Citrus Sinensis ID: 005204

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------71
MRFLLQHNPIAGSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFSSSPRRLITTSLAFKRINNNNYKNDDDNNNNHHPLTLRTKDLSSVSYRNHPTPTSETEEKMLDSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSKMKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
cccccccccccccccccccccccEEEEcccccEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccEEEEEEccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHccccHHHHHHcccEEcccccEEEEEEEEEEccEEEEEEEccccccccccccccccccccccccccccEEEEcccHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccHHHHHcccEEEEEEEcccccccccccEEEEEEEEEcccccEEEEEEEEEEcccccEEccc
ccEEEccccccccccHHHHHHHHHHEEcccccHHHHHccccEEEcccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEcccccccccccccEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHccccHHHHHHcccEEEcccccEEEEEEEccccEEEEEEEEccccEEEEccccccccccHHHcccccEEEEEccHHHHHHHHHHccccEEEcccccccHHcHcccccccccccccccHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHccHHHHHHHHHHcccccccccEcHHHHHHHHHHHHcccccccccccccccHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEccHHHHHccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccEccccccHHHHHHcccEEEEEEccccccccccccEEEEEEEEEccccccEEEEEEEcccccEEEEcc
mrfllqhnpiagsfshsrlHKLSYLFMDSSTLRTAAASTRlftinsspcfsssprrliTTSLAFKRinnnnykndddnnnnhhpltlrtkdlssvsyrnhptptseteekmLDSRSWEILKIKLKQLGldigrcapgvenrmlcpkcnggdseelslslfldedgFSAVWMCFRakcgwkgstsalvdnnrsqsslKKFSKMKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMqkrhghevviafpywrngklvnckyrDFNKKFWQEKDTEKVFyglddiegesDIIIVEgemdklsmeeagflncvsvpdgapssvskknvpseeqdtkYQYLWNCKMYLKQASRIIlatdgdppgQALAEELARRVGrercwrvrwpkkndvdhfkdANEVLMYLGPGALKEVVEnaelypimglfnfrDYFDEIDAyyhrtsgdefgiSTGWRALNELYnvlpgeltivtgvpnsgkseWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKkpffeanyggsaermTVEEFEQGKAWLSNTFSlircendslpsiKWVLDLAKAAVLRHgvrglvidpyneldhqrpvsqTETEYVSQMLTMVKRFAQHHACHvwfvahprqlhnwvgeppnlydisgsahfinkcdngivihrnrdpeagpidrVQVCVRKVRNKVVGTIGEAFLSYnrvtgeymdiv
mrfllqhnpiagsfshsrLHKLSYLFMDSSTLRTAAASTRLftinsspcfsssprrLITTSLAFKRINNnnykndddnnnnHHPLTlrtkdlssvsyrnhptptseteekmldSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGStsalvdnnrsqsslkkfskmkTIREitedsleleplgNELRAYFAERLISAETLRrnrvmqkrhghevviafpywrngklVNCKYRDFNKKFWQEKDTEKVfyglddiegESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPssvskknvpseeqdtKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELArrvgrercwrvrwpkkndvdhfkdANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIdpyneldhqrpvSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNrdpeagpidrvqvcVRKVRnkvvgtigeaflsynrvtgeymdiv
MRFLLQHNPIAGSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFSSSPRRLITTSLAFKRInnnnykndddnnnnHHPLTLRTKDLSSVSYRNHPTPTSETEEKMLDSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNggdseelslslfldedgfsAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSKMKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELArrvgrercwrvrwPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
***********GSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFS***RRLITTSLAFKRI************************************************SWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSA*****************************LEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVS*********************KYQYLWNCKMYLKQASRIILATDGD***QALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYM***
*RF****NPIAG*FSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPC*******************************************************************WEILKIKLKQLGLDIGRCAPGVENRMLCPKCN******LSLSLFLDEDGFSAVWMCFRAKCGWKGSTSAL***************************ELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKK*WQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYN*****************QMLTMVKRFAQHHACHVWFV******************ISGSAHFINKCDNGIVIHRNRDP***PIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
MRFLLQHNPIAGSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFSSSPRRLITTSLAFKRINNNNYKNDDDNNNNHHPLTLRTKDLSSVS****************DSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSKMKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPD****************DTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
*RFLLQHNPIAGSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFSSSPRRLITTSLAFKRINNNNYKNDDDNNNNHHPLTLRTKDLSSVSYRNHPTPTSETEEKMLDSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSA****************MKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFLLQHNPIAGSFSHSRLHKLSYLFMDSSTLRTAAASTRLFTINSSPCFSSSPRRLITTSLAFKRINNNNYKNDDDNNNNHHPLTLRTKDLSSVSYRNHPTPTSETEEKMLDSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSKMKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query709 2.2.26 [Sep-21-2011]
P03692566 DNA primase/helicase OS=E no no 0.607 0.761 0.242 1e-11
P20315566 DNA primase/helicase OS=E no no 0.568 0.712 0.240 3e-09
Q96RR1684 Twinkle protein, mitochon yes no 0.698 0.723 0.213 4e-09
Q8CIW5685 Twinkle protein, mitochon yes no 0.603 0.624 0.221 2e-08
Q5ZIW1669 Twinkle protein, mitochon yes no 0.606 0.642 0.208 2e-07
>sp|P03692|PRIM_BPT7 DNA primase/helicase OS=Enterobacteria phage T7 GN=4 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 123/507 (24%), Positives = 199/507 (39%), Gaps = 76/507 (14%)

Query: 226 FAERLISAETLRRNRV-MQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEK-V 283
              R IS ET ++    + K  G    +A    +NG +V+ K RD +K F      +   
Sbjct: 81  LTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDA 140

Query: 284 FYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKYQY 343
            +G     G   I++ EGE+D L++ E        V  G  +S +KK   +  +      
Sbjct: 141 LFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYE------ 194

Query: 344 LWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKDANEV 403
                 Y  Q  +IIL  D D  G+   EE A+ +   +      P        KDANE 
Sbjct: 195 ------YFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLP-------CKDANEC 241

Query: 404 LMYLGPGALKEVVENAELY---PIMGLFNFRDYFDEIDAYYHRTSGDEFGIS-TGWRALN 459
            +      + E V NA  +    ++   + R+   E     H +S +  G+  +G   +N
Sbjct: 242 HLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIRE-----HLSSEESVGLLFSGCTGIN 296

Query: 460 E-LYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEK 518
           +       GE+ +VT     GKS ++           G K  L  +E  V E A  L+  
Sbjct: 297 DKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGL 356

Query: 519 HIKKPFFEANYGGSAERMTVE--EFEQGKAWLSNTF---------SLIRCENDSLPSIKW 567
           H +    +++   S +R  +E  +F+Q   W    F         S    E D L     
Sbjct: 357 HNRVRLRQSD---SLKREIIENGKFDQ---WFDELFGNDTFHLYDSFAEAETDRL----- 405

Query: 568 VLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQT-----ETEYVSQMLTMVKRFAQHHAC 622
              LAK A +R G+   VI     LDH   V        E + +  ++T +K FA+    
Sbjct: 406 ---LAKLAYMRSGLGCDVI----ILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGV 458

Query: 623 HVWFVAHPR-----QLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQ 677
            +  + H +     + H   G P ++ D+ GS       D  I + RN+  +   +    
Sbjct: 459 VLVVICHLKNPDKGKAHE-EGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNL---- 513

Query: 678 VCVRKVRNKVVGTIGEA-FLSYNRVTG 703
           V VR ++ +  G  G A ++ YN+ TG
Sbjct: 514 VLVRILKCRFTGDTGIAGYMEYNKETG 540
DNA primase synthesizes RNA primers necessary for replication by DNA polymerase. It also functions as an ATP-dependent unwinding protein. Has a 5'->3' helicase activity; 4a also has a DNA primase activity.
Escherichia coli (taxid: 562)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|P20315|PRIM_BPT3 DNA primase/helicase OS=Enterobacteria phage T3 GN=4 PE=3 SV=1 Back     alignment and function description
>sp|Q96RR1|PEO1_HUMAN Twinkle protein, mitochondrial OS=Homo sapiens GN=PEO1 PE=1 SV=1 Back     alignment and function description
>sp|Q8CIW5|PEO1_MOUSE Twinkle protein, mitochondrial OS=Mus musculus GN=Peo1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIW1|PEO1_CHICK Twinkle protein, mitochondrial OS=Gallus gallus GN=PEO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query709
225444145705 PREDICTED: uncharacterized protein LOC10 0.881 0.886 0.722 0.0
356555942678 PREDICTED: uncharacterized protein LOC10 0.871 0.911 0.738 0.0
356532467679 PREDICTED: uncharacterized protein LOC10 0.870 0.908 0.731 0.0
224056777658 predicted protein [Populus trichocarpa] 0.833 0.898 0.711 0.0
255564299700 nucleic acid binding protein, putative [ 0.837 0.848 0.707 0.0
413943393736 hypothetical protein ZEAMMB73_832314 [Ze 0.850 0.819 0.666 0.0
449488512679 PREDICTED: twinkle protein, mitochondria 0.826 0.863 0.671 0.0
302141745696 unnamed protein product [Vitis vinifera] 0.926 0.943 0.640 0.0
242093886770 hypothetical protein SORBIDRAFT_10g02699 0.863 0.794 0.647 0.0
30692010709 toprim domain-containing protein [Arabid 0.874 0.874 0.635 0.0
>gi|225444145|ref|XP_002268852.1| PREDICTED: uncharacterized protein LOC100257655 [Vitis vinifera] gi|297740887|emb|CBI31069.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/627 (72%), Positives = 513/627 (81%), Gaps = 2/627 (0%)

Query: 84  PLTLRTKDLSSVSYRNHPTPT-SETEEKMLDSRS-WEILKIKLKQLGLDIGRCAPGVENR 141
           P++L+T  L   S+ N P P  SE  E   +S +   +LK KL+ +G D      G  + 
Sbjct: 73  PISLKTFALPYTSHSNVPGPVYSENPEDTSNSSARLNVLKKKLEVIGFDTQMLKTGQYSH 132

Query: 142 MLCPKCNGGDSEELSLSLFLDEDGFSAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSK 201
           + CP C GGDS E SLSLF+  DG  AVWMC R KCG +G+  A V+++ S   L + +K
Sbjct: 133 LTCPTCKGGDSMEKSLSLFITLDGDHAVWMCHRGKCGSRGNIRAFVNDSSSYGRLNQITK 192

Query: 202 MKTIREITEDSLELEPLGNELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGK 261
           +K  REITE+SL L+PL +EL AYF ER+IS +TL RN VMQK +G + +IAF Y RNG 
Sbjct: 193 IKPKREITEESLGLKPLCSELVAYFGERMISEKTLARNSVMQKSYGDQFIIAFTYRRNGV 252

Query: 262 LVNCKYRDFNKKFWQEKDTEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPD 321
           LV+CKYRD NK FWQEKDTEK+FYG+DDI+  SDIIIVEGE+DKLSMEEAGF NCVSVPD
Sbjct: 253 LVSCKYRDVNKNFWQEKDTEKIFYGVDDIKEASDIIIVEGEIDKLSMEEAGFYNCVSVPD 312

Query: 322 GAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRE 381
           GAP SVS K   S E+D KYQYLWNCK YL++ASRIILATDGD PG ALAEELARR+GRE
Sbjct: 313 GAPPSVSTKVFESAEKDIKYQYLWNCKEYLEKASRIILATDGDAPGLALAEELARRLGRE 372

Query: 382 RCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYY 441
           RCWRV+WPKKN+V+HFKDANEVLMYLGP  LKEV+ENAE+YPI GLFNF  YF+EID YY
Sbjct: 373 RCWRVKWPKKNEVEHFKDANEVLMYLGPDVLKEVIENAEIYPIQGLFNFSHYFNEIDGYY 432

Query: 442 HRTSGDEFGISTGWRALNELYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVL 501
           H T G E G+STGWR LN LYNV+PGELT+VTGVPNSGKSEWIDAL+CNIN   GW F L
Sbjct: 433 HHTLGFELGVSTGWRGLNGLYNVVPGELTVVTGVPNSGKSEWIDALLCNINRSVGWSFAL 492

Query: 502 CSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDS 561
           CSMENKVREHARKLLEKHIKKPFF+A YG S ERMTVEEFE GK WLS TF LIRCE DS
Sbjct: 493 CSMENKVREHARKLLEKHIKKPFFKAGYGESIERMTVEEFELGKKWLSETFYLIRCEKDS 552

Query: 562 LPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHA 621
           LP+IKWVLDLAK+AVLRHGVRGLVIDPYNELDHQRP  QTETEYVSQMLTM+KRFAQHH+
Sbjct: 553 LPNIKWVLDLAKSAVLRHGVRGLVIDPYNELDHQRPPGQTETEYVSQMLTMIKRFAQHHS 612

Query: 622 CHVWFVAHPRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVR 681
           CHVWFVAHPRQLH W G PPN+YDISGSAHFINKCDNGIVIHRNR+PEAGP+D+VQVCVR
Sbjct: 613 CHVWFVAHPRQLHQWNGGPPNMYDISGSAHFINKCDNGIVIHRNRNPEAGPVDQVQVCVR 672

Query: 682 KVRNKVVGTIGEAFLSYNRVTGEYMDI 708
           KVRNKVVGTIG+AFLSY+R++G Y DI
Sbjct: 673 KVRNKVVGTIGDAFLSYDRISGVYTDI 699

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356555942|ref|XP_003546288.1| PREDICTED: uncharacterized protein LOC100779625 [Glycine max] Back     alignment and taxonomy information
>gi|356532467|ref|XP_003534794.1| PREDICTED: uncharacterized protein LOC100804637 [Glycine max] Back     alignment and taxonomy information
>gi|224056777|ref|XP_002299018.1| predicted protein [Populus trichocarpa] gi|222846276|gb|EEE83823.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255564299|ref|XP_002523146.1| nucleic acid binding protein, putative [Ricinus communis] gi|223537553|gb|EEF39177.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|413943393|gb|AFW76042.1| hypothetical protein ZEAMMB73_832314 [Zea mays] Back     alignment and taxonomy information
>gi|449488512|ref|XP_004158064.1| PREDICTED: twinkle protein, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302141745|emb|CBI18948.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|242093886|ref|XP_002437433.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] gi|241915656|gb|EER88800.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|30692010|ref|NP_849735.1| toprim domain-containing protein [Arabidopsis thaliana] gi|209529811|gb|ACI49800.1| At1g30680 [Arabidopsis thaliana] gi|332193138|gb|AEE31259.1| toprim domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query709
TAIR|locus:2204584709 AT1G30680 [Arabidopsis thalian 0.913 0.913 0.585 6.3e-211
TAIR|locus:2204559337 AT1G30660 "AT1G30660" [Arabido 0.442 0.931 0.512 3.7e-80
UNIPROTKB|Q1L7I7765 Q1L7I7 "Mitochondrial helicase 0.471 0.436 0.239 1.5e-11
DICTYBASE|DDB_G0288209772 DDB_G0288209 "T7-like mitochon 0.461 0.423 0.231 5e-10
UNIPROTKB|Q1L7I8724 Q1L7I8 "Mitochondrial helicase 0.455 0.446 0.216 2.3e-06
UNIPROTKB|Q6NU50679 MGC81247 "MGC81247 protein" [X 0.346 0.362 0.249 0.00017
TAIR|locus:2204584 AT1G30680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2039 (722.8 bits), Expect = 6.3e-211, P = 6.3e-211
 Identities = 390/666 (58%), Positives = 486/666 (72%)

Query:    46 SSPCFSSSPRRLITTSLAFKRIXXXXXXXXXXXXXXHHPLTLRTKDLSSV-SYRNHPTPT 104
             SSP +SSS R++ + S  F+ +              + P   RT  LSS  S    PTP 
Sbjct:    42 SSPSYSSS-RQVSSVSRRFRPVLASRPVSK------NSPYYQRTNGLSSYNSIPRVPTPV 94

Query:   105 S---ETEEKMLDSRSWEILKIKLKQLGLDIGRCAPGVENRMLCPKCNXXXXXXXXXXXXX 161
                 E +++++ SR    L+ KL + G+D   C PG  + ++CP C              
Sbjct:    95 DTEVEADKRVVLSRL-VTLRRKLAEQGVDAENCPPGQHSGLICPTCEGGNSGEKSLSLFI 153

Query:   162 XXXXXXAVWMCFRAKCGWKGSTSALVDNNRSQSSLKKFSKMKTIREITEDSLELEPLGNE 221
                   A W CFR KCG KG   A    +   +S     K++  R+IT + +ELEPL +E
Sbjct:   154 APDGSSATWNCFRGKCGLKGGVRA----DGGLASADPIEKVE--RKITVEGIELEPLCDE 207

Query:   222 LRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTE 281
             ++ YFA R IS +TL RNRVMQKR G E+VIAF YW+ G+LV+CKYR   K F+QE+ T 
Sbjct:   208 IQDYFAARAISRKTLERNRVMQKRIGDEIVIAFTYWQRGELVSCKYRSLTKMFFQERKTR 267

Query:   282 KVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNCVSVPDGAPSSVSKKNVPSEEQDTKY 341
             ++ YGLDDIE  S++IIVEGE+DKL+MEEAGFLNCVSVPDGAP+ VS K +PSE++DTKY
Sbjct:   268 RILYGLDDIEKTSEVIIVEGEIDKLAMEEAGFLNCVSVPDGAPAKVSSKEIPSEDKDTKY 327

Query:   342 QYLWNCKMYLKQASRIILATDGDPPGQALAEELAXXXXXXXXXXXXXPKKNDVDHFKDAN 401
             ++LWNC  YLK+ASRI++ATDGD PGQA+AEE+A             PKK++ +HFKDAN
Sbjct:   328 KFLWNCNDYLKKASRIVIATDGDGPGQAMAEEIARRLGKERCWRVKWPKKSEDEHFKDAN 387

Query:   402 EVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALNEL 461
             EVLM  GP  LKE + +AE YPI+GLF+F+D+FDEIDAYY RT G E+G+STGW+ L+ L
Sbjct:   388 EVLMSKGPHLLKEAILDAEPYPILGLFSFKDFFDEIDAYYDRTHGHEYGVSTGWKNLDNL 447

Query:   462 YNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIK 521
             Y+V+PGELT+VTG+PNSGKSEWIDA++CN+N   GWKF LCSMENKVR+HARKLLEKHIK
Sbjct:   448 YSVVPGELTVVTGIPNSGKSEWIDAMLCNLNHSVGWKFALCSMENKVRDHARKLLEKHIK 507

Query:   522 KPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGV 581
             KPFF+A+YG S +RM+VEE ++GK WL++TF  IRCE DSLPSI WVL+ AKAAVLR+G+
Sbjct:   508 KPFFDADYGRSVQRMSVEEKDEGKKWLNDTFYPIRCEMDSLPSIDWVLERAKAAVLRYGI 567

Query:   582 RGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPRQLHNWVGEPP 641
             RGLVIDPYNELDHQR   QTETEYVSQMLT +KRF+QHH+CHVWFVAHP+QL +W G  P
Sbjct:   568 RGLVIDPYNELDHQRTPRQTETEYVSQMLTKIKRFSQHHSCHVWFVAHPKQLQHWDGGAP 627

Query:   642 NLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRV 701
             NLYDISGSAHFINKCDNGI++HRNRD  AGP+D VQ+ VRKVRNKV G IG+A+L Y+R 
Sbjct:   628 NLYDISGSAHFINKCDNGIIVHRNRDENAGPLDLVQIGVRKVRNKVAGQIGDAYLCYDRT 687

Query:   702 TGEYMD 707
             TG Y D
Sbjct:   688 TGSYSD 693
GO:0003678 "DNA helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006260 "DNA replication" evidence=IEA
TAIR|locus:2204559 AT1G30660 "AT1G30660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1L7I7 Q1L7I7 "Mitochondrial helicase twinkle" [Acanthamoeba castellanii (taxid:5755)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288209 DDB_G0288209 "T7-like mitochondrial DNA helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q1L7I8 Q1L7I8 "Mitochondrial helicase twinkle" [Vermamoeba vermiformis (taxid:5778)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NU50 MGC81247 "MGC81247 protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_I003289
hypothetical protein (658 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query709
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohex 1e-15
pfam1366281 pfam13662, Toprim_4, Toprim domain 5e-13
cd0102979 cd01029, TOPRIM_primases, TOPRIM_primases: The top 8e-11
COG0358568 COG0358, DnaG, DNA primase (bacterial type) [DNA r 2e-09
cd0018883 cd00188, TOPRIM, Topoisomerase-primase domain 9e-09
pfam1315590 pfam13155, Toprim_2, Toprim-like 2e-08
pfam0175186 pfam01751, Toprim, Toprim domain 2e-07
smart0049375 smart00493, TOPRIM, topoisomerases, DnaG-type prim 2e-07
cd0336479 cd03364, TOPRIM_DnaG_primases, TOPRIM_DnaG_primase 9e-07
pfam13481154 pfam13481, AAA_25, AAA domain 1e-05
TIGR01391415 TIGR01391, dnaG, DNA primase, catalytic core 2e-05
COG0305435 COG0305, DnaB, Replicative DNA helicase [DNA repli 5e-05
PRK07004460 PRK07004, PRK07004, replicative DNA helicase; Prov 7e-05
TIGR00665434 TIGR00665, DnaB, replicative DNA helicase 0.001
PRK05748448 PRK05748, PRK05748, replicative DNA helicase; Prov 0.001
PRK07773 886 PRK07773, PRK07773, replicative DNA helicase; Vali 0.001
>gnl|CDD|238542 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information 
 Score = 77.4 bits (191), Expect = 1e-15
 Identities = 63/262 (24%), Positives = 114/262 (43%), Gaps = 17/262 (6%)

Query: 454 GWRALNE-LYNVLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHA 512
            +  LN+    +  GEL I+T     GK+ ++     ++    G +    S+E  V   A
Sbjct: 16  PFPVLNKLTKGLRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEEPVVRTA 75

Query: 513 RKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRC---ENDSLPSIKWVL 569
           R+LL ++  K     +   +    T+EEF+   A         R    ++    S+  VL
Sbjct: 76  RRLLGQYAGKRL---HLPDTVFIYTLEEFD---AAFDEFEGTGRLFMYDSFGEYSMDSVL 129

Query: 570 DLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAH 629
           +  +   + HG++ ++ID  + +      S  E + + +++T ++ FA  H  H+  V+H
Sbjct: 130 EKVRYMAVSHGIQHIIIDNLSIMVSDERASGDERKALDEIMTKLRGFATEHGIHITLVSH 189

Query: 630 PRQ----LHNWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRN 685
            R+      +  G   +L D  GSA      DN I + RN+   A   +R    +R ++N
Sbjct: 190 LRRPDGDKTHEEGGEVSLSDFRGSAAIGQLADNVIALERNQQ--AELDERNTTYLRILKN 247

Query: 686 KVVGTIGEAF-LSYNRVTGEYM 706
           +  G  G A  L Y++ TG   
Sbjct: 248 RFTGGTGVAGPLEYDKETGRLS 269

Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands. Length = 271
>gnl|CDD|222298 pfam13662, Toprim_4, Toprim domain Back     alignment and domain information
>gnl|CDD|173779 cd01029, TOPRIM_primases, TOPRIM_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of bacterial DnaG-type primases and their homologs Back     alignment and domain information
>gnl|CDD|223435 COG0358, DnaG, DNA primase (bacterial type) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173773 cd00188, TOPRIM, Topoisomerase-primase domain Back     alignment and domain information
>gnl|CDD|221942 pfam13155, Toprim_2, Toprim-like Back     alignment and domain information
>gnl|CDD|216679 pfam01751, Toprim, Toprim domain Back     alignment and domain information
>gnl|CDD|214695 smart00493, TOPRIM, topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins Back     alignment and domain information
>gnl|CDD|173784 cd03364, TOPRIM_DnaG_primases, TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|233392 TIGR01391, dnaG, DNA primase, catalytic core Back     alignment and domain information
>gnl|CDD|223382 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235907 PRK07004, PRK07004, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|233080 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information
>gnl|CDD|180232 PRK05748, PRK05748, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236093 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 709
PRK08006471 replicative DNA helicase; Provisional 100.0
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 100.0
PRK08840464 replicative DNA helicase; Provisional 100.0
PRK05636505 replicative DNA helicase; Provisional 100.0
PRK07004460 replicative DNA helicase; Provisional 100.0
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 100.0
PRK08760476 replicative DNA helicase; Provisional 100.0
PRK05595444 replicative DNA helicase; Provisional 100.0
PRK06321472 replicative DNA helicase; Provisional 100.0
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 100.0
PRK06904472 replicative DNA helicase; Validated 100.0
PRK06749428 replicative DNA helicase; Provisional 100.0
PRK08506472 replicative DNA helicase; Provisional 100.0
PRK09165497 replicative DNA helicase; Provisional 100.0
TIGR00665434 DnaB replicative DNA helicase. This model describe 100.0
PHA02542473 41 41 helicase; Provisional 100.0
PRK05748448 replicative DNA helicase; Provisional 100.0
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 100.0
TIGR01391415 dnaG DNA primase, catalytic core. This protein con 100.0
PRK05667580 dnaG DNA primase; Validated 100.0
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 100.0
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 100.0
PHA02540337 61 DNA primase; Provisional 100.0
COG0358568 DnaG DNA primase (bacterial type) [DNA replication 100.0
PHA02415 930 DNA primase domain-containing protein 99.96
PRK07773 886 replicative DNA helicase; Validated 99.96
TIGR00646218 MG010 DNA primase-related protein. The DNA primase 99.94
PRK08624373 hypothetical protein; Provisional 99.94
PHA02031266 putative DnaG-like primase 99.92
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 99.89
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 99.86
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 99.85
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 99.84
PRK11823 446 DNA repair protein RadA; Provisional 99.83
PRK05973237 replicative DNA helicase; Provisional 99.83
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 99.82
cd01393226 recA_like RecA is a bacterial enzyme which has rol 99.8
PRK09361225 radB DNA repair and recombination protein RadB; Pr 99.79
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 99.79
cd01394218 radB RadB. The archaeal protein radB shares simila 99.79
PRK04328249 hypothetical protein; Provisional 99.78
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 99.77
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 99.77
cd00983325 recA RecA is a bacterial enzyme which has roles in 99.76
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 99.75
TIGR02012321 tigrfam_recA protein RecA. This model describes or 99.75
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 99.75
PRK09354349 recA recombinase A; Provisional 99.74
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 99.73
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 99.73
PLN03186342 DNA repair protein RAD51 homolog; Provisional 99.73
PRK09302 509 circadian clock protein KaiC; Reviewed 99.72
TIGR02237209 recomb_radB DNA repair and recombination protein R 99.72
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 99.71
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 99.71
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 99.7
PTZ00035337 Rad51 protein; Provisional 99.69
PRK04301317 radA DNA repair and recombination protein RadA; Va 99.69
TIGR02236310 recomb_radA DNA repair and recombination protein R 99.68
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 99.67
PRK06067234 flagellar accessory protein FlaH; Validated 99.67
PRK09302509 circadian clock protein KaiC; Reviewed 99.66
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 99.61
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.59
PRK09519 790 recA DNA recombination protein RecA; Reviewed 99.59
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 99.59
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.58
PF00154322 RecA: recA bacterial DNA recombination protein; In 99.57
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 99.56
TIGR027601960 TraI_TIGR conjugative transfer relaxase protein Tr 99.54
PRK07078 759 hypothetical protein; Validated 99.53
COG4643366 Uncharacterized protein conserved in bacteria [Fun 99.47
PF1315596 Toprim_2: Toprim-like 99.39
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.39
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 99.35
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 99.32
KOG1564351 consensus DNA repair protein RHP57 [Replication, r 99.3
cd0336479 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The top 99.27
KOG1434335 consensus Meiotic recombination protein Dmc1 [Cell 99.24
PF1336296 Toprim_3: Toprim domain 99.23
PF1366281 Toprim_4: Toprim domain; PDB: 1EQN_E 1DD9_A 3B39_B 99.06
cd0102979 TOPRIM_primases TOPRIM_primases: The topoisomerase 99.02
PF0180797 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin 98.98
smart0040055 ZnF_CHCC zinc finger. 98.78
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 98.77
smart0049376 TOPRIM topoisomerases, DnaG-type primases, OLD fam 98.58
PF12965130 DUF3854: Domain of unknown function (DUF3854); Int 98.56
PRK04031408 DNA primase; Provisional 98.56
cd0102781 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The to 98.54
PRK04296190 thymidine kinase; Provisional 98.43
PF08275128 Toprim_N: DNA primase catalytic core, N-terminal d 98.26
KOG1433326 consensus DNA repair protein RAD51/RHP55 [Replicat 98.17
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 98.15
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.07
KOG2859293 consensus DNA repair protein, member of the recA/R 97.97
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.94
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.92
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 97.91
PF13479213 AAA_24: AAA domain 97.9
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.9
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.89
COG4619223 ABC-type uncharacterized transport system, ATPase 97.89
cd03115173 SRP The signal recognition particle (SRP) mediates 97.84
smart00382148 AAA ATPases associated with a variety of cellular 97.79
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.76
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.75
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.75
cd0018883 TOPRIM Topoisomerase-primase domain. This is a nuc 97.73
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.72
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.72
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.65
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.63
PRK10867433 signal recognition particle protein; Provisional 97.62
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 97.62
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.61
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 97.61
TIGR00959428 ffh signal recognition particle protein. This mode 97.56
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.54
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.54
PRK14974336 cell division protein FtsY; Provisional 97.53
TIGR00064272 ftsY signal recognition particle-docking protein F 97.52
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.52
PF13173128 AAA_14: AAA domain 97.52
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 97.47
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.43
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.42
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.41
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.39
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.39
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.38
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.38
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.37
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.37
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.37
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.37
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.37
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 97.36
COG1127263 Ttg2A ABC-type transport system involved in resist 97.36
PRK10416318 signal recognition particle-docking protein FtsY; 97.36
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 97.35
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.35
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.34
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.34
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.33
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.32
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.31
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.3
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.3
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.29
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.29
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 97.28
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.28
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.27
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 97.27
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.27
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.26
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.26
PF00004132 AAA: ATPase family associated with various cellula 97.25
COG0410237 LivF ABC-type branched-chain amino acid transport 97.25
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.25
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 97.24
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.24
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.24
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.24
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.23
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.23
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.23
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.22
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.22
PRK11153343 metN DL-methionine transporter ATP-binding subunit 97.22
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.22
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.21
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.21
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.21
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 97.2
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 97.2
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.19
PF05729166 NACHT: NACHT domain 97.19
PRK09473330 oppD oligopeptide transporter ATP-binding componen 97.19
PRK13537306 nodulation ABC transporter NodI; Provisional 97.19
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.18
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.18
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.18
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.18
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.17
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 97.17
COG1123 539 ATPase components of various ABC-type transport sy 97.17
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.17
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.16
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 97.16
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.16
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.16
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.16
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 97.16
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.16
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.15
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.15
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.15
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.14
PRK08181269 transposase; Validated 97.14
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 97.14
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.14
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.14
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.14
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 97.13
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.12
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 97.12
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.11
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.11
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.11
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.1
PRK12377248 putative replication protein; Provisional 97.1
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 97.1
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.09
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.09
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.09
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.09
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.08
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.08
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.07
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.06
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.06
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.05
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.05
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.05
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 97.04
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 97.03
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.03
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.02
PRK13536340 nodulation factor exporter subunit NodI; Provision 97.02
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.02
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 97.01
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.01
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.01
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 96.99
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 96.99
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 96.99
cd03234226 ABCG_White The White subfamily represents ABC tran 96.98
PRK10908222 cell division protein FtsE; Provisional 96.98
PF1324576 AAA_19: Part of AAA domain 96.98
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 96.97
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 96.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 96.97
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.97
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 96.97
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.97
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 96.96
PRK06921266 hypothetical protein; Provisional 96.96
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 96.96
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 96.96
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.96
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 96.96
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 96.95
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 96.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 96.95
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 96.94
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 96.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.94
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 96.93
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 96.93
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.93
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.93
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 96.93
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 96.92
PRK10938 490 putative molybdenum transport ATP-binding protein 96.92
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 96.92
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 96.91
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 96.91
PRK10253265 iron-enterobactin transporter ATP-binding protein; 96.91
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.9
COG4559259 ABC-type hemin transport system, ATPase component 96.9
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.9
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 96.89
PRK09984262 phosphonate/organophosphate ester transporter subu 96.88
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 96.87
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 96.86
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 96.86
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 96.86
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.85
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.85
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.85
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 96.84
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 96.84
PRK11607377 potG putrescine transporter ATP-binding subunit; P 96.83
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.83
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 96.83
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 96.83
cd03246173 ABCC_Protease_Secretion This family represents the 96.82
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.82
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 96.82
PRK08727233 hypothetical protein; Validated 96.81
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 96.81
cd03114148 ArgK-like The function of this protein family is u 96.81
PRK08116268 hypothetical protein; Validated 96.81
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.8
PRK10261 623 glutathione transporter ATP-binding protein; Provi 96.8
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 96.8
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.79
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 96.78
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 96.78
PRK13768253 GTPase; Provisional 96.78
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 96.78
PRK102631355 DNA translocase FtsK; Provisional 96.77
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.77
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.77
COG1123539 ATPase components of various ABC-type transport sy 96.76
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 96.76
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.75
PRK03695248 vitamin B12-transporter ATPase; Provisional 96.75
PF01751100 Toprim: Toprim domain; InterPro: IPR006171 This is 96.74
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.74
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 96.73
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 96.73
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 96.73
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 96.72
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.72
PRK13409590 putative ATPase RIL; Provisional 96.71
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 96.71
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 96.7
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 96.69
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.68
PLN03211 659 ABC transporter G-25; Provisional 96.68
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 96.66
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 96.66
PTZ00293211 thymidine kinase; Provisional 96.65
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 96.65
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 96.65
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 96.64
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.63
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.62
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.61
COG1658127 Small primase-like proteins (Toprim domain) [DNA r 96.6
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 96.6
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 96.6
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 96.59
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.59
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 96.59
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 96.59
COG4586325 ABC-type uncharacterized transport system, ATPase 96.58
COG3842352 PotA ABC-type spermidine/putrescine transport syst 96.58
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 96.57
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 96.56
COG0411250 LivG ABC-type branched-chain amino acid transport 96.56
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.56
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 96.55
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 96.55
PRK14235267 phosphate transporter ATP-binding protein; Provisi 96.55
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 96.55
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.54
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 96.54
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 96.53
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.52
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 96.52
PRK06835329 DNA replication protein DnaC; Validated 96.51
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 96.51
PRK10522547 multidrug transporter membrane component/ATP-bindi 96.51
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.51
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.51
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 96.51
PRK14237267 phosphate transporter ATP-binding protein; Provisi 96.51
PRK10261623 glutathione transporter ATP-binding protein; Provi 96.5
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 96.5
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 96.49
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.49
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 96.48
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 96.48
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 96.48
PLN03140 1470 ABC transporter G family member; Provisional 96.47
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 96.47
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 96.47
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 96.46
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 96.45
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 96.45
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.44
PRK00889175 adenylylsulfate kinase; Provisional 96.44
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 96.44
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 96.42
PRK14242253 phosphate transporter ATP-binding protein; Provisi 96.42
PRK12608380 transcription termination factor Rho; Provisional 96.42
PRK09376416 rho transcription termination factor Rho; Provisio 96.41
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.41
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 96.4
COG4987573 CydC ABC-type transport system involved in cytochr 96.4
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 96.4
PRK09435332 membrane ATPase/protein kinase; Provisional 96.4
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 96.4
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.39
PRK14240250 phosphate transporter ATP-binding protein; Provisi 96.39
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.39
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.38
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 96.38
PRK09183259 transposase/IS protein; Provisional 96.37
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 96.37
PRK07773886 replicative DNA helicase; Validated 96.36
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 96.36
PRK04017132 hypothetical protein; Provisional 96.36
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.36
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 96.36
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 96.35
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 96.35
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 96.34
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.34
PRK08939306 primosomal protein DnaI; Reviewed 96.34
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 96.34
PRK14236272 phosphate transporter ATP-binding protein; Provisi 96.33
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.32
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.3
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 96.3
TIGR00767415 rho transcription termination factor Rho. Members 96.3
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 96.27
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 96.27
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.27
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 96.26
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 96.26
PRK10636638 putative ABC transporter ATP-binding protein; Prov 96.25
PRK09580248 sufC cysteine desulfurase ATPase component; Review 96.25
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 96.25
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 96.25
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 96.24
cd01128249 rho_factor Transcription termination factor rho is 96.24
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.24
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 96.24
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 96.24
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 96.23
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.23
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 96.23
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 96.23
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 96.21
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 96.21
COG4674249 Uncharacterized ABC-type transport system, ATPase 96.21
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 96.19
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 96.19
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 96.18
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 96.18
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.18
COG1158422 Rho Transcription termination factor [Transcriptio 96.18
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 96.17
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 96.17
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.16
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 96.14
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.13
PRK14243264 phosphate transporter ATP-binding protein; Provisi 96.13
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 96.13
PRK13695174 putative NTPase; Provisional 96.13
PRK09700510 D-allose transporter ATP-binding protein; Provisio 96.13
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.13
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 96.12
PRK15064530 ABC transporter ATP-binding protein; Provisional 96.11
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.11
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 96.11
PRK11288501 araG L-arabinose transporter ATP-binding protein; 96.11
COG4988559 CydD ABC-type transport system involved in cytochr 96.1
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.09
PF09807249 DUF2348: Uncharacterized conserved protein (DUF234 96.09
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 96.09
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 96.09
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 96.08
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 96.08
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 96.07
PRK10762501 D-ribose transporter ATP binding protein; Provisio 96.07
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 96.05
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 96.05
PRK14086617 dnaA chromosomal replication initiation protein; P 96.04
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 96.03
PRK10790592 putative multidrug transporter membrane\ATP-bindin 96.03
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 96.03
PRK14088440 dnaA chromosomal replication initiation protein; P 96.02
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.02
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 96.01
COG4618580 ArpD ABC-type protease/lipase transport system, AT 96.01
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 96.0
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.0
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 95.99
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 95.98
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 95.98
PRK12422445 chromosomal replication initiation protein; Provis 95.98
PRK04841 903 transcriptional regulator MalT; Provisional 95.98
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 95.97
COG4172534 ABC-type uncharacterized transport system, duplica 95.97
PRK09694 878 helicase Cas3; Provisional 95.96
PRK13409 590 putative ATPase RIL; Provisional 95.96
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 95.95
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 95.95
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.94
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 95.94
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 95.94
PRK00149450 dnaA chromosomal replication initiation protein; R 95.94
COG4148352 ModC ABC-type molybdate transport system, ATPase c 95.93
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.93
PRK08084235 DNA replication initiation factor; Provisional 95.92
PRK06696223 uridine kinase; Validated 95.92
PHA00520330 packaging NTPase P4 95.92
PRK07952244 DNA replication protein DnaC; Validated 95.91
PRK12678672 transcription termination factor Rho; Provisional 95.91
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 95.91
PRK07667193 uridine kinase; Provisional 95.91
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 95.9
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2e-41  Score=375.73  Aligned_cols=266  Identities=19%  Similarity=0.237  Sum_probs=226.4

Q ss_pred             cchhhhhhhcccCCCcccccccchhhhhhhc-cCCCcEEEEEccCCCChHHHHHHHHHHHHHhcCCeEEEEECCCCHHHH
Q 005204          433 YFDEIDAYYHRTSGDEFGISTGWRALNELYN-VLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREH  511 (709)
Q Consensus       433 ~~~~ie~~~~~~~~~~~gi~tg~~~LD~ll~-l~~G~L~ii~G~pG~GKT~~a~qla~~~a~~~g~~Vly~SlE~~~~~~  511 (709)
                      +++.+++......+...|++|||+.||++++ |.+|+|++|+|+||+|||+|++++|.++|.++|++|+|||+||+.+++
T Consensus       189 ~~~~i~~~~~~~~~~~~Gi~TG~~~LD~~~~Gl~~G~LiiIaarPgmGKTafalnia~~~a~~~g~~V~~fSlEM~~~ql  268 (471)
T PRK08006        189 TVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTTFAMNLCENAAMLQDKPVLIFSLEMPGEQI  268 (471)
T ss_pred             HHHHHHHHHhcCCCCCCcccCCCHHHHHhhcCCCCCcEEEEEeCCCCCHHHHHHHHHHHHHHhcCCeEEEEeccCCHHHH
Confidence            3444554443334557899999999999998 999999999999999999999999999997669999999999999999


Q ss_pred             HHHHHHHHcCCCccccccCCCCCCCCHHHHHHHHH---HH-hcCcceEEecCCCCCCHHHHHHHHHHHHHhc-CCcEEEE
Q 005204          512 ARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKA---WL-SNTFSLIRCENDSLPSIKWVLDLAKAAVLRH-GVRGLVI  586 (709)
Q Consensus       512 ~~Rl~~~~~g~~~~~i~~g~~~~~l~~e~~~~~~~---~l-~~~~~~i~~~~~~~~~i~~i~~~i~~~~~~~-~~~lIVI  586 (709)
                      +.|+++..++++...++.|    .+++++|.++..   .+ ....+++  ++.+..++++|.+.+++++.++ ++++|||
T Consensus       269 ~~Rlla~~~~v~~~~i~~~----~l~~~e~~~~~~a~~~~~~~~~l~I--~d~~~~t~~~i~~~~r~~~~~~~~~~lvvI  342 (471)
T PRK08006        269 MMRMLASLSRVDQTRIRTG----QLDDEDWARISGTMGILLEKRNMYI--DDSSGLTPTEVRSRARRIFREHGGLSLIMI  342 (471)
T ss_pred             HHHHHHHhcCCCHHHhhcC----CCCHHHHHHHHHHHHHHHhcCCEEE--ECCCCCCHHHHHHHHHHHHHhcCCCCEEEE
Confidence            9999999999999999866    799999987643   34 4444555  2345678999999999988776 6999999


Q ss_pred             ccCcccccCCCCCCCHHHHHHHHHHHHHHHHHHhCcEEEEEec-cCCCCCCCCCCCccccccCchhhhcccceEEEEeeC
Q 005204          587 DPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAH-PRQLHNWVGEPPNLYDISGSAHFINKCDNGIVIHRN  665 (709)
Q Consensus       587 D~~~~l~~~~~~~~~~~~~~~~i~~~Lk~lA~~~~i~Vi~v~h-~rk~~~~~~~~p~l~di~GS~~i~~~AD~vl~l~r~  665 (709)
                      | |++++.......++.++++++++.||.||+++||+||+++| ||..+++.+++|.++|++||++|+|.||+||+|+|+
T Consensus       343 D-YLqli~~~~~~~~r~~ei~~isr~LK~lAkel~ipVi~LsQLnR~~e~r~dkrP~lsDLreSG~IEqdAD~v~~l~R~  421 (471)
T PRK08006        343 D-YLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRD  421 (471)
T ss_pred             c-cHHHccCCCCCCCcHHHHHHHHHHHHHHHHHhCCeEEEEEecCccccccCCCCCchhhhhhcCcccccCCEEEEEecc
Confidence            9 99998644333566778999999999999999999999999 999988888999999999999999999999999998


Q ss_pred             CCCC--CCCCCeEEEEEEeeeCCCcceeeeEEEEEEccccEEEcC
Q 005204          666 RDPE--AGPIDRVQVCVRKVRNKVVGTIGEAFLSYNRVTGEYMDI  708 (709)
Q Consensus       666 ~~~e--~~~~~~~~l~v~K~R~g~~G~~g~~~l~fd~~t~rf~~~  708 (709)
                      +..+  ....+.++|+|.|||+|++|.+   .+.|++.++||.+.
T Consensus       422 ~~y~~~~~~~g~~elivaKnR~G~~G~v---~l~f~~~~~~f~~~  463 (471)
T PRK08006        422 EVYHENSDLKGIAEIIIGKQRNGPIGTV---RLTFNGQWSRFDNY  463 (471)
T ss_pred             cccccccCCCCceEEEEecccCCCCceE---EEEEccCcccccCC
Confidence            7332  2234679999999999888775   79999999999875

>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR01391 dnaG DNA primase, catalytic core Back     alignment and domain information
>PRK05667 dnaG DNA primase; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PHA02540 61 DNA primase; Provisional Back     alignment and domain information
>COG0358 DnaG DNA primase (bacterial type) [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02415 DNA primase domain-containing protein Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>TIGR00646 MG010 DNA primase-related protein Back     alignment and domain information
>PRK08624 hypothetical protein; Provisional Back     alignment and domain information
>PHA02031 putative DnaG-like primase Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK07078 hypothetical protein; Validated Back     alignment and domain information
>COG4643 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13155 Toprim_2: Toprim-like Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1564 consensus DNA repair protein RHP57 [Replication, recombination and repair] Back     alignment and domain information
>cd03364 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG Back     alignment and domain information
>KOG1434 consensus Meiotic recombination protein Dmc1 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13362 Toprim_3: Toprim domain Back     alignment and domain information
>PF13662 Toprim_4: Toprim domain; PDB: 1EQN_E 1DD9_A 3B39_B 1DDE_A Back     alignment and domain information
>cd01029 TOPRIM_primases TOPRIM_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of bacterial DnaG-type primases and their homologs Back     alignment and domain information
>PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00400 ZnF_CHCC zinc finger Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>smart00493 TOPRIM topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins Back     alignment and domain information
>PF12965 DUF3854: Domain of unknown function (DUF3854); InterPro: IPR024385 This is a family of uncharacterised proteins, found by clustering human gut metagenomic sequences [] Back     alignment and domain information
>PRK04031 DNA primase; Provisional Back     alignment and domain information
>cd01027 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain found in Ribonuclease M5: (RNase M5) and other small primase-like proteins from bacteria and archaea Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF08275 Toprim_N: DNA primase catalytic core, N-terminal domain; InterPro: IPR013264 This is the N-terminal, catalytic core domain of DNA primases Back     alignment and domain information
>KOG1433 consensus DNA repair protein RAD51/RHP55 [Replication, recombination and repair] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG2859 consensus DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd00188 TOPRIM Topoisomerase-primase domain Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PF01751 Toprim: Toprim domain; InterPro: IPR006171 This is a conserved region from DNA primase Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1658 Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04017 hypothetical protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09807 DUF2348: Uncharacterized conserved protein (DUF2348); InterPro: IPR018627 Members of this family of putative uncharacterised proteins have no known function Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PHA00520 packaging NTPase P4 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query709
1q57_A503 The Crystal Structure Of The Bifunctional Primase-h 6e-11
1e0j_A289 Gp4d Helicase From Phage T7 Adpnp Complex Length = 5e-06
1cr0_A296 Crystal Structure Of The Helicase Domain Of The Gen 6e-06
>pdb|1Q57|A Chain A, The Crystal Structure Of The Bifunctional Primase-helicase Of Bacteriophage T7 Length = 503 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 113/474 (23%), Positives = 181/474 (38%), Gaps = 75/474 (15%)
Query: 258 RNGKLVNCKYRDFNKKFWQEKD-TEKVFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLNC 316
           +NG +V+ K RD +K F           +G     G   I++ EGE+D L++ E      
Sbjct: 51  QNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKY 110
Query: 317 VSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELAX 376
             V  G  +S +KK   +  +            Y  Q  +IIL  D D  G+   EE A 
Sbjct: 111 PVVSLGHGASAAKKTCAANYE------------YFDQFEQIILMFDMDEAGRKAVEEAAQ 158
Query: 377 XXXXXXXXXXXXPKKNDVDHFKDANEVLMYLGPGALKEVVENAELY---PIMGLFNFRDY 433
                       P        KDANE  +      + E V NA  +    ++   + R+ 
Sbjct: 159 VLPAGKVRVAVLP-------CKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRER 211
Query: 434 FDEIDAYYHRTSGDEFGIS-TGWRALNE-LYNVLPGELTIVTGVPNSGKSEWIDALICNI 491
             E     H +S +  G+  +G   +N+       GE+ +VT       S ++       
Sbjct: 212 IRE-----HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQW 266
Query: 492 NEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVE--EFEQGKAWLS 549
               G K  L  +E  V E A  L+  H +    +++   S +R  +E  +F+Q   W  
Sbjct: 267 GTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSD---SLKREIIENGKFDQ---WFD 320
Query: 550 NTF---------SLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPV-- 598
             F         S    E D L        LAK A +R G+   VI     LDH   V  
Sbjct: 321 ELFGNDTFHLYDSFAEAETDRL--------LAKLAYMRSGLGCDVI----ILDHISIVVS 368
Query: 599 ---SQTETEYVSQMLTMVKRFAQHHACHVWFVAHPR-----QLHNWVGEPPNLYDISGSA 650
                 E + +  ++T +K FA+     +  + H +     + H   G P ++ D+ GS 
Sbjct: 369 ASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHE-EGRPVSITDLRGSG 427
Query: 651 HFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEA-FLSYNRVTG 703
                 D  I + RN+  +   +    V VR ++ +  G  G A ++ YN+ TG
Sbjct: 428 ALRQLSDTIIALERNQQGDMPNL----VLVRILKCRFTGDTGIAGYMEYNKETG 477
>pdb|1E0J|A Chain A, Gp4d Helicase From Phage T7 Adpnp Complex Length = 289 Back     alignment and structure
>pdb|1CR0|A Chain A, Crystal Structure Of The Helicase Domain Of The Gene4 Protein Of Bacteriophage T7 Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query709
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 1e-100
1nui_A255 DNA primase/helicase; zinc-biding domain, toprim f 4e-25
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 5e-08
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
4edg_A329 DNA primase; catalytic domain, nucleoside triphosp 2e-06
2au3_A407 DNA primase; zinc ribbon, toprim, RNA polymerase, 6e-06
1dd9_A338 DNA primase, DNAG; toprim, 3-helix bundle, DNA-bin 2e-05
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 3e-04
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Length = 503 Back     alignment and structure
 Score =  317 bits (813), Expect = e-100
 Identities = 98/494 (19%), Positives = 181/494 (36%), Gaps = 38/494 (7%)

Query: 224 AYFAERLISAETLRRNRV-MQKRHGHEVVIAFPYWRNGKLVNCKYRDFNKKFWQEKDTEK 282
           +    R IS ET ++    + K  G    +A    +NG +V+ K RD +K F      + 
Sbjct: 16  SALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKS 75

Query: 283 -VFYGLDDIEGESDIIIVEGEMDKLSMEEAGFLN--CVSVPDGAPSSVSKKNVPSEEQDT 339
              +G     G   I++ EGE+D L++ E        VS+  GA +              
Sbjct: 76  DALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASA-------------- 121

Query: 340 KYQYLWNCKMYLKQASRIILATDGDPPGQALAEELARRVGRERCWRVRWPKKNDVDHFKD 399
             +       Y  Q  +IIL  D D  G+   EE A+ +   +      P        KD
Sbjct: 122 AKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLP-------CKD 174

Query: 400 ANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGISTGWRALN 459
           ANE  +      + E V NA  +   G+ +     + I  +          + +G   +N
Sbjct: 175 ANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSE-ESVGLLFSGCTGIN 233

Query: 460 ELYNVL-PGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEK 518
           +       GE+ +VT       S ++           G K  L  +E  V E A  L+  
Sbjct: 234 DKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGL 293

Query: 519 HIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLR 578
           H +    +++     E +   +F+Q    L    +    ++ +      +L         
Sbjct: 294 HNRVRLRQSDS-LKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSG 352

Query: 579 HGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAHPR----QLH 634
            G   +++D +  +         E + +  ++T +K FA+     +  + H +       
Sbjct: 353 LGCDVIILD-HISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKA 411

Query: 635 NWVGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVRNKVVGTIGEA 694
           +  G P ++ D+ GS       D  I + RN+  +   +  V++    ++ +  G  G A
Sbjct: 412 HEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRI----LKCRFTGDTGIA 467

Query: 695 -FLSYNRVTGEYMD 707
            ++ YN+ TG    
Sbjct: 468 GYMEYNKETGWLEP 481
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Length = 255 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Length = 296 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4edg_A DNA primase; catalytic domain, nucleoside triphosphate, nucleoside polyph protein-ligand complex, transferase; HET: DNA ATP; 2.00A {Staphylococcus aureus} PDB: 4edk_A* 4edr_A* 4edt_A* 4edv_A* 4ee1_A* Length = 329 Back     alignment and structure
>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transf; HET: DNA; 2.00A {Aquifex aeolicus} Length = 407 Back     alignment and structure
>1dd9_A DNA primase, DNAG; toprim, 3-helix bundle, DNA-binding protein, RNA polymerase, replication protein, transferase; HET: DNA; 1.60A {Escherichia coli} SCOP: e.13.1.1 PDB: 1dde_A* 1eqn_A* 3b39_A* Length = 338 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query709
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 100.0
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 100.0
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 100.0
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 100.0
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 100.0
2au3_A407 DNA primase; zinc ribbon, toprim, RNA polymerase, 100.0
2r6a_A454 DNAB helicase, replicative helicase; replication, 100.0
1nui_A255 DNA primase/helicase; zinc-biding domain, toprim f 99.97
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.96
4edg_A329 DNA primase; catalytic domain, nucleoside triphosp 99.93
1dd9_A338 DNA primase, DNAG; toprim, 3-helix bundle, DNA-bin 99.93
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 99.92
1xp8_A366 RECA protein, recombinase A; recombination, radior 99.85
2z43_A324 DNA repair and recombination protein RADA; archaea 99.85
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 99.84
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.84
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 99.84
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.83
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.82
1u94_A356 RECA protein, recombinase A; homologous recombinat 99.81
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.81
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.8
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.8
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 99.79
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.78
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.78
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.77
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.75
3io5_A333 Recombination and repair protein; storage dimer, i 99.7
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.65
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.63
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.59
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.52
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.52
3bs4_A260 Uncharacterized protein PH0321; structural genomic 99.43
1d0q_A103 DNA primase; zinc-binding motif, protein, transfer 99.14
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 99.02
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.82
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 98.61
1t6t_1118 Putative protein; structural genomics, PSI, protei 98.55
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.75
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.63
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.6
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.59
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.55
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.51
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.49
2fcj_A119 Small toprim domain protein; structural genomics, 97.44
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.31
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.3
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.29
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.24
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.22
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.22
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.19
1g6h_A257 High-affinity branched-chain amino acid transport 97.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.14
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.13
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.11
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.05
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.03
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 97.02
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.01
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.01
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 96.98
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.97
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.96
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 96.96
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.96
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.94
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.93
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.93
1b0u_A262 Histidine permease; ABC transporter, transport pro 96.93
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.88
2og2_A359 Putative signal recognition particle receptor; nuc 96.87
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.86
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.86
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 96.85
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.83
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 96.82
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.82
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 96.81
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.81
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.81
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.79
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.78
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.77
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.75
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.75
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.73
2xxa_A433 Signal recognition particle protein; protein trans 96.72
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.71
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.7
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.58
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.58
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.58
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.55
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 96.51
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.49
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 96.42
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 96.41
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.4
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.39
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.39
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.37
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.33
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.32
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.3
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 96.3
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.29
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.23
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.17
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.13
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.09
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.06
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.05
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 96.0
3bos_A242 Putative DNA replication factor; P-loop containing 95.99
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.98
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 95.98
3ice_A422 Transcription termination factor RHO; transcriptio 95.95
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 95.95
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.9
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.89
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 95.88
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.86
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 95.8
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.77
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.74
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.73
3igf_A 374 ALL4481 protein; two-domained protein consisting o 95.69
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 95.66
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 95.57
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.55
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.53
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.52
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.47
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.47
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.46
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.43
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.42
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.41
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.41
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.37
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.35
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 95.29
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.29
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.27
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 95.22
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.18
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 95.17
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 95.14
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.11
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.08
3l0o_A427 Transcription termination factor RHO; helicase, RH 95.05
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.05
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.05
3end_A307 Light-independent protochlorophyllide reductase ir 95.04
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.03
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 95.01
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.98
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.98
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 94.95
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 94.93
2qgz_A308 Helicase loader, putative primosome component; str 94.93
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 94.92
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.92
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.86
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 94.85
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.85
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.84
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 94.82
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.78
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 94.77
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 94.76
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 94.75
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 94.72
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.72
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 94.7
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 94.67
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 94.65
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 94.65
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.64
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 94.63
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.63
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.62
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 94.61
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.61
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.59
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.59
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 94.59
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.58
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.56
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.5
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 94.49
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 94.49
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 94.48
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.45
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.45
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.45
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 94.3
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 94.28
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 94.24
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.22
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.2
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.2
3fwy_A314 Light-independent protochlorophyllide reductase I 94.18
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.16
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.15
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 94.14
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 94.12
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.12
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.12
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 94.11
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 94.09
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 94.08
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.08
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 94.07
1tue_A212 Replication protein E1; helicase, replication, E1E 94.06
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 94.05
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.99
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.98
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 93.9
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.89
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.87
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.85
3cwq_A209 Para family chromosome partitioning protein; alpha 93.83
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 93.83
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.78
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.77
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 93.77
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.76
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.68
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.65
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.59
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 93.56
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 93.53
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 93.5
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.49
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 93.46
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 93.41
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.4
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 93.37
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.37
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.37
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.36
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.35
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.34
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.33
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 93.29
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.29
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 93.21
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.2
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.19
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.19
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.18
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.18
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.15
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.11
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.06
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.06
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.04
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.04
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 93.0
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 93.0
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.84
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 92.8
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.8
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.7
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 92.7
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.67
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.65
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.65
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 92.64
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.62
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 92.57
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.56
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 92.54
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.51
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.5
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.5
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 92.44
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.44
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.39
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.37
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 92.37
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.33
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 92.32
2ghi_A260 Transport protein; multidrug resistance protein, M 92.3
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 92.22
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 92.19
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.19
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.11
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.1
3kta_A182 Chromosome segregation protein SMC; structural mai 92.08
3b6e_A216 Interferon-induced helicase C domain-containing P; 92.04
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 91.99
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.97
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 91.93
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 91.93
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 91.87
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.85
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.83
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 91.82
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 91.81
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 91.8
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 91.79
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.77
2vli_A183 Antibiotic resistance protein; transferase, tunica 91.74
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.74
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.73
1p9r_A418 General secretion pathway protein E; bacterial typ 91.71
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.7
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 91.7
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.54
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 91.46
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.43
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.4
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.39
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.37
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 91.29
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.27
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 91.25
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 91.16
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 91.14
2fna_A357 Conserved hypothetical protein; structural genomic 91.14
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 91.09
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.06
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.04
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 90.98
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 90.91
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.82
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 90.81
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 90.8
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 90.78
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.75
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 90.62
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 90.62
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 90.61
1via_A175 Shikimate kinase; structural genomics, transferase 90.61
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 90.54
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.54
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 90.49
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 90.41
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 90.39
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 90.3
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 90.29
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 90.23
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 90.23
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 90.21
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 90.21
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 90.2
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 90.17
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 90.16
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 90.14
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 90.04
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 90.0
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 89.98
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 89.94
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.93
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.88
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 89.88
3tlx_A243 Adenylate kinase 2; structural genomics, structura 89.83
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 89.82
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 89.78
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 89.61
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 89.55
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.51
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 89.5
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.42
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.37
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.36
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.34
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.33
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.25
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.21
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.21
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.21
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 89.18
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 89.17
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 89.14
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 89.13
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 89.13
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 89.09
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.07
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 89.06
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 89.04
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 89.03
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 88.98
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.91
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 88.87
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 88.75
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 88.75
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 88.67
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 88.58
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 88.56
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 88.39
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 88.33
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 88.32
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 88.24
3r20_A233 Cytidylate kinase; structural genomics, seattle st 88.23
2oap_1511 GSPE-2, type II secretion system protein; hexameri 88.19
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.16
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 88.12
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 88.01
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 87.94
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 87.94
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 87.92
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 87.92
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 87.91
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 87.88
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 87.88
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.86
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 87.85
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 87.84
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 87.84
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 87.82
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 87.8
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 87.78
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.68
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 87.62
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 87.59
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 87.54
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 87.43
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 87.43
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 87.33
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 87.18
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.17
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 87.17
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 87.12
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 87.05
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 87.01
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 87.0
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 86.98
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 86.97
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.86
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 86.71
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 86.69
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 86.68
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 86.63
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 86.53
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 86.27
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 86.27
2hf9_A226 Probable hydrogenase nickel incorporation protein 86.24
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 85.96
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 85.87
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 85.8
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 85.67
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 85.58
3pvs_A 447 Replication-associated recombination protein A; ma 85.47
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 85.41
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 85.36
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 85.29
4a8j_A361 Elongator complex protein 4; transcription; 2.10A 85.22
3bor_A237 Human initiation factor 4A-II; translation initiat 85.17
2r62_A268 Cell division protease FTSH homolog; ATPase domain 85.1
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 85.01
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 84.94
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 84.93
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.89
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 84.85
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 84.85
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 84.78
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.53
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 84.52
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 84.52
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 84.51
3co5_A143 Putative two-component system transcriptional RES 84.45
2wji_A165 Ferrous iron transport protein B homolog; membrane 84.41
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 84.36
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 84.23
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 84.23
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 84.2
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 84.1
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 84.01
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 83.97
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 83.97
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 83.8
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 83.76
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 83.75
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 83.71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 83.59
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 83.29
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 83.07
1vdd_A228 Recombination protein RECR; helix-hairpin-helix, z 82.98
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 82.96
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 82.96
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 82.92
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 82.83
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 82.82
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 82.74
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 82.68
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 82.67
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 82.64
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 82.64
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 82.63
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 82.57
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 82.56
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 82.56
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
Probab=100.00  E-value=2.4e-62  Score=555.26  Aligned_cols=453  Identities=23%  Similarity=0.248  Sum_probs=369.2

Q ss_pred             HHHHHHHhCCCCHHHHHHccccccCCCCeeEEEEeEe-cCCEEEEEEeecCCCcccc-cCCCCCccccccccCCCCeEEE
Q 005204          221 ELRAYFAERLISAETLRRNRVMQKRHGHEVVIAFPYW-RNGKLVNCKYRDFNKKFWQ-EKDTEKVFYGLDDIEGESDIII  298 (709)
Q Consensus       221 ~~~~YL~~RGI~~~~~~~~~~~~~~~g~~~~i~fP~~-~~G~lv~~~~R~~~kk~~~-~~~~~~~lyg~~~i~~~~~viI  298 (709)
                      .+.+||.+|||+.+++++|+++........+++||+. .+|+++++++|..+++++. ..++...+||++.+.+.+.|+|
T Consensus        13 ~~~~YL~~Rgi~~~~~~~~~~~~~~~~g~~~i~fp~~d~~G~~~g~~~R~~~~~~ky~~~~k~~~lyg~~~~~~~~~v~i   92 (503)
T 1q57_A           13 GRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVV   92 (503)
T ss_dssp             CBCCCBTTTTBCHHHHHHHTEEECCBTTBCEEEEEEECTTSCEEEEEEEETTTEEEEEECCCTTCEETGGGCSSEEEEEE
T ss_pred             HHHHHHHHCCCCHHHHHHcCeEEECCCCcEEEEEEEECCCCCEEEEEeECCCCCceEecCCCCCceECccccCCCCEEEE
Confidence            3678999999999999999987554333467999997 8899999999987654443 1235678999998877778999


Q ss_pred             EcChhhHHHHHHh-CCc-eEEEcCCCCCCCCCCCCCCchhhhhhHHHHHhHhhhhcCcCEEEEEecCChhhHHHHHHHHH
Q 005204          299 VEGEMDKLSMEEA-GFL-NCVSVPDGAPSSVSKKNVPSEEQDTKYQYLWNCKMYLKQASRIILATDGDPPGQALAEELAR  376 (709)
Q Consensus       299 ~EG~~DaLsl~q~-g~~-~~val~~G~~~~~~~~~L~~~~~~~~~~~l~~~~~~L~~~~~Ivi~~DnD~aG~~aa~~~a~  376 (709)
                      |||++|+||++|+ |.. ++++++++...         .     .+.+.+++++|.++++|++|+|||.||++|++++++
T Consensus        93 ~EG~~D~ls~~~~~g~~~~v~slg~~~~~---------~-----~~~l~~~l~~l~~~~~ivl~~D~D~aG~~aa~~~~~  158 (503)
T 1q57_A           93 TEGEIDMLTVMELQDCKYPVVSLGHGASA---------A-----KKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQ  158 (503)
T ss_dssp             ESSHHHHHHHTTTTTTCSCEEEESSTTTT---------H-----HHHHHTTHHHHHTEEEEEEECCSSHHHHHHHHHHHH
T ss_pred             ECCHHHHHHHHHhcCCCcEEEECCcccch---------h-----HHHHHHHHHhhcCCCEEEEEeCCCHHHHHHHHHHHH
Confidence            9999999999999 753 46665433321         0     123445567788889999999999999999999999


Q ss_pred             HhCCcceEEEEcCCCCCCCCCCCHHHHHHhcCCCccceeeeccccccccccccccccchhhhhhhcccCCCcccccc-cc
Q 005204          377 RVGRERCWRVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYPIMGLFNFRDYFDEIDAYYHRTSGDEFGIST-GW  455 (709)
Q Consensus       377 ~l~~~~~~iv~~P~~~~~~~~kD~ND~l~~~g~e~l~~~l~~A~~~~~~~l~~~~d~~~~ie~~~~~~~~~~~gi~t-g~  455 (709)
                      .|...+|+++.+|       +|||||+|++.|.+++.+++++|.++.+.++.++.++++++++.+.  .....|++| ||
T Consensus       159 ~l~~~~~~~~~~p-------~kD~nd~l~~~g~~~~~~~i~~a~~~~~~~i~~~~~~~~~i~~~~~--~~~~~~i~t~G~  229 (503)
T 1q57_A          159 VLPAGKVRVAVLP-------CKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLS--SEESVGLLFSGC  229 (503)
T ss_dssp             HSCGGGEEECCCS-------SSSHHHHHTTSCHHHHHHHHTTCCCCCCSSEEEGGGGHHHHHHHHH--HSCTTCSCCSSC
T ss_pred             hcccCcEEEEeCC-------CCCHHHHHHhcCHHHHHHHHHhcCCCCHHHhcChHHHHHHHHhhhc--ccccCCccccch
Confidence            9976678777653       7999999999999999999999999999999999999999888763  356789999 99


Q ss_pred             hhhhhhhc-cCCCcEEEEEccCCCChHHHHHHHHHHHHHhcCCeEEEEECCCCHHHHHHHHHHHHcCCCccc---cccCC
Q 005204          456 RALNELYN-VLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHARKLLEKHIKKPFFE---ANYGG  531 (709)
Q Consensus       456 ~~LD~ll~-l~~G~L~ii~G~pG~GKT~~a~qla~~~a~~~g~~Vly~SlE~~~~~~~~Rl~~~~~g~~~~~---i~~g~  531 (709)
                      +.||++++ +++|++++|+|+||+|||+|++|++.+++.++|.+|+|||+||+++++..|+++...++++..   ++.| 
T Consensus       230 ~~LD~~lgGl~~G~l~li~G~pG~GKT~lal~~a~~~a~~~g~~vl~~s~E~s~~~l~~r~~~~~~~~~~~~~~~~~~g-  308 (503)
T 1q57_A          230 TGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKRE-  308 (503)
T ss_dssp             TTHHHHHCCCCTTCEEEEEESSCHHHHHHHHHHHHHHTTTSCCCEEEEESSSCHHHHHHHHHHHHTTSCCTTCHHHHHH-
T ss_pred             hhhhHhhcccCCCeEEEEeecCCCCchHHHHHHHHHHHHhcCCcEEEEeccCCHHHHHHHHHHHHcCCChhhccccccC-
Confidence            99999999 999999999999999999999999999998668999999999999999999999999998764   4433 


Q ss_pred             CCCCCCHHHHHHHHHHH-hc-CcceEEecCCCCCCHHHHHHHHHHHHHhcCCcEEEEccCcccccCCCCCCCHHHHHHHH
Q 005204          532 SAERMTVEEFEQGKAWL-SN-TFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQM  609 (709)
Q Consensus       532 ~~~~l~~e~~~~~~~~l-~~-~~~~i~~~~~~~~~i~~i~~~i~~~~~~~~~~lIVID~~~~l~~~~~~~~~~~~~~~~i  609 (709)
                         .++++++.++.+.+ .. ++++.  +..+..++++++..+++++.++++++||||++..+ .......++.+.+.++
T Consensus       309 ---~l~~~~~~~~~~~~~~~~~l~i~--~~~~~~~~~~i~~~i~~~~~~~~~~lvVID~l~~l-~~~~~~~~~~~~~~~~  382 (503)
T 1q57_A          309 ---IIENGKFDQWFDELFGNDTFHLY--DSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIV-VSASGESDERKMIDNL  382 (503)
T ss_dssp             ---HHHTSHHHHHHHHHHTTTCEEEE--CCC---CHHHHHHHHHHHHHTTCCSEEEEECTTCC-CSCCSCCCHHHHHHHH
T ss_pred             ---CCCHHHHHHHHHHHhccCCEEEE--CCCCCCCHHHHHHHHHHHHHhcCCCEEEEccchhc-CCCCCCCCHHHHHHHH
Confidence               45556676666555 23 33333  21234689999999999999999999999966544 3322335777889999


Q ss_pred             HHHHHHHHHHhCcEEEEEec-cCCCCCC----CCCCCccccccCchhhhcccceEEEEeeCCCCCCCCCCeEEEEEEeee
Q 005204          610 LTMVKRFAQHHACHVWFVAH-PRQLHNW----VGEPPNLYDISGSAHFINKCDNGIVIHRNRDPEAGPIDRVQVCVRKVR  684 (709)
Q Consensus       610 ~~~Lk~lA~~~~i~Vi~v~h-~rk~~~~----~~~~p~l~di~GS~~i~~~AD~vl~l~r~~~~e~~~~~~~~l~v~K~R  684 (709)
                      ++.|+.+|+++||+||+++| +| .+.+    .+++|.+++++||+.+++.||+||+|++++..+  ..+.++|.|.|+|
T Consensus       383 ~~~Lk~lak~~~i~vi~~~q~~r-~~~~~~~~~~~~p~l~dlr~s~~ie~~aD~vi~l~r~~~~~--~~~~~~l~v~K~R  459 (503)
T 1q57_A          383 MTKLKGFAKSTGVVLVVICHLKN-PDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGD--MPNLVLVRILKCR  459 (503)
T ss_dssp             HHHHHHHHHHHTCEEEEEEECCC-CSSSSCSTTCCCCCSSSCSSSSHHHHHCSEEEEEEECSSSS--CTTEEEEEEEEET
T ss_pred             HHHHHHHHHHHCCeEEEEEcCCc-hhccCccccCCCCChhhhccchHhhecCcEEEEEEeCCcCC--CCCeEEEEEEecc
Confidence            99999999999999999999 66 4332    267899999999999999999999999987533  1357899999999


Q ss_pred             -CCCcceeeeEEEEEEccccEEEcC
Q 005204          685 -NKVVGTIGEAFLSYNRVTGEYMDI  708 (709)
Q Consensus       685 -~g~~G~~g~~~l~fd~~t~rf~~~  708 (709)
                       +|++|..  +.+.|+++++||.++
T Consensus       460 ~~G~~g~~--~~l~f~~~~~~f~~~  482 (503)
T 1q57_A          460 FTGDTGIA--GYMEYNKETGWLEPS  482 (503)
T ss_dssp             TTCCCEEE--EEEEECTTTCCEEEE
T ss_pred             CCCCCCce--EEEEEEcCCceEecC
Confidence             7877664  379999999999886
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transf; HET: DNA; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4edg_A DNA primase; catalytic domain, nucleoside triphosphate, nucleoside polyph protein-ligand complex, transferase; HET: DNA ATP; 2.00A {Staphylococcus aureus} PDB: 4e2k_A* 4edk_A* 4edr_A* 4edt_A* 4edv_A* 4ee1_A* Back     alignment and structure
>1dd9_A DNA primase, DNAG; toprim, 3-helix bundle, DNA-binding protein, RNA polymerase, replication protein, transferase; HET: DNA; 1.60A {Escherichia coli} SCOP: e.13.1.1 PDB: 1dde_A* 1eqn_A* 3b39_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1t6t_1 Putative protein; structural genomics, PSI, protein structur initiative, midwest center for structural genomics, MCSG, U function; 1.80A {Aquifex aeolicus} SCOP: c.136.1.1 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2fcj_A Small toprim domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MES; 1.30A {Geobacillus stearothermophilus} SCOP: c.136.1.1 PDB: 2i5r_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 709
d1cr2a_277 c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), 4e-25
d1nuia1192 e.13.1.2 (A:64-255) Primase fragment of primase-he 8e-21
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 3e-14
d2fcja1114 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 6e-14
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 6e-09
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 4e-08
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 1e-07
d1t6t1_108 c.136.1.1 (1:) Hypothetical protein aq_2086 {Aquif 2e-07
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 2e-06
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 3e-05
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 6e-05
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

 Score =  103 bits (257), Expect = 4e-25
 Identities = 51/279 (18%), Positives = 98/279 (35%), Gaps = 13/279 (4%)

Query: 435 DEIDAYYHRTSGDEFGISTGWRALNE-LYNVLPGELTIVTGVPNSGKSEWIDALICNINE 493
           + I  +   +      + +G   +N+       GE+ +VT     GKS ++         
Sbjct: 3   ERIREHL-SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGT 61

Query: 494 HAGWKFVLCSMENKVREHARKLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFS 553
             G K  L  +E  V E A  L+  H +    +++     E +   +F+Q    L    +
Sbjct: 62  AMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDS-LKREIIENGKFDQWFDELFGNDT 120

Query: 554 LIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPVSQTETEYVSQMLTMV 613
               ++ +      +L          G   +++D  + +      S       + M T +
Sbjct: 121 FHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLM-TKL 179

Query: 614 KRFAQHHACHVWFVAHPRQLHNWVG----EPPNLYDISGSAHFINKCDNGIVIHRNRDPE 669
           K FA+     +  + H +            P ++ D+ GS       D  I + RN+  +
Sbjct: 180 KGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGD 239

Query: 670 AGPIDRVQVCVRKVRNKVVGTIGEAF-LSYNRVTGEYMD 707
                   V VR ++ +  G  G A  + YN+ TG    
Sbjct: 240 ----MPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEP 274
>d1nuia1 e.13.1.2 (A:64-255) Primase fragment of primase-helicase protein {Bacteriophage T7 [TaxId: 10760]} Length = 192 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d2fcja1 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]} Length = 114 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1t6t1_ c.136.1.1 (1:) Hypothetical protein aq_2086 {Aquifex aeolicus [TaxId: 63363]} Length = 108 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query709
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 100.0
d1nuia1192 Primase fragment of primase-helicase protein {Bact 99.93
d1dd9a_314 DNA primase DnaG catalytic core {Escherichia coli 99.92
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 99.88
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 99.85
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 99.84
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 99.8
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 99.77
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 99.76
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 99.72
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 99.68
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 99.65
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 99.62
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 99.62
d2fcja1114 Hypothetical protein RBSTP2199 {Bacillus stearothe 99.42
d1t6t1_108 Hypothetical protein aq_2086 {Aquifex aeolicus [Ta 99.39
d1d0qa_102 Zinc-binding domain of DNA primase {Bacillus stear 99.01
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.08
d1okkd2207 GTPase domain of the signal recognition particle r 98.07
d2qy9a2211 GTPase domain of the signal recognition particle r 97.97
d1vmaa2213 GTPase domain of the signal recognition particle r 97.86
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.85
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.8
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.72
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.71
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.7
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.65
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.56
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.49
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.46
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.45
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.38
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.35
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.33
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.24
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.14
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.1
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.09
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.02
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.96
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.94
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.87
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.81
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.49
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.35
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.34
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.33
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.26
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.26
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.24
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.21
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.15
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.14
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.99
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.88
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.8
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.73
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.71
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.61
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.6
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.59
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.45
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.31
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 95.27
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.19
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.15
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.09
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.08
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.08
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.04
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.98
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.93
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.91
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 94.87
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.79
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.78
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.64
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.56
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.56
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.51
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.39
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.37
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 94.37
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.27
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.27
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.19
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 94.17
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.15
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.08
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.04
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.83
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.82
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.75
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.69
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.68
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.67
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.63
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.57
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.55
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.36
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.32
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.31
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.29
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.25
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.21
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.21
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.08
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.99
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.85
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 92.81
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.77
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.61
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.52
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.33
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.33
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.32
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.26
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.08
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.94
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.89
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 91.89
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.63
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.61
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 91.55
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.51
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.41
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.4
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.37
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 91.18
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.98
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.84
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.63
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 90.49
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 90.4
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.14
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.03
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.89
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.8
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.69
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 89.22
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.21
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.06
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.04
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.9
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.78
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 88.55
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 88.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.11
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 87.55
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.42
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 87.13
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.04
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.95
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.89
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.78
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 86.58
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 86.54
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.47
d1nuia254 Zinc-binding domain of primase-helicase {Bacteriop 86.35
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.0
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 85.71
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.53
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 85.5
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 85.35
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 85.31
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 85.14
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 84.91
d1nrjb_209 Signal recognition particle receptor beta-subunit 84.83
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.35
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 84.26
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 84.2
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 84.11
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 84.04
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 83.94
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.89
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.86
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 83.83
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 83.74
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.74
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.6
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.46
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 83.2
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 83.19
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 83.15
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.1
d2fh5b1207 Signal recognition particle receptor beta-subunit 83.07
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 83.05
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 82.98
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 82.98
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.84
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.62
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 82.61
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.58
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.49
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 82.35
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 82.08
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 82.03
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.01
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 82.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 81.74
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 81.71
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 81.66
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 81.63
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 81.45
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.44
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 81.44
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 81.38
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.34
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 81.18
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 81.17
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 81.12
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.12
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.08
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 81.07
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.98
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.78
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 80.69
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.14
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 80.04
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.03
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=100.00  E-value=4e-37  Score=318.95  Aligned_cols=267  Identities=19%  Similarity=0.196  Sum_probs=187.4

Q ss_pred             hhhhhhhcccCCCcccccccchhhhhhhc-cCCCcEEEEEccCCCChHHHHHHHHHHHHHhcCCeEEEEECCCCHHHHHH
Q 005204          435 DEIDAYYHRTSGDEFGISTGWRALNELYN-VLPGELTIVTGVPNSGKSEWIDALICNINEHAGWKFVLCSMENKVREHAR  513 (709)
Q Consensus       435 ~~ie~~~~~~~~~~~gi~tg~~~LD~ll~-l~~G~L~ii~G~pG~GKT~~a~qla~~~a~~~g~~Vly~SlE~~~~~~~~  513 (709)
                      +++++.+.+ +....+++|||+.||++++ +++|++++|+|+||+|||+|++|++.++|.++|.+|+|+|+||++.++..
T Consensus         3 e~~~~~~~~-~~~~~~i~TG~~~lD~~~~G~~~G~l~vi~G~~G~GKT~~~~~la~~~a~~~g~~v~~~s~E~~~~~~~~   81 (277)
T d1cr2a_           3 ERIREHLSS-EESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAE   81 (277)
T ss_dssp             HHHHHHHTS-CCCSCBCCCSCTTHHHHHCSBCTTCEEEEECSTTSSHHHHHHHHHHHHHHTSCCCEEEEESSSCHHHHHH
T ss_pred             HHHHHHHhC-CCCccccCCCchhHHHHhcCCCCCeEEEEEeCCCCCHHHHHHHHHHhhhhhcccceeEeeeccchhhHHh
Confidence            455555554 4666899999999999998 99999999999999999999999999998877999999999999999999


Q ss_pred             HHHHHHcCCCccccccCCCCCCCCHHHHHHHHHHHhcCcceEEecCCCCCCHHHHHHHHHHHHHhcCCcEEEEccCcccc
Q 005204          514 KLLEKHIKKPFFEANYGGSAERMTVEEFEQGKAWLSNTFSLIRCENDSLPSIKWVLDLAKAAVLRHGVRGLVIDPYNELD  593 (709)
Q Consensus       514 Rl~~~~~g~~~~~i~~g~~~~~l~~e~~~~~~~~l~~~~~~i~~~~~~~~~i~~i~~~i~~~~~~~~~~lIVID~~~~l~  593 (709)
                      |+++..++++........ ...++.+++.++.+.+.....+.........+.+++...++..+..+++++||||++. ++
T Consensus        82 r~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvID~l~-~l  159 (277)
T d1cr2a_          82 DLIGLHNRVRLRQSDSLK-REIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHIS-IV  159 (277)
T ss_dssp             HHHHHHTTCCGGGCHHHH-HHHHHTSHHHHHHHHHHSSSCEEEECCC-CCCHHHHHHHHHHHHHTTCCSEEEEEEEE-C-
T ss_pred             HHHHHhhcCCchhhcccc-cchhhhHHHHHHHHHhhccceeeeeccccchhHHHHHHHhhhhhhccCcceEEEcccc-cc
Confidence            999999999876543210 0001112334444444433222223445567788999999998899999999999654 44


Q ss_pred             cCCCCCCCHHHHHHHHHHHHHHHHHHhCcEEEEEec-cCCCCCC---CCCCCccccccCchhhhcccceEEEEeeCCCCC
Q 005204          594 HQRPVSQTETEYVSQMLTMVKRFAQHHACHVWFVAH-PRQLHNW---VGEPPNLYDISGSAHFINKCDNGIVIHRNRDPE  669 (709)
Q Consensus       594 ~~~~~~~~~~~~~~~i~~~Lk~lA~~~~i~Vi~v~h-~rk~~~~---~~~~p~l~di~GS~~i~~~AD~vl~l~r~~~~e  669 (709)
                      .......+.++.+.+++..|+.+|+++||+||+++| +|...++   .+.+|.+++++||+.|++.||.||.|+|+++.+
T Consensus       160 ~~~~~~~~~~~~~~~~~~~l~~lA~~~~i~vi~~~q~~r~~~~~~~~~~~~~~~~~~~gS~~i~~~ad~vl~l~r~~~~~  239 (277)
T d1cr2a_         160 VSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGD  239 (277)
T ss_dssp             ---------CHHHHHHHHHHHHHHHHHCCEEEEEEECC---------------------CHHHHHHCSEEEEEECC----
T ss_pred             cccccccchhHHHHHHHHHHHHHhhhccccceeecccccccccccccccccchhhhcccccchhhhCcEEEEEEecCccC
Confidence            332223344567889999999999999999999999 6654433   345789999999999999999999999977544


Q ss_pred             CCCCCeEEEEEEeeeC-CCcceeeeEEEEEEccccEEEcC
Q 005204          670 AGPIDRVQVCVRKVRN-KVVGTIGEAFLSYNRVTGEYMDI  708 (709)
Q Consensus       670 ~~~~~~~~l~v~K~R~-g~~G~~g~~~l~fd~~t~rf~~~  708 (709)
                      .  .+...|.|.|+|+ |.+|..  ..+.||++||||.+.
T Consensus       240 ~--~~~~~l~v~KnR~~G~~G~~--~~l~~d~~tgr~~~~  275 (277)
T d1cr2a_         240 M--PNLVLVRILKCRFTGDTGIA--GYMEYNKETGWLEPS  275 (277)
T ss_dssp             ----CEEEEEEEEETTTCCCEEE--EEEEECTTTCCEEEC
T ss_pred             C--CCeEEEEEEccCCCCCCCCE--EEEEEeCCCCeEcCC
Confidence            2  4678999999995 555554  379999999999985
>d1nuia1 e.13.1.2 (A:64-255) Primase fragment of primase-helicase protein {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1dd9a_ e.13.1.1 (A:) DNA primase DnaG catalytic core {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcja1 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t6t1_ c.136.1.1 (1:) Hypothetical protein aq_2086 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure