus       469 ---~-------------~~~~s~----~~~l~---------~~~~~~~~~~~~~k~~--r~-~d~~~~~~l~~~~---~p  513 (898)
T KOG1051|consen  469 ---V-------------DSERSV----IEELK---------LKKNSLDRNSLLAKAH--RP-NDYTRETDLRYGR---IP  513 (898)
T ss_pred             ---h-------------ccchhH----Hhhhc---------cccCCcccchhhhccc--CC-CCcchhhhccccc---cc
Confidence               0             000000    00000         0000110011 11111  23 5557999999999   32


Q ss_pred             CCCCCCCCCCCcccccccccccccccCCccCCCcccccccCC-CCCC-C-CcccccchHhHHHHHHHhcCcccccHHHHH
Q 005186          238 APTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQSS-SSSC-P-DLNCQFDLSNWKTLFRALTEKIDWQDEAIS  314 (710)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~s~-~~~~-~-~~~~~~d~~~lk~L~k~L~~~ViGQdeAi~  314 (710)
                        .....                  .+.++.+ +...++++. ...| + +...+.+.++|+.|++.|.++|+||++|+.
T Consensus       514 --~~~~~------------------~~~~~~~-~~~~i~~~~s~~tgip~~~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~  572 (898)
T KOG1051|consen  514 --DELSE------------------KSNDNQG-GESDISEVVSRWTGIPVDRLAEAEAERLKKLEERLHERVIGQDEAVA  572 (898)
T ss_pred             --hhhhh------------------hcccccC-CccchhhhhhhhcCCchhhhhhhHHHHHHHHHHHHHhhccchHHHHH
Confidence              11110                  1222222 222222222 1111 1 233345788999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCCCCCCCCCeEEEEecCCCCchhHHHHHHHHHHcCCCcceEEecCCCCCCCCCCCCCcccccccc
Q 005186          315 VISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGG  394 (710)
Q Consensus       315 ~I~~aI~~~r~g~~~~~~~~~r~~~~lLf~GP~GvGKT~LAraLAe~L~gs~~~fI~iD~s~~~~e~~~~~sl~~~~~~G  394 (710)
                      +|+.+|.+++.|+.++     +++.||+|+||+|||||+||++||+.+||+...||++||++    |.+..     .+.|
T Consensus       573 aIa~AI~~sr~gl~~~-----~~~awflflGpdgvGKt~lAkaLA~~~Fgse~~~IriDmse----~~evs-----klig  638 (898)
T KOG1051|consen  573 AIAAAIRRSRAGLKDP-----NPDAWFLFLGPDGVGKTELAKALAEYVFGSEENFIRLDMSE----FQEVS-----KLIG  638 (898)
T ss_pred             HHHHHHHhhhcccCCC-----CCCeEEEEECCCchhHHHHHHHHHHHHcCCccceEEechhh----hhhhh-----hccC
Confidence            9999999999998876     47899999999999999999999999999999999999997    44422     4456


Q ss_pred             ccccccccchhhHHHHHHHhCCCeEEEEeccccCCHHHHHHHHhhHhCCcccCCCCeEeecCceEEEEccCCCccccccc
Q 005186          395 DSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILP  474 (710)
Q Consensus       395 ~~~~f~G~t~~~~L~~al~~~p~sVI~LDEIDKa~~~vqn~LLq~LE~G~l~d~~Gr~vd~~n~I~IlTSN~g~~~~~~~  474 (710)
                      .+++|+|++..|+|+++++++||+|||||||||||+++++.|+|+||+|+++|++||+|+|+|+|||||+|.++..+.  
T Consensus       639 sp~gyvG~e~gg~LteavrrrP~sVVLfdeIEkAh~~v~n~llq~lD~GrltDs~Gr~Vd~kN~I~IMTsn~~~~~i~--  716 (898)
T KOG1051|consen  639 SPPGYVGKEEGGQLTEAVKRRPYSVVLFEEIEKAHPDVLNILLQLLDRGRLTDSHGREVDFKNAIFIMTSNVGSSAIA--  716 (898)
T ss_pred             CCcccccchhHHHHHHHHhcCCceEEEEechhhcCHHHHHHHHHHHhcCccccCCCcEeeccceEEEEecccchHhhh--
Confidence            666667777779999999999999999999999999999999999999999999999999999999999999876432  


Q ss_pred             cccccccchHHHHHHHhhhhhhhhhhhhhhccccccccccccccccchhhhhhhhhhccCCCCCCCCCChHHHHHhhccC
Q 005186          475 SEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRS  554 (710)
Q Consensus       475 ~~~~~~~f~eeki~~~k~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KRk~~~~~d~~e~~~~~~~~K~~~~~  554 (710)
                         +... .++++....+                                               +...+..+.+++...
T Consensus       717 ---~~~~-~~~~l~~~~~-----------------------------------------------~~~~~~~~k~~v~~~  745 (898)
T KOG1051|consen  717 ---NDAS-LEEKLLDMDE-----------------------------------------------KRGSYRLKKVQVSDA  745 (898)
T ss_pred             ---cccc-cccccccchh-----------------------------------------------hhhhhhhhhhhhhhh
Confidence               1111 1211110000                                               000001111111110


Q ss_pred             CCCccCCCCCcchhhhhhcCCCCCCCCCcccccccchhHHhcCcceeeecCCCCHHHHHHHHHHHHHHHHhhhcCCCceE
Q 005186          555 PTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLL  634 (710)
Q Consensus       555 s~~~lDLNlp~~e~e~~~~d~~~~~~d~~~e~~~~f~~efl~RiD~iVvF~PLD~d~Laeiil~~L~~~~~~~~g~~i~L  634 (710)
                      .+.                           .+...|++||++|+|.+++|+|||.+++.++....+.....+.-+.++.+
T Consensus       746 ~~~---------------------------~~~~~~r~Ef~nrid~i~lf~~l~~~~~~~i~~~~~~e~~~r~~~~~~~~  798 (898)
T KOG1051|consen  746 VRI---------------------------YNKQFFRKEFLNRIDELDLNLPLDRDELIEIVNKQLTEIEKRLEERELLL  798 (898)
T ss_pred             hhc---------------------------ccccccChHHhcccceeeeecccchhhHhhhhhhHHHHHHHHhhhhHHHH
Confidence            000                           01148999999999999999999999887777655544433332335778


Q ss_pred             EeCHHHHHHHHHhcCCCC-ChHHHHHHHHHHHHHHHHHHHHhcCcCCCCEEEEEEec
Q 005186          635 EIDRKVMEQLLAAAYLSE-SNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACE  690 (710)
Q Consensus       635 eId~eale~La~~~~~~~-GaR~le~~IE~vl~~~L~el~~~~~~~~~~~v~Lv~~~  690 (710)
                      .+++.+.+.++..+|+.. |+|.|+++|++.|...|+.... ..+....++++..-.
T Consensus       799 ~v~~~~~~~v~~~~~d~~ygAr~ikr~i~~~~~~~la~~~l-~ei~~~~~~~i~~~~  854 (898)
T KOG1051|consen  799 LVTDRVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALL-GEVEDGLTERILVAD  854 (898)
T ss_pred             HHHHHHHhhhhhcCcChHHHhhHHHHHHHHHHHHHHhhhhe-eeecCCceEEEEecc
Confidence            999999999999999998 9999999999999999999999 888888998777644

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF05609 LAP1C: Lamina-associated polypeptide 1C (LAP1C); InterPro: IPR008662 This entry contains Rattus norvegicus LAP1C proteins and several uncharacterised highly related sequences from both Mus sp Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
3pxi_A758 Structure Of Meca108:clpc Length = 758 3e-09
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 4e-09
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 6e-09
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 2e-08
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 2e-05
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 21/133 (15%)
Query: 335 PRRDIW-FNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVG 393
           P+R I  F F GP   GK ++A ALAE I+G +E+ I  D+      M       H   G
Sbjct: 517 PKRPIGSFIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEY---MEK-----HSTSG 568
Query: 394 GDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREV 453
           G             +  ++ +KP SVV L+ ++KA   V N L + ++ G+L DS GR V
Sbjct: 569 GQ------------LTEKVRRKPYSVVLLDAIEKAHPDVFNILLQVLEDGRLTDSKGRTV 616
Query: 454 SVSNAIFVTASSF 466
              N I +  S+ 
Sbjct: 617 DFRNTILIMTSNV 629
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 4e-07
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-05
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 74.5 bits (182), Expect = 8e-14
 Identities = 102/686 (14%), Positives = 196/686 (28%), Gaps = 203/686 (29%)

Query: 57  QCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKK-WDDICQSLHR-TQSLQVGSQ 114
           Q + +L  +    E       D K  +D    +S ++K+  D I  S    + +L++   
Sbjct: 17  QYKDILSVF----EDAFVDNFDCKDVQD--MPKSILSKEEIDHIIMSKDAVSGTLRL--- 67

Query: 115 FPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVS 174
                 F  L  K+E                  V  +    +   N       + F    
Sbjct: 68  ------FWTLLSKQEEM----------------VQKFVE-EVLRIN-------YKF---- 93

Query: 175 GAKNDSLLSKLREKSSNADLDSG---GSRSPCCLSNSSVDDGSRKSPTPVTSVTTDL--- 228
                 L+S ++ +     + +      R      N      +     P   +   L   
Sbjct: 94  ------LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL 147

Query: 229 ----GL---GLLGIGSAPTSNEPKEPISKD-LTERSQELSGCCSATVNGSISNQLAQSSS 280
                +   G+LG G             K  +      L  C S  V   +  ++   + 
Sbjct: 148 RPAKNVLIDGVLGSG-------------KTWVA-----LDVCLSYKVQCKMDFKIFWLNL 189

Query: 281 SSC--PDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQ-----RRTGHEDHHGA 333
            +C  P+      L   + L   +      + +  S I   I       RR      +  
Sbjct: 190 KNCNSPET----VLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPY-- 243

Query: 334 SPR-----RDIW-------FNF------TGPD------LCGKRKIAIALAEIIYG----- 364
                    ++        FN       T         L       I+L           
Sbjct: 244 -ENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 365 GKENFI-CADLCPQDGEMNNPPKFYHQVVGGD--SVQFRGKTLADYVA-WELLKKPLSVV 420
            K   +   D  PQD     P     +V+  +   +    +++ D +A W+  K      
Sbjct: 303 VKSLLLKYLDCRPQD----LPR----EVLTTNPRRLSIIAESIRDGLATWDNWKHV---- 350

Query: 421 YLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDC 480
              N DK    +++SL+       L  +  R++    ++F         A I P+ +   
Sbjct: 351 ---NCDKLTTIIESSLNV------LEPAEYRKMFDRLSVFP------PSAHI-PTILL-S 393

Query: 481 KFSEEKIYRAKSRLTQILIEPALVNRSSSQ----------KLSASETSEGMSHQKLLNKR 530
               + I      +   L + +LV +   +          +L     +E   H+ +++  
Sbjct: 394 LIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHY 453

Query: 531 KLIGRNDN----PQQHD------------TSEMVKRAHRSPTRNLDLN-LPAEEDEVLVL 573
            +    D+    P   D              E  +R        LD   L  +    +  
Sbjct: 454 NIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQK----IRH 509

Query: 574 DSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECL 633
           DS     S S  NT   LQ     +  I      + D   E+++  I   F   +    +
Sbjct: 510 DSTAWNASGSILNT---LQQLKFYKPYI-----CDNDPKYERLVNAI-LDFLPKIEENLI 560

Query: 634 LEIDRKVMEQLLAAAYLSESNRVIED 659
                 ++ ++   A ++E   + E+
Sbjct: 561 CSKYTDLL-RI---ALMAEDEAIFEE 582
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.98
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.97
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.97
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.94
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.9
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.86
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.85
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.77
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.76
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.76
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.76
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.76
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.75
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.63
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.56
3pvs_A 447 Replication-associated recombination protein A; ma 99.5
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.48
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.48
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.45
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.45
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.45
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.45
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.44
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.44
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.42
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.42
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.42
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.42
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.41
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.38
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.38
3co5_A143 Putative two-component system transcriptional RES 99.37
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.37
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.37
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.36
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.36
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.35
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.35
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.35
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.33
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.33
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.32
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.32
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.31
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.3
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.3
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.3
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.28
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.28
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.28
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.27
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.25
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.24
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.24
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.2
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.2
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.19
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.18
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.17
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.15
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.14
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.1
3bos_A242 Putative DNA replication factor; P-loop containing 99.09
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.09
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.09
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.05
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.03
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.03
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.02
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.98
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.97
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.95
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.93
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.92
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.91
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.9
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.86
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.86
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.84
3f8t_A506 Predicted ATPase involved in replication control, 98.74
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.7
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.62
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.59
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.37
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.33
2qgz_A308 Helicase loader, putative primosome component; str 98.09
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.05
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.92
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.9
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.77
1tue_A212 Replication protein E1; helicase, replication, E1E 97.71
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.57
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.38
2fna_A357 Conserved hypothetical protein; structural genomic 97.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.22
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.21
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.17
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.12
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.11
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.11
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.82
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.78
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.57
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.51
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.47
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.35
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.27
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.95
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.95
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 95.78
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.78
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.73
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.71
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.69
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.62
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.56
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.48
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.47
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.44
1via_A175 Shikimate kinase; structural genomics, transferase 95.42
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.41
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.38
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.37
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.35
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.26
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.25
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.25
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.18
2og2_A359 Putative signal recognition particle receptor; nuc 95.14
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.14
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.11
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.09
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.07
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.05
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.04
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.03
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.0
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.97
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.86
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.86
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.84
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.84
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.77
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.76
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.76
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.73
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.71
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.69
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.69
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.63
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.62
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.59
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.58
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.58
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.54
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.54
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.51
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.51
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.49
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.46
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.45
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.4
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.38
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.36
2xxa_A433 Signal recognition particle protein; protein trans 94.35
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.33
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.32
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.31
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.26
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.26
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.25
1p9r_A418 General secretion pathway protein E; bacterial typ 94.18
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.17
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.14
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.07
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.06
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.06
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.02
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.96
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.75
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.7
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.66
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 93.65
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.64
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.59
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.58
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.56
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.53
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.48
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.47
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.46
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.35
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.34
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.3
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.29
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.26
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.21
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.18
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.18
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.15
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.14
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.14
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.14
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.13
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.1
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.06
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.99
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 92.97
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.97
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.92
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 92.81
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 92.74
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.71
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.65
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 92.49
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.45
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.43
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.4
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.37
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.37
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.35
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.32
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.29
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.27
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.2
1xp8_A366 RECA protein, recombinase A; recombination, radior 92.12
1qzm_A94 ATP-dependent protease LA; oligomerization domain, 92.07
2oap_1511 GSPE-2, type II secretion system protein; hexameri 91.94
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.78
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 91.66
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.57
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.54
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 91.21
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.2
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.12
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 91.12
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.01
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.91
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.9
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.83
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.73
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.69
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 90.68
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.65
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 90.64
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 90.61
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 90.61
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 90.51
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.51
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.49
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 90.45
3kta_A182 Chromosome segregation protein SMC; structural mai 90.41
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.33
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.27
2cvh_A220 DNA repair and recombination protein RADB; filamen 90.23
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.22
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 90.16
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 90.08
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.07
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.84
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 89.84
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 89.63
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.5
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 89.46
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 89.42
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.38
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.36
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.92
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 88.67
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 88.56
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 88.35
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.1
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.8
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 87.79
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 87.75
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 87.59
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.54
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 87.53
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.45
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.31
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 87.26
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.24
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 87.23
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 87.18
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 86.96
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 86.91
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 86.66
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 86.57
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 86.46
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 86.44
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 86.36
2ged_A193 SR-beta, signal recognition particle receptor beta 86.31
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.25
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 86.25
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 86.12
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 86.06
2z43_A324 DNA repair and recombination protein RADA; archaea 85.97
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 85.91
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 85.87
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 85.85
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 85.76
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 85.76
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 85.69
1g6h_A257 High-affinity branched-chain amino acid transport 85.59
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.52
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.48
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 85.44
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 85.36
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 85.33
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.31
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 85.29
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.23
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 85.17
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 85.13
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 85.12
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 84.97
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 84.91
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 84.9
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 84.76
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.76
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 84.6
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 84.5
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 84.48
2ghi_A260 Transport protein; multidrug resistance protein, M 84.48
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 84.47
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 84.45
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 84.42
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 84.39
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 84.26
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 84.26
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 84.22
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 84.18
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 84.1
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 83.96
1nrj_B218 SR-beta, signal recognition particle receptor beta 83.92
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 83.9
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 83.89
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 83.89
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 83.82
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 83.79
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 83.79
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 83.73
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 83.68
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 83.62
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 83.5
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 83.46
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 83.44
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 83.4
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 83.38
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 83.16
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 83.14
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 83.09
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.9
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 82.85
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 82.84
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 82.53
3io5_A333 Recombination and repair protein; storage dimer, i 82.51
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 82.41
2www_A349 Methylmalonic aciduria type A protein, mitochondri 82.39
2wji_A165 Ferrous iron transport protein B homolog; membrane 82.28
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 82.23
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 82.22
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 82.15
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 82.09
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 82.03
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 81.98
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 81.94
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 81.88
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 81.78
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 81.74
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 81.71
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 81.63
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 81.54
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 81.06
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 81.02
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 80.98
3h1t_A590 Type I site-specific restriction-modification syst 80.98
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 80.78
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 80.57
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 80.53
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 80.49
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 80.39
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 80.34
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 80.29
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 80.09
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 80.06
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 80.04
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
Probab=100.00  E-value=4.8e-32  Score=319.84  Aligned_cols=294  Identities=19%  Similarity=0.222  Sum_probs=234.7

Q ss_pred             cchHhHHHHHHHhcCcccccHHHHHHHHHHHHHHhcCCCCCCCCCCCCCeEEEEecCCCCchhHHHHHHHHHHcCCCcce
Q 005186          290 FDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENF  369 (710)
Q Consensus       290 ~d~~~lk~L~k~L~~~ViGQdeAi~~I~~aI~~~r~g~~~~~~~~~r~~~~lLf~GP~GvGKT~LAraLAe~L~gs~~~f  369 (710)
                      .|...+..+++.|.+.|+||++++..|..++...+.|+..++    ++.+++||+||+|||||++|++||+.+   +.+|
T Consensus       444 ~~~~~l~~l~~~l~~~v~g~~~~~~~l~~~i~~~~~g~~~~~----~p~~~~ll~G~~GtGKT~la~~la~~l---~~~~  516 (758)
T 1r6b_X          444 SDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAGLGHEH----KPVGSFLFAGPTGVGKTEVTVQLSKAL---GIEL  516 (758)
T ss_dssp             SHHHHHHHHHHHHTTTSCSCHHHHHHHHHHHHHHHTTCSCTT----SCSEEEEEECSTTSSHHHHHHHHHHHH---TCEE
T ss_pred             hHHHHHHHHHHHHHhhccCHHHHHHHHHHHHHHHhcccCCCC----CCceEEEEECCCCCcHHHHHHHHHHHh---cCCE
Confidence            366788999999999999999999999999999999887764    577899999999999999999999999   5789


Q ss_pred             EEecCCCCCCCCCCCCCccccccccccccccccchhhHHHHHHHhCCCeEEEEeccccCCHHHHHHHHhhHhCCcccCCC
Q 005186          370 ICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSY  449 (710)
Q Consensus       370 I~iD~s~~~~e~~~~~sl~~~~~~G~~~~f~G~t~~~~L~~al~~~p~sVI~LDEIDKa~~~vqn~LLq~LE~G~l~d~~  449 (710)
                      +++||+.+    .+.+.+  ..++|...+|.|....+.+.++++++|++||||||||++++++++.|+++|++|++++..
T Consensus       517 ~~i~~s~~----~~~~~~--~~l~g~~~g~~g~~~~~~l~~~~~~~~~~vl~lDEi~~~~~~~~~~Ll~~le~~~~~~~~  590 (758)
T 1r6b_X          517 LRFDMSEY----MERHTV--SRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNN  590 (758)
T ss_dssp             EEEEGGGC----SSSSCC--SSSCCCCSCSHHHHHTTHHHHHHHHCSSEEEEEETGGGSCHHHHHHHHHHHHHSEEEETT
T ss_pred             EEEechhh----cchhhH--hhhcCCCCCCcCccccchHHHHHHhCCCcEEEEeCccccCHHHHHHHHHHhcCcEEEcCC
Confidence            99999973    333333  355666666666555577899999999999999999999999999999999999999999


Q ss_pred             CeEeecCceEEEEccCCCccccccccccccccchHHHHHHHhhhhhhhhhhhhhhccccccccccccccccchhhhhhhh
Q 005186          450 GREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNK  529 (710)
Q Consensus       450 Gr~vd~~n~I~IlTSN~g~~~~~~~~~~~~~~f~eeki~~~k~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K  529 (710)
                      |+.++|+|++||+|||.+...+.    ....+|..+.                                           
T Consensus       591 g~~~~~~~~~iI~tsN~~~~~~~----~~~~g~~~~~-------------------------------------------  623 (758)
T 1r6b_X          591 GRKADFRNVVLVMTTNAGVRETE----RKSIGLIHQD-------------------------------------------  623 (758)
T ss_dssp             TEEEECTTEEEEEEECSSCC------------------------------------------------------------
T ss_pred             CCEEecCCeEEEEecCcchhhhh----hcccCccccc-------------------------------------------
Confidence            99999999999999998654321    0111221000                                           


Q ss_pred             hhccCCCCCCCCCChHHHHHhhccCCCCccCCCCCcchhhhhhcCCCCCCCCCcccccccchhHHhcCcceeeecCCCCH
Q 005186          530 RKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNF  609 (710)
Q Consensus       530 Rk~~~~~d~~e~~~~~~~~K~~~~~s~~~lDLNlp~~e~e~~~~d~~~~~~d~~~e~~~~f~~efl~RiD~iVvF~PLD~  609 (710)
                                        .                              ......+....|.|+|++|+|.+|.|.||+.
T Consensus       624 ------------------~------------------------------~~~~~~~~~~~~~~~l~~R~~~~i~~~~l~~  655 (758)
T 1r6b_X          624 ------------------N------------------------------STDAMEEIKKIFTPEFRNRLDNIIWFDHLST  655 (758)
T ss_dssp             ----------------------------------------------------CHHHHHHHSCHHHHTTCSEEEECCCCCH
T ss_pred             ------------------h------------------------------HHHHHHHHHHhcCHHHHhhCCcceeeCCCCH
Confidence                              0                              0001122344789999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhcCCCceEEeCHHHHHHHHHhcCCCC-ChHHHHHHHHHHHHHHHHHHHHhcCcCCCCEEEEEE
Q 005186          610 DALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSE-SNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVA  688 (710)
Q Consensus       610 d~Laeiil~~L~~~~~~~~g~~i~LeId~eale~La~~~~~~~-GaR~le~~IE~vl~~~L~el~~~~~~~~~~~v~Lv~  688 (710)
                      +++..++...+.+...+.-..++.+.++++|+++|+.++|... |+|.|+++|++.+.++|++.+..++...+..|++..
T Consensus       656 ~~~~~i~~~~l~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~~~~g~R~l~~~i~~~~~~~l~~~~l~~~~~~~~~~~~~~  735 (758)
T 1r6b_X          656 DVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFGSLVDGGQVTVAL  735 (758)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTEEEEECHHHHHHHHHHHCBTTTBTTTHHHHHHHHHTHHHHHHHHHSTTTTCEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCcEEEeCHHHHHHHHHhCCCcCCCchHHHHHHHHHHHHHHHHHHHcCcCCCCCEEEEEE
Confidence            9887777665543222221246789999999999999999888 999999999999999999999999988888887766


Q ss_pred             ecC
Q 005186          689 CEG  691 (710)
Q Consensus       689 ~~~  691 (710)
                      .++
T Consensus       736 ~~~  738 (758)
T 1r6b_X          736 DKE  738 (758)
T ss_dssp             EGG
T ss_pred             eCC
Confidence            543
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 710
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 4e-23
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 6e-14
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-05
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score = 98.6 bits (245), Expect = 4e-23
 Identities = 55/219 (25%), Positives = 92/219 (42%), Gaps = 19/219 (8%)

Query: 291 DLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDI-WFNFTGPDLC 349
           +      L   L +++  QDEAI  ++  I + R G +D     P R I  F F GP   
Sbjct: 10  EREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKD-----PNRPIGSFLFLGPTGV 64

Query: 350 GKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQV--VGGDSVQFRGKTLADY 407
           GK ++A  LA  ++  +E  I  D+     +        H V  + G    + G      
Sbjct: 65  GKTELAKTLAATLFDTEEAMIRIDMTEYMEK--------HAVSRLIGAPPGYVGYEEGGQ 116

Query: 408 VAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFV 467
           +   + ++P SV+  + ++KA   V N L + +  G+L DS+GR V   N + +  S+  
Sbjct: 117 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNL- 175

Query: 468 EDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNR 506
                L  E     +  E+I     ++ Q    P  +NR
Sbjct: 176 --GSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNR 212
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.92
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.87
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.72
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.6
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.44
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.42
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.4
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.39
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.38
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.33
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.31
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.28
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.26
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.25
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.23
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.17
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.15
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.13
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.08
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.06
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.92
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.81
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.8
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.68
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.48
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.9
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.52
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.17
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.9
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.86
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.86
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.62
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.59
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.57
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.56
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.54
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.49
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.43
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.42
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.25
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.21
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.13
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.97
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.84
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.74
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.71
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.67
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.54
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.49
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.48
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.46
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.46
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.38
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.37
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.34
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.32
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.28
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.23
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.17
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.07
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.8
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.75
d1okkd2207 GTPase domain of the signal recognition particle r 94.72
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.68
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.63
d2qy9a2211 GTPase domain of the signal recognition particle r 94.59
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.54
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.38
d1vmaa2213 GTPase domain of the signal recognition particle r 94.35
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.16
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.11
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.08
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.31
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.21
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.03
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.89
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.67
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 92.34
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.02
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.92
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.69
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.57
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.36
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.33
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.02
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.01
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.84
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.99
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.37
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.04
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.94
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.87
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.32
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 88.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.56
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.49
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.28
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.25
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.16
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 86.95
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.78
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.6
d2awna2232 Maltose transport protein MalK, N-terminal domain 86.59
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.32
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 86.23
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.22
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.02
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 85.95
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.93
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 85.75
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 85.74
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.67
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.48
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 85.4
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 85.37
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 85.31
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 85.17
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 84.9
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 83.68
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.64
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 83.61
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.48
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 83.43
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.11
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.06
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 82.83
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 82.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 82.82
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 82.77
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 82.69
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 82.67
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.62
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 82.48
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.27
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 82.2
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 82.12
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 82.1
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.9
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.83
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 81.79
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 81.68
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 81.66
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.63
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 81.38
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.35
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 81.26
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 81.14
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 81.08
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 80.82
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 80.74
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 80.58
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 80.43
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 80.3
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 80.22
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.17
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.5e-44  Score=383.60  Aligned_cols=293  Identities=19%  Similarity=0.225  Sum_probs=240.3

Q ss_pred             cchHhHHHHHHHhcCcccccHHHHHHHHHHHHHHhcCCCCCCCCCCCCCeEEEEecCCCCchhHHHHHHHHHHcCCCcce
Q 005186          290 FDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENF  369 (710)
Q Consensus       290 ~d~~~lk~L~k~L~~~ViGQdeAi~~I~~aI~~~r~g~~~~~~~~~r~~~~lLf~GP~GvGKT~LAraLAe~L~gs~~~f  369 (710)
                      .|.+++++|++.|+++|+||++|++.|+.+|.+++.|+..++    +|.+++||+||+|||||+||++||+.+   ..+|
T Consensus         8 ~d~~~l~~l~~~L~~~viGQ~~a~~~v~~~v~~~~~~l~~~~----~p~~~~lf~Gp~GvGKT~lak~la~~l---~~~~   80 (315)
T d1r6bx3           8 SDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAGLGHEH----KPVGSFLFAGPTGVGKTEVTVQLSKAL---GIEL   80 (315)
T ss_dssp             SHHHHHHHHHHHHTTTSCSCHHHHHHHHHHHHHHHTTCSCTT----SCSEEEEEECSTTSSHHHHHHHHHHHH---TCEE
T ss_pred             hHHHHHHHHHHHhCCeecChHHHHHHHHHHHHHHHccCCCCC----CCceEEEEECCCcchhHHHHHHHHhhc---cCCe
Confidence            488999999999999999999999999999999999988775    578899999999999999999999998   5789


Q ss_pred             EEecCCCCCCCCCCCCCccccccccccccccccchhhHHHHHHHhCCCeEEEEeccccCCHHHHHHHHhhHhCCcccCCC
Q 005186          370 ICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSY  449 (710)
Q Consensus       370 I~iD~s~~~~e~~~~~sl~~~~~~G~~~~f~G~t~~~~L~~al~~~p~sVI~LDEIDKa~~~vqn~LLq~LE~G~l~d~~  449 (710)
                      +++||+.    |.+.+++.  .++|...+|.|....+.+.+.+.++|++||+||||||||++|++.|+++|++|+++|+.
T Consensus        81 i~~d~s~----~~~~~~~~--~l~g~~~gy~g~~~~~~l~~~~~~~~~~vvl~DeieKa~~~V~~~lLqild~G~ltd~~  154 (315)
T d1r6bx3          81 LRFDMSE----YMERHTVS--RLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNN  154 (315)
T ss_dssp             EEEEGGG----CSSSSCCS--SSCCCCSCSHHHHHTTHHHHHHHHCSSEEEEEETGGGSCHHHHHHHHHHHHHSEEEETT
T ss_pred             eEecccc----ccchhhhh--hhcccCCCccccccCChhhHHHHhCccchhhhcccccccchHhhhhHHhhccceecCCC
Confidence            9999997    44444432  45666666666666688999999999999999999999999999999999999999999


Q ss_pred             CeEeecCceEEEEccCCCccccccccccccccchHHHHHHHhhhhhhhhhhhhhhccccccccccccccccchhhhhhhh
Q 005186          450 GREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNK  529 (710)
Q Consensus       450 Gr~vd~~n~I~IlTSN~g~~~~~~~~~~~~~~f~eeki~~~k~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K  529 (710)
                      |+.++|+|+|+|||||+|...+..    ...+|..+                                            
T Consensus       155 Gr~vdf~n~iiI~Tsnig~~~i~~----~~~~~~~~--------------------------------------------  186 (315)
T d1r6bx3         155 GRKADFRNVVLVMTTNAGVRETER----KSIGLIHQ--------------------------------------------  186 (315)
T ss_dssp             TEEEECTTEEEEEEECSSCC------------------------------------------------------------
T ss_pred             CCccCccceEEEeccchhhHHHHh----hhccchhh--------------------------------------------
Confidence            999999999999999998654310    00001000                                            


Q ss_pred             hhccCCCCCCCCCChHHHHHhhccCCCCccCCCCCcchhhhhhcCCCCCCCCCcccccccchhHHhcCcceeeecCCCCH
Q 005186          530 RKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNF  609 (710)
Q Consensus       530 Rk~~~~~d~~e~~~~~~~~K~~~~~s~~~lDLNlp~~e~e~~~~d~~~~~~d~~~e~~~~f~~efl~RiD~iVvF~PLD~  609 (710)
                                      . .                              ......++...|+|||++|||++|+|+||+.
T Consensus       187 ----------------~-~------------------------------~~~~~~~l~~~f~pEflnRid~ii~f~~l~~  219 (315)
T d1r6bx3         187 ----------------D-N------------------------------STDAMEEIKKIFTPEFRNRLDNIIWFDHLST  219 (315)
T ss_dssp             ----------------------------------------------------CHHHHHHHSCHHHHTTCSEEEECCCCCH
T ss_pred             ----------------h-h------------------------------hHhHHHHHHHhcCHHHHhhhhhhhcccchhh
Confidence                            0 0                              0001123455899999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhcCCCceEEeCHHHHHHHHHhcCCCC-ChHHHHHHHHHHHHHHHHHHHHhcCcCCCCEEEEEE
Q 005186          610 DALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSE-SNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVA  688 (710)
Q Consensus       610 d~Laeiil~~L~~~~~~~~g~~i~LeId~eale~La~~~~~~~-GaR~le~~IE~vl~~~L~el~~~~~~~~~~~v~Lv~  688 (710)
                      +++.+++...+.....+....++.+.++++|+++|++.+|.+. |+|+|++.|++.+.++|++.++..+...+..|++..
T Consensus       220 ~~~~~I~~~~l~~~~~~l~~~~i~l~~~~~a~~~l~~~~yd~~~GaR~L~r~Ie~~i~~~la~~il~~~~~~g~~i~V~~  299 (315)
T d1r6bx3         220 DVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFGSLVDGGQVTVAL  299 (315)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTEEEEECHHHHHHHHHHHCBTTTBTTTHHHHHHHHHTHHHHHHHHHSTTTTCEEEEEEE
T ss_pred             hHHHHHHHHHHHHHHHHHHhcCcchhhHHHHHHHHHHhCCCCCCChhhHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEEE
Confidence            9887776555544333332358999999999999999999998 999999999999999999999999988888887765


Q ss_pred             ec
Q 005186          689 CE  690 (710)
Q Consensus       689 ~~  690 (710)
                      ..
T Consensus       300 ~~  301 (315)
T d1r6bx3         300 DK  301 (315)
T ss_dssp             EG
T ss_pred             EC
Confidence            54
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure