Citrus Sinensis ID: 005240

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700------

MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA

cccccccEEEEccccccccccEEEEccccccccccEEEcccccEEEEEEEEccccccccccEEEEEEEcccccEEccccccccccccccccEEEEccccEEEEEEcccccccccccccccccEEEEccccccccccHHHHHcccHHHHHHHHHcccEEEEEEccccccEEcccccEEEEccccccccEEEEEEcccccEEEEccccccEEEEEEEccccEEEEEccccccccccccccccccccccEEEcccccccEEEEEEEccccccccccccccEEEcccccccccccEEEEEcccEEEEEEEccccEEEEEEEEcccccEEEEEEEccccccccEEEEcccccccccccccccEEEcccccEEEEEEEEccccEEEEEEEcccccccccccEEEEEEcccccEEEEEEccccccccEEEEEccccccEEEcccccEEEEEEEccccccEEEEEEcccccEEEccccccccccccccccEEEEEEcccccEEEEEEEccccccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccc

cccccccEEEEEcccccccccEEEccccccccccccEEcccccEEEEEEEEccccccccccEEEEEEEccccccEEccccccEEEEcccccEEEcccccEEEEEEcccccccccccccccccEEEEcccccccccccHHHHcccHHHHHHHHHHHHccEEEEEccccEEEcccccEEEcccccccccEEEEEEEccccEEEEEccccccEEEEEEccccEEEEEcccccHcccccccccccccccccccccccccEEEEEEEccccccccccccHHHEHHccccccccccccEEEEcccccccEEEccccEEEEEEEccccccEEEEEEcccccccccEEEEEcccccccccccccEEEEcccccEEEEEEEccccccEEEEEEcccccccccccEEEEEEcccccEEEEEEcccccccccEEEEccccccccccccccEEEEEEccccccccEEEEEcccccccEEcccccccHHHcccccEEEEEEcccccEEEEEEEccccccccccccccEEEEEcccccccHHHccccccccccccccccccHHHHHHccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcHHHHHHHHHHHcccHHHHHHEEccccccccccccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccc

mpfftgigihrllpddslgpekevhgypdgakinfvswspdgkriafsvrvdeednvssckLRVWIADaetgeakplfespdiclnaVFGSFvwvnnstlliftipssrrdppkktmvplgpkiqsneqKNIIISRMTdnllkdeydesLFDYYTTAQLVLGsldgtakdfgtpavytavepspdqkYVLITSmhrpysykvpcarfsqKVQVWTTDGKLVRelcdlppaedipvcynSVREGMRsiswradkpstlYWVEAQdrgdanvevsprdiiytqpaepaegekpeilhkldlrfrsvswcddSLALVNETWYKtsqtrtwlvcpgskdvaprvLFDRVFenvysdpgspmmtrtstgTNVIAKIKKENDEQIYILLNgrgftpegnipfldlfdintgskerIWESNREKYFETAVALVFGqgeedinlNQLKILTSKESKTEITQYHILswplkkssqitnfphpyptlASLQKEMIKYQrkdgvpltatlylppgydqskdgplpclfwaypedykskdaagqvrgspnefsgmtptsSLIFLARRFAvlagpsipiigegdklpndrFVEQLVSSAEAAVEEVVRrgvadpsriavgghsygAFMTAHLLahaphlfccgiarsgsynktltpfgfQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYClsntsdgkcga

MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFsvrvdeednvsscKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIftipssrrdppkktmvplgpkiqsneqkniIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAvytavepspdQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRelcdlppaedipVCYNSVREGMRsiswradkpstLYWVEAQDrgdanvevspRDIIytqpaepaegekpeILHKLDLRFRSVSWCDDSLALVNETWyktsqtrtwlvcpgskdVAPRVLFDRVFENvysdpgspmmtrtsTGTNVIAKIKKENDEQIYILLNGrgftpegniPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLsntsdgkcga

MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFveqlvssaeaaveevvrrgvaDPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA

***FTGIGIHRLLP*********VHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTI*************************NIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIY*************ILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYS*************TNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDY***********************SLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLS*********

*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIP*************************IIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKY************

*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLS*********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		706	2.2.26 [Sep-21-2011]
Q8VZF3		960	Probable glutamyl endopep	yes	no	0.990	0.728	0.675	0.0
Q10MJ1		938	Probable glutamyl endopep	yes	no	0.988	0.744	0.671	0.0
Q12884		760	Seprase OS=Homo sapiens G	yes	no	0.186	0.173	0.290	4e-06
P97321		761	Seprase OS=Mus musculus G	yes	no	0.189	0.176	0.263	4e-06
P14740		767	Dipeptidyl peptidase 4 OS	no	no	0.199	0.183	0.285	0.0001
P28843		760	Dipeptidyl peptidase 4 OS	no	no	0.199	0.185	0.285	0.0003
P81425		765	Dipeptidyl peptidase 4 OS	no	no	0.182	0.168	0.291	0.0007

>sp\|Q8VZF3\|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2	Back alignment and function desciption

 Score = 1055 bits (2729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/748 (67%), Positives = 595/748 (79%), Gaps = 49/748 (6%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+TG+GIH+LLPD +L PEKE+ G PDG KINFV+WS DGK +AFS+RVDE  N  S 
Sbjct: 174 MSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAFSIRVDENGN--SS 231

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           K  VW+AD ETG A+PLF S DI LNA+F SFVW++NSTLL+ TIPSSR +PPKK +VP 
Sbjct: 232 KPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPS 291

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK  SNE K ++  R   +LLKDEYD  LFDYY ++QLVL SLDGT K+ G PAVYT++
Sbjct: 292 GPKTLSNETKTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSL 351

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PS D KY+L++S+HRPYS+ VPC RF +KV+VWTTDG+ VR+LCDLP AEDIP+  NSV
Sbjct: 352 DPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSV 411

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTL W E QD GDA +EVSPRDI+Y Q AEP  GE+PE+LHKLDLR
Sbjct: 412 RKGMRSINWRADKPSTL-WAETQDGGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLR 470

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDD+LALV E+WYKT +TRTW++ PGS DV+PR+LFDR  E+VYSDPGS M+ R
Sbjct: 471 YGGISWCDDTLALVYESWYKTRRTRTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRR 530

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T  GT VIAKIKKENDE  Y+LLNG G TP+GN+PFLDLFDINTG+KERIWES++EKYFE
Sbjct: 531 TDAGTYVIAKIKKENDEGTYVLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFE 590

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ + +LKILTSKESKTE TQY +  WP +K  QITNFPHPYP LASL
Sbjct: 591 TVVALMSDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL 650

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+YQRKDGV LTATLYLPPGYD SKDGPLPCLFW+YP ++KSKDAAGQVRGSPNEF
Sbjct: 651 QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEF 710

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVAD 600
           +G+  TS+L++LARRFA+L+GP+IPIIGEGD+  NDR+VEQLV+SAEAAVEEVVRRGVAD
Sbjct: 711 AGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRRGVAD 770

Query: 601 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAE----------- 649
            S+IAVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E           
Sbjct: 771 RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY 830

Query: 650 -----------------------------------RFFDALKGHGALSRLVLLPFEHHVY 674
                                              RFF+ALKGHGAL RLV+LP E H Y
Sbjct: 831 VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY 890

Query: 675 AARENVMHVIWETDRWLQKYCLSNTSDG 702
           +ARE++MHV+WETDRWLQKYC+ NTSD 
Sbjct: 891 SARESIMHVLWETDRWLQKYCVPNTSDA 918

Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -

>sp\|Q10MJ1\|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1	Back alignment and function description

>sp\|Q12884\|SEPR_HUMAN Seprase OS=Homo sapiens GN=FAP PE=1 SV=5	Back alignment and function description

>sp\|P97321\|SEPR_MOUSE Seprase OS=Mus musculus GN=Fap PE=2 SV=1	Back alignment and function description

>sp\|P14740\|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2	Back alignment and function description

>sp\|P28843\|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3	Back alignment and function description

>sp\|P81425\|DPP4_BOVIN Dipeptidyl peptidase 4 OS=Bos taurus GN=DPP4 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		706
297743980		913	unnamed protein product [Vitis vinifera]	0.991	0.766	0.704	0.0
359479944		961	PREDICTED: probable glutamyl endopeptida	0.990	0.727	0.702	0.0
224130988		967	predicted protein [Populus trichocarpa]	0.992	0.724	0.696	0.0
224064539		905	predicted protein [Populus trichocarpa]	0.987	0.770	0.691	0.0
449436423		970	PREDICTED: probable glutamyl endopeptida	0.991	0.721	0.689	0.0
449436421		971	PREDICTED: probable glutamyl endopeptida	0.991	0.720	0.689	0.0
357511363		962	Acylamino-acid-releasing enzyme [Medicag	0.992	0.728	0.679	0.0
30690669		961	prolyl oligopeptidase-like protein [Arab	0.991	0.728	0.676	0.0
297828471		962	serine-type peptidase [Arabidopsis lyrat	0.991	0.727	0.675	0.0
332278170		960	RecName: Full=Probable glutamyl endopept	0.990	0.728	0.675	0.0

>gi\|297743980\|emb\|CBI36950.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/747 (70%), Positives = 620/747 (82%), Gaps = 47/747 (6%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+T IGIH+L+PD +LGPEKEVHG+PDGAKINFVSWS +G+ ++FS+RVDEE+N SS 
Sbjct: 109 MSFYTSIGIHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEEN-SSS 167

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           KLR+W+AD ETG+A+PLF+SPDI LNAVF +FVWV++STLL+ TIP SR DPPKK +VP 
Sbjct: 168 KLRIWVADVETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPS 227

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK+QSNEQKN++  R   +LLKDEYD  LFDYY T QLVL SLDGT K+ G PAVYT++
Sbjct: 228 GPKVQSNEQKNVVQVRTFQDLLKDEYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSM 287

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PSPDQKY+LI+S+HRPYS+ VPC RF +KV +WT++GK VRELCDLP AEDIP+ +NSV
Sbjct: 288 DPSPDQKYLLISSIHRPYSFIVPCGRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSV 347

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTLYWVE QD GDA VEVSPRDI+Y QPAEP +GE+  ILHKLDLR
Sbjct: 348 RKGMRSINWRADKPSTLYWVETQDEGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLR 407

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDDSLALV E+WYKT +TRTW++ PGS+DV+PR+LFDR  E+VYSDPGSPM+ R
Sbjct: 408 YGGISWCDDSLALVYESWYKTRRTRTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRR 467

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T+ GT VIAKIKKENDE  YILLNG G TPEGNIPFLDLFDINTGSKERIWES++EKY+E
Sbjct: 468 TTAGTYVIAKIKKENDEGTYILLNGSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYE 527

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ LNQLKILTSKESKTE TQY I SW  KK+ QITNFPHPYP LASL
Sbjct: 528 TVVALMSDQSEGDLYLNQLKILTSKESKTENTQYFIQSWLDKKACQITNFPHPYPQLASL 587

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+Y+RKDGV LTATLYLPPGYD SKDGPLPCL W+YP ++KSKDAAGQVRGSPNEF
Sbjct: 588 QKEMIRYERKDGVQLTATLYLPPGYDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEF 647

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVAD 600
           +G+ PTS+L++LARRFA+L+GP+IPIIGEG++  NDR+VEQLV+SAEAAVEEV+RRGVA 
Sbjct: 648 AGIGPTSALLWLARRFAILSGPTIPIIGEGNEEANDRYVEQLVASAEAAVEEVIRRGVAH 707

Query: 601 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAE----------- 649
           P++IAVGGHSYGAFMTA+LLAHAPHLFCCGIARSG+YN+TLTPFGFQ E           
Sbjct: 708 PNKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTY 767

Query: 650 -----------------------------------RFFDALKGHGALSRLVLLPFEHHVY 674
                                              RFF+ALKGHGAL RLV+LPFE H Y
Sbjct: 768 VEMSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY 827

Query: 675 AARENVMHVIWETDRWLQKYCLSNTSD 701
           AARE++MHV+WETDRWLQK+C+SNT++
Sbjct: 828 AARESIMHVLWETDRWLQKHCVSNTTN 854

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359479944\|ref\|XP_002270510.2\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224130988\|ref\|XP_002320974.1\| predicted protein [Populus trichocarpa] gi\|222861747\|gb\|EEE99289.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224064539\|ref\|XP_002301512.1\| predicted protein [Populus trichocarpa] gi\|222843238\|gb\|EEE80785.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449436423\|ref\|XP_004135992.1\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] gi\|449507837\|ref\|XP_004163143.1\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449436421\|ref\|XP_004135991.1\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] gi\|449507834\|ref\|XP_004163142.1\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357511363\|ref\|XP_003625970.1\| Acylamino-acid-releasing enzyme [Medicago truncatula] gi\|355500985\|gb\|AES82188.1\| Acylamino-acid-releasing enzyme [Medicago truncatula]	Back alignment and taxonomy information

>gi\|30690669\|ref\|NP_850473.1\| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi\|330255741\|gb\|AEC10835.1\| prolyl oligopeptidase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828471\|ref\|XP_002882118.1\| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi\|297327957\|gb\|EFH58377.1\| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|332278170\|sp\|Q8VZF3.2\|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; Flags: Precursor	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		706
UNIPROTKB\|Q8EHB8		801	SO_1310 "Serine peptidase S9 f	0.703	0.620	0.315	1.2e-79
TIGR_CMR\|SO_1310		801	SO_1310 "conserved hypothetica	0.703	0.620	0.315	1.2e-79
TIGR_CMR\|SO_4618		645	SO_4618 "prolyl oligopeptidase	0.215	0.235	0.243	0.00075

UNIPROTKB\|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

 Score = 650 (233.9 bits), Expect = 1.2e-79, Sum P(3) = 1.2e-79
 Identities = 162/514 (31%), Positives = 252/514 (49%)

Query:   136 RMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMH 195
             R   +LLK   D+ LF   TT+QL L  L+G     G P +      SPD +Y+L   + 
Sbjct:   210 RTYQDLLKTSADKQLFSRLTTSQLALVDLEGKLTKIGAPGIIEDFSVSPDGQYILSRQIT 269

Query:   196 RPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPS 255
              P+S +V    F    +++  +G+L+  L      E  P   +SV  G R   W   + +
Sbjct:   270 TPFSTQVKYDDFPTLTEIYNLNGQLITLLHQSQGGESRPQGKDSVLPGPRMFHWVQGQAA 329

Query:   256 TLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVN 315
             TL + +A D+GD+  +   RD ++    +P   ++   + +   R   + W ++ LAL+ 
Sbjct:   330 TLAFTKALDQGDSQRDAPQRDSLWL--LDPPFTQQATRVAQTQWRITDIDWAENHLALIT 387

Query:   316 ETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKEN 375
             E   K  Q R   +     + +   L +R   + Y D G         G   +  ++ + 
Sbjct:   388 ERNSKAQQIRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAKHYYPGKGQVVSLQ-QG 445

Query:   376 DEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDIN 435
              +   ++  G+G TP+G+ PFL    + T     +W+S   +    +V  V       +N
Sbjct:   446 AKTTGLIHYGQGATPQGDKPFLKRTSLITSESSLLWQSASNRL--ESVRYV-------LN 496

Query:   436 LNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPL 495
             L+ L+++ ++ES TE     +L+    K S +   P        +QK++I ++R DGVPL
Sbjct:   497 LDPLQLIINRESPTESPSLVLLN--AAKESVLYEQPDGLSAYLGMQKQLITFKRADGVPL 554

Query:   496 TATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARR 555
             + TLYLP  Y + + G LP L WAYP ++   + AGQ+  S N++  ++P   +  +A  
Sbjct:   555 SGTLYLPANYTKEQ-GTLPVLMWAYPREFNDPEVAGQISFSANQYPTISPRGPIPLVAEG 613

Query:   556 FAVLAGPSIPIIGEGDKLPNDRFXXXXXXXXXXXXXXXXXXXXXDPSRIAVGGHSYGAFM 615
             FAV    S+PII +GDK  ND F                     D  +IAVGGHSYGAFM
Sbjct:   614 FAVFDKVSMPIIAQGDKESNDTFREQLTANAQAAIDTLVDLGIADRKQIAVGGHSYGAFM 673

Query:   616 TAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQAE 649
              A+LLAH   LF  GIARSG+YN++LTPFGFQ E
Sbjct:   674 VANLLAHTD-LFYAGIARSGAYNRSLTPFGFQNE 706

GO:0003674 "molecular_function" evidence=ND

GO:0005575 "cellular_component" evidence=ND

GO:0008150 "biological_process" evidence=ND

TIGR_CMR\|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_4618 SO_4618 "prolyl oligopeptidase family protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q10MJ1	CGEP_ORYSJ	3, ., 4, ., 2, 1, ., -	0.6715	0.9886	0.7441	yes	no
Q8VZF3	CGEP_ARATH	3, ., 4, ., 2, 1, ., -	0.6751	0.9900	0.7281	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00028112001	SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (884 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00015534001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (725 aa)	•	0.422

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		706
COG1506		620	COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin	2e-23
pfam00326		212	pfam00326, Peptidase_S9, Prolyl oligopeptidase fam	4e-10
pfam12697		187	pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam	5e-05
COG0400		207	COG0400, COG0400, Predicted esterase [General func	7e-05
COG4099		387	COG4099, COG4099, Predicted peptidase [General fun	1e-04
COG3509		312	COG3509, LpqC, Poly(3-hydroxybutyrate) depolymeras	0.001
pfam12695		145	pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam	0.002

>gnl\|CDD\|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

 Score =  105 bits (263), Expect = 2e-23
 Identities = 68/321 (21%), Positives = 113/321 (35%), Gaps = 76/321 (23%)

Query: 432 EDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL-QKEMIKYQRK 490
              +++  K+  +  S TE     I  +   + +++T+  +       L + E + Y+  
Sbjct: 316 PGFDVDGRKLALAYSSPTE--PPEIYLYDRGEEAKLTSSNNSGLKKVKLAEPEPVTYKSN 373

Query: 491 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLI 550
           DG  +   LY PPG+D  K  PL  + + +              G P+   G +    + 
Sbjct: 374 DGETIHGWLYKPPGFDPRKKYPL--IVYIH--------------GGPSAQVGYSFNPEIQ 417

Query: 551 FLARR-FAVLAGPSIPIIGEGDK---LPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAV 606
            LA   +AVLA       G G +        +    +    AAV+ +V+  + DP RI +
Sbjct: 418 VLASAGYAVLAPNYRGSTGYGREFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGI 477

Query: 607 GGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGF-------------------- 646
            G SYG +MT       P  F   +A +G  +  L                         
Sbjct: 478 TGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENGGGPPEDRE 536

Query: 647 --------------------------------QAERFFDALKGHGALSRLVLLPFEHHVY 674
                                           QAE+  DALK  G    LV+ P E H +
Sbjct: 537 KYEDRSPIFYADNIKTPLLLIHGEEDDRVPIEQAEQLVDALKRKGKPVELVVFPDEGHGF 596

Query: 675 AARENVMHVIWETDRWLQKYC 695
           +  EN + V+ E   W +++ 
Sbjct: 597 SRPENRVKVLKEILDWFKRHL 617

Length = 620

>gnl\|CDD\|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family	Back alignment and domain information

>gnl\|CDD\|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family	Back alignment and domain information

>gnl\|CDD\|223477 COG0400, COG0400, Predicted esterase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226584 COG4099, COG4099, Predicted peptidase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226040 COG3509, LpqC, Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		706
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	100.0
PRK10115		686	protease 2; Provisional	100.0
KOG2281		867	consensus Dipeptidyl aminopeptidases/acylaminoacyl	100.0
KOG2100		755	consensus Dipeptidyl aminopeptidase [Posttranslati	99.97
COG1770		682	PtrB Protease II [Amino acid transport and metabol	99.93
PRK01029		428	tolB translocation protein TolB; Provisional	99.93
PRK01029		428	tolB translocation protein TolB; Provisional	99.93
PRK03629		429	tolB translocation protein TolB; Provisional	99.92
PRK05137		435	tolB translocation protein TolB; Provisional	99.92
PRK04043		419	tolB translocation protein TolB; Provisional	99.92
PRK05137		435	tolB translocation protein TolB; Provisional	99.92
PRK03629		429	tolB translocation protein TolB; Provisional	99.91
PRK04792		448	tolB translocation protein TolB; Provisional	99.91
PRK04043		419	tolB translocation protein TolB; Provisional	99.9
PRK02889		427	tolB translocation protein TolB; Provisional	99.9
PRK02889		427	tolB translocation protein TolB; Provisional	99.9
PRK04922		433	tolB translocation protein TolB; Provisional	99.9
PRK04792		448	tolB translocation protein TolB; Provisional	99.9
PRK00178		430	tolB translocation protein TolB; Provisional	99.89
PRK04922		433	tolB translocation protein TolB; Provisional	99.89
PRK00178		430	tolB translocation protein TolB; Provisional	99.89
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	99.87
PRK01742		429	tolB translocation protein TolB; Provisional	99.85
KOG2237		712	consensus Predicted serine protease [Posttranslati	99.85
PRK01742		429	tolB translocation protein TolB; Provisional	99.85
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.83
COG4946		668	Uncharacterized protein related to the periplasmic	99.81
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.81
COG1505		648	Serine proteases of the peptidase family S9A [Amin	99.8
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.8
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	99.78
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	99.75
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	99.75
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.73
COG0412		236	Dienelactone hydrolase and related enzymes [Second	99.72
PF01738		218	DLH: Dienelactone hydrolase family; InterPro: IPR0	99.68
PF05448		320	AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0	99.63
TIGR02821		275	fghA_ester_D S-formylglutathione hydrolase. This m	99.63
PRK10162		318	acetyl esterase; Provisional	99.6
PLN02442		283	S-formylglutathione hydrolase	99.6
PRK10566		249	esterase; Provisional	99.59
PRK05077		414	frsA fermentation/respiration switch protein; Revi	99.57
PLN02298		330	hydrolase, alpha/beta fold family protein	99.53
PF12715		390	Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8	99.5
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.49
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.49
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	99.48
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.48
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.47
COG4946		668	Uncharacterized protein related to the periplasmic	99.45
PRK13604		307	luxD acyl transferase; Provisional	99.44
PLN02385		349	hydrolase; alpha/beta fold family protein	99.44
COG0657		312	Aes Esterase/lipase [Lipid metabolism]	99.41
KOG1515		336	consensus Arylacetamide deacetylase [Defense mecha	99.4
COG3458		321	Acetyl esterase (deacetylase) [Secondary metabolit	99.4
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	99.39
PHA02857		276	monoglyceride lipase; Provisional	99.38
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.37
COG4099		387	Predicted peptidase [General function prediction o	99.35
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	99.34
PRK10749		330	lysophospholipase L2; Provisional	99.34
PRK11460		232	putative hydrolase; Provisional	99.34
PRK11028		330	6-phosphogluconolactonase; Provisional	99.34
PRK10439		411	enterobactin/ferric enterobactin esterase; Provisi	99.33
KOG4391		300	consensus Predicted alpha/beta hydrolase BEM46 [Ge	99.3
COG1647		243	Esterase/lipase [General function prediction only]	99.3
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	99.28
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	99.28
PF06500		411	DUF1100: Alpha/beta hydrolase of unknown function	99.27
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.27
PF10503		220	Esterase_phd: Esterase PHB depolymerase	99.27
TIGR00976		550	/NonD putative hydrolase, CocE/NonD family. This m	99.27
KOG3101		283	consensus Esterase D [General function prediction	99.26
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	99.26
PLN00021		313	chlorophyllase	99.25
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.25
PRK05371		767	x-prolyl-dipeptidyl aminopeptidase; Provisional	99.23
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	99.22
COG3509		312	LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda	99.22
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.21
PLN02652		395	hydrolase; alpha/beta fold family protein	99.21
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.21
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.21
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.19
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	99.19
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.18
PRK11028		330	6-phosphogluconolactonase; Provisional	99.18
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.17
COG2945		210	Predicted hydrolase of the alpha/beta superfamily	99.17
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.17
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.16
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.16
PF02129		272	Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam	99.15
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.13
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.12
PRK13616		591	lipoprotein LpqB; Provisional	99.11
KOG0266		456	consensus WD40 repeat-containing protein [General	99.11
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.1
KOG0286		343	consensus G-protein beta subunit [General function	99.1
PF02230		216	Abhydrolase_2: Phospholipase/Carboxylesterase; Int	99.09
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.06
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.05
PF00756		251	Esterase: Putative esterase; InterPro: IPR000801 T	99.04
COG2382		299	Fes Enterochelin esterase and related enzymes [Ino	99.04
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.03
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.03
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	99.03
PLN02872		395	triacylglycerol lipase	99.03
cd00312		493	Esterase_lipase Esterases and lipases (includes fu	99.02
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.02
KOG2055		514	consensus WD40 repeat protein [General function pr	99.02
PF08840		213	BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term	99.02
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	98.99
KOG0279		315	consensus G protein beta subunit-like protein [Sig	98.99
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.98
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.97
KOG0973		942	consensus Histone transcription regulator HIRA, WD	98.97
PF12740		259	Chlorophyllase2: Chlorophyllase enzyme; InterPro:	98.97
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	98.95
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.95
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	98.95
COG0400		207	Predicted esterase [General function prediction on	98.93
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	98.92
COG2272		491	PnbA Carboxylesterase type B [Lipid metabolism]	98.89
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	98.89
KOG2314		698	consensus Translation initiation factor 3, subunit	98.89
KOG1552		258	consensus Predicted alpha/beta hydrolase [General	98.88
KOG2096		420	consensus WD40 repeat protein [General function pr	98.86
KOG1407		313	consensus WD40 repeat protein [Function unknown]	98.84
KOG2055		514	consensus WD40 repeat protein [General function pr	98.82
PF03403		379	PAF-AH_p_II: Platelet-activating factor acetylhydr	98.82
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	98.82
PRK10673		255	acyl-CoA esterase; Provisional	98.81
PF00135		535	COesterase: Carboxylesterase family The prints ent	98.81
KOG0973		942	consensus Histone transcription regulator HIRA, WD	98.81
COG2936		563	Predicted acyl esterases [General function predict	98.8
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	98.8
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.78
PRK10115		686	protease 2; Provisional	98.78
KOG3043		242	consensus Predicted hydrolase related to dienelact	98.77
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	98.77
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	98.77
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	98.75
KOG0266		456	consensus WD40 repeat-containing protein [General	98.74
KOG0263		707	consensus Transcription initiation factor TFIID, s	98.72
KOG0645		312	consensus WD40 repeat protein [General function pr	98.72
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	98.71
PLN02824		294	hydrolase, alpha/beta fold family protein	98.7
PRK10985		324	putative hydrolase; Provisional	98.69
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	98.69
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.67
PTZ00421		493	coronin; Provisional	98.65
KOG0263		707	consensus Transcription initiation factor TFIID, s	98.64
KOG0286		343	consensus G-protein beta subunit [General function	98.64
COG2819		264	Predicted hydrolase of the alpha/beta superfamily	98.61
PF07224		307	Chlorophyllase: Chlorophyllase; InterPro: IPR01082	98.61
KOG4178		322	consensus Soluble epoxide hydrolase [Lipid transpo	98.61
KOG0296		399	consensus Angio-associated migratory cell protein	98.6
PLN02511		388	hydrolase	98.58
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	98.58
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	98.58
PLN00181		793	protein SPA1-RELATED; Provisional	98.58
KOG0772		641	consensus Uncharacterized conserved protein, conta	98.57
PRK13616		591	lipoprotein LpqB; Provisional	98.56
PTZ00421		493	coronin; Provisional	98.56
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	98.54
KOG3847		399	consensus Phospholipase A2 (platelet-activating fa	98.54
KOG2314		698	consensus Translation initiation factor 3, subunit	98.52
COG0627		316	Predicted esterase [General function prediction on	98.5
PLN02679		360	hydrolase, alpha/beta fold family protein	98.5
PTZ00420		568	coronin; Provisional	98.47
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	98.47
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	98.47
PRK00870		302	haloalkane dehalogenase; Provisional	98.46
PTZ00420		568	coronin; Provisional	98.45
KOG4409		365	consensus Predicted hydrolase/acyltransferase (alp	98.44
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.42
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	98.41
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	98.4
KOG2139		445	consensus WD40 repeat protein [General function pr	98.39
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	98.39
KOG0275		508	consensus Conserved WD40 repeat-containing protein	98.39
COG4188		365	Predicted dienelactone hydrolase [General function	98.38
PF08538		303	DUF1749: Protein of unknown function (DUF1749); In	98.38
KOG2315		566	consensus Predicted translation initiation factor	98.37
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	98.35
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	98.34
KOG0282		503	consensus mRNA splicing factor [Function unknown]	98.33
KOG0284		464	consensus Polyadenylation factor I complex, subuni	98.32
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.31
PLN00181		793	protein SPA1-RELATED; Provisional	98.3
KOG2315		566	consensus Predicted translation initiation factor	98.29
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	98.28
PRK11071		190	esterase YqiA; Provisional	98.27
KOG1273		405	consensus WD40 repeat protein [General function pr	98.26
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	98.25
PLN02965		255	Probable pheophorbidase	98.24
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	98.24
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	98.23
PLN02211		273	methyl indole-3-acetate methyltransferase	98.23
PLN02894		402	hydrolase, alpha/beta fold family protein	98.23
KOG2096		420	consensus WD40 repeat protein [General function pr	98.23
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.23
KOG1274		933	consensus WD40 repeat protein [General function pr	98.22
KOG0643		327	consensus Translation initiation factor 3, subunit	98.2
KOG1274		933	consensus WD40 repeat protein [General function pr	98.2
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	98.2
PRK10349		256	carboxylesterase BioH; Provisional	98.18
KOG0639		705	consensus Transducin-like enhancer of split protei	98.18
KOG0772		641	consensus Uncharacterized conserved protein, conta	98.17
KOG4627		270	consensus Kynurenine formamidase [Amino acid trans	98.17
KOG0284		464	consensus Polyadenylation factor I complex, subuni	98.16
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	98.15
KOG0645		312	consensus WD40 repeat protein [General function pr	98.14
KOG0296		399	consensus Angio-associated migratory cell protein	98.13
PF03583		290	LIP: Secretory lipase ; InterPro: IPR005152 This e	98.13
KOG0639		705	consensus Transducin-like enhancer of split protei	98.13
PRK03592		295	haloalkane dehalogenase; Provisional	98.12
PRK06489		360	hypothetical protein; Provisional	98.12
COG0429		345	Predicted hydrolase of the alpha/beta-hydrolase fo	98.1
KOG1273		405	consensus WD40 repeat protein [General function pr	98.09
KOG2139		445	consensus WD40 repeat protein [General function pr	98.08
PLN02578		354	hydrolase	98.07
KOG2564		343	consensus Predicted acetyltransferases and hydrola	98.06
PRK08775		343	homoserine O-acetyltransferase; Provisional	98.05
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.04
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	98.03
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.02
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	98.01
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.01
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	98.0
KOG0282		503	consensus mRNA splicing factor [Function unknown]	98.0
PRK03204		286	haloalkane dehalogenase; Provisional	98.0
KOG0640		430	consensus mRNA cleavage stimulating factor complex	97.99
KOG2624		403	consensus Triglyceride lipase-cholesterol esterase	97.99
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	97.97
KOG1838		409	consensus Alpha/beta hydrolase [General function p	97.95
PF09752		348	DUF2048: Uncharacterized conserved protein (DUF204	97.94
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	97.94
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	97.94
KOG0275		508	consensus Conserved WD40 repeat-containing protein	97.94
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	97.93
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	97.93
TIGR02171		912	Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou	97.93
COG1770		682	PtrB Protease II [Amino acid transport and metabol	97.91
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	97.91
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	97.91
KOG1454		326	consensus Predicted hydrolase/acyltransferase (alp	97.91
KOG0283		712	consensus WD40 repeat-containing protein [Function	97.91
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	97.9
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	97.89
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.88
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	97.87
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	97.87
PRK07581		339	hypothetical protein; Validated	97.87
KOG1516		545	consensus Carboxylesterase and related proteins [G	97.83
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	97.83
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	97.81
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.81
KOG1553		517	consensus Predicted alpha/beta hydrolase BAT5 [Gen	97.75
KOG0310		487	consensus Conserved WD40 repeat-containing protein	97.74
KOG0278		334	consensus Serine/threonine kinase receptor-associa	97.74
PF05728		187	UPF0227: Uncharacterised protein family (UPF0227);	97.74
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	97.7
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	97.7
TIGR02171		912	Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou	97.68
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	97.67
KOG0771		398	consensus Prolactin regulatory element-binding pro	97.65
PF06342		297	DUF1057: Alpha/beta hydrolase of unknown function	97.65
PF05577		434	Peptidase_S28: Serine carboxypeptidase S28; InterP	97.64
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	97.64
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	97.62
PF10340		374	DUF2424: Protein of unknown function (DUF2424); In	97.62
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	97.6
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	97.59
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	97.59
PRK05855		582	short chain dehydrogenase; Validated	97.57
KOG4667		269	consensus Predicted esterase [Lipid transport and	97.56
KOG0643		327	consensus Translation initiation factor 3, subunit	97.55
KOG2048		691	consensus WD40 repeat protein [General function pr	97.55
TIGR03502		792	lipase_Pla1_cef extracellular lipase, Pla-1/cef fa	97.54
KOG2106		626	consensus Uncharacterized conserved protein, conta	97.47
PF05677		365	DUF818: Chlamydia CHLPS protein (DUF818); InterPro	97.44
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	97.4
KOG0640		430	consensus mRNA cleavage stimulating factor complex	97.39
KOG0288		459	consensus WD40 repeat protein TipD [General functi	97.39
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.38
KOG0295		406	consensus WD40 repeat-containing protein [Function	97.36
KOG2112		206	consensus Lysophospholipase [Lipid transport and m	97.34
KOG2110		391	consensus Uncharacterized conserved protein, conta	97.33
PRK02888		635	nitrous-oxide reductase; Validated	97.32
KOG1539		910	consensus WD repeat protein [General function pred	97.32
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	97.3
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.29
KOG0288		459	consensus WD40 repeat protein TipD [General functi	97.27
PF12146		79	Hydrolase_4: Putative lysophospholipase; InterPro:	97.27
PRK07868		994	acyl-CoA synthetase; Validated	97.26
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	97.26
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	97.25
KOG2382		315	consensus Predicted alpha/beta hydrolase [General	97.24
KOG4389		601	consensus Acetylcholinesterase/Butyrylcholinestera	97.24
KOG0283		712	consensus WD40 repeat-containing protein [Function	97.17
KOG0771		398	consensus Prolactin regulatory element-binding pro	97.16
KOG0289		506	consensus mRNA splicing factor [General function p	97.14
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	97.14
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	97.12
COG3391		381	Uncharacterized conserved protein [Function unknow	97.11
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	97.09
KOG0303		472	consensus Actin-binding protein Coronin, contains	97.03
PRK02888		635	nitrous-oxide reductase; Validated	97.01
KOG0316		307	consensus Conserved WD40 repeat-containing protein	97.0
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	96.98
KOG1063		764	consensus RNA polymerase II elongator complex, sub	96.98
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	96.97
COG3571		213	Predicted hydrolase of the alpha/beta-hydrolase fo	96.97
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	96.97
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	96.96
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	96.95
KOG2110		391	consensus Uncharacterized conserved protein, conta	96.9
PTZ00472		462	serine carboxypeptidase (CBP1); Provisional	96.87
KOG0295		406	consensus WD40 repeat-containing protein [Function	96.84
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	96.84
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	96.79
KOG2048		691	consensus WD40 repeat protein [General function pr	96.79
PF10230		266	DUF2305: Uncharacterised conserved protein (DUF230	96.79
KOG1539		910	consensus WD repeat protein [General function pred	96.76
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	96.75
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	96.73
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	96.7
PRK06765		389	homoserine O-acetyltransferase; Provisional	96.7
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	96.69
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	96.67
COG4947		227	Uncharacterized protein conserved in bacteria [Fun	96.65
KOG0278		334	consensus Serine/threonine kinase receptor-associa	96.64
KOG0289		506	consensus mRNA splicing factor [General function p	96.63
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	96.61
COG2021		368	MET2 Homoserine acetyltransferase [Amino acid tran	96.6
COG3391		381	Uncharacterized conserved protein [Function unknow	96.57
KOG2984		277	consensus Predicted hydrolase [General function pr	96.56
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	96.55
COG4757		281	Predicted alpha/beta hydrolase [General function p	96.52
KOG0290		364	consensus Conserved WD40 repeat-containing protein	96.48
PF06057		192	VirJ: Bacterial virulence protein (VirJ); InterPro	96.46
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	96.44
PF02273		294	Acyl_transf_2: Acyl transferase; InterPro: IPR0031	96.41
PF11144		403	DUF2920: Protein of unknown function (DUF2920); In	96.38
KOG2182		514	consensus Hydrolytic enzymes of the alpha/beta hyd	96.37
KOG2106		626	consensus Uncharacterized conserved protein, conta	96.33
KOG0641		350	consensus WD40 repeat protein [General function pr	96.28
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	96.28
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	96.25
PF01674		219	Lipase_2: Lipase (class 2); InterPro: IPR002918 Li	96.22
KOG2183		492	consensus Prolylcarboxypeptidase (angiotensinase C	96.2
PF07082		250	DUF1350: Protein of unknown function (DUF1350); In	96.2
PRK04940		180	hypothetical protein; Provisional	96.19
KOG0302		440	consensus Ribosome Assembly protein [General funct	96.16
KOG0269		839	consensus WD40 repeat-containing protein [Function	96.12
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	96.08
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	96.07
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	96.07
KOG0641		350	consensus WD40 repeat protein [General function pr	96.02
PRK13614		573	lipoprotein LpqB; Provisional	96.02
KOG0303		472	consensus Actin-binding protein Coronin, contains	96.01
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	96.0
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	96.0
KOG0316		307	consensus Conserved WD40 repeat-containing protein	95.99
KOG2321		703	consensus WD40 repeat protein [General function pr	95.97
KOG4283		397	consensus Transcription-coupled repair protein CSA	95.96
KOG0647		347	consensus mRNA export protein (contains WD40 repea	95.96
KOG0647		347	consensus mRNA export protein (contains WD40 repea	95.95
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	95.94
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	95.89
KOG0294		362	consensus WD40 repeat-containing protein [Function	95.88
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	95.86
KOG4328		498	consensus WD40 protein [Function unknown]	95.8
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	95.75
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	95.74
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	95.74
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	95.72
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	95.7
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	95.69
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	95.65
KOG0310		487	consensus Conserved WD40 repeat-containing protein	95.64
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	95.64
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	95.61
COG3150		191	Predicted esterase [General function prediction on	95.6
PF12048		310	DUF3530: Protein of unknown function (DUF3530); In	95.58
PF06821		171	Ser_hydrolase: Serine hydrolase; InterPro: IPR0106	95.5
PRK13613		599	lipoprotein LpqB; Provisional	95.5
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	95.45
KOG1063		764	consensus RNA polymerase II elongator complex, sub	95.45
KOG0294		362	consensus WD40 repeat-containing protein [Function	95.41
KOG4840		299	consensus Predicted hydrolases or acyltransferases	95.4
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	95.36
PF07519		474	Tannase: Tannase and feruloyl esterase; InterPro:	95.35
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	95.24
PRK13615		557	lipoprotein LpqB; Provisional	95.19
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	95.18
TIGR03712		511	acc_sec_asp2 accessory Sec system protein Asp2. Th	95.12
KOG3967		297	consensus Uncharacterized conserved protein [Funct	95.1
COG4782		377	Uncharacterized protein conserved in bacteria [Fun	95.07
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	94.97
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	94.82
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	94.79
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	94.75
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	94.71
PF10142		367	PhoPQ_related: PhoPQ-activated pathogenicity-relat	94.56
KOG0308		735	consensus Conserved WD40 repeat-containing protein	94.53
KOG4283		397	consensus Transcription-coupled repair protein CSA	94.34
PF00450		415	Peptidase_S10: Serine carboxypeptidase; InterPro:	94.29
KOG0302		440	consensus Ribosome Assembly protein [General funct	94.28
KOG2111		346	consensus Uncharacterized conserved protein, conta	94.22
KOG4328		498	consensus WD40 protein [Function unknown]	94.17
PF11339		581	DUF3141: Protein of unknown function (DUF3141); In	94.11
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	94.01
KOG0269		839	consensus WD40 repeat-containing protein [Function	93.98
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	93.98
KOG1520		376	consensus Predicted alkaloid synthase/Surface muci	93.93
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	93.89
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	93.87
KOG1214		1289	consensus Nidogen and related basement membrane pr	93.76
KOG2565		469	consensus Predicted hydrolases or acyltransferases	93.59
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	93.59
PRK13614		573	lipoprotein LpqB; Provisional	93.48
KOG2321		703	consensus WD40 repeat protein [General function pr	93.45
KOG3253		784	consensus Predicted alpha/beta hydrolase [General	93.39
KOG2041		1189	consensus WD40 repeat protein [General function pr	93.35
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	93.17
COG3243		445	PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me	93.15
KOG2551		230	consensus Phospholipase/carboxyhydrolase [Amino ac	93.12
KOG0646		476	consensus WD40 repeat protein [General function pr	93.08
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	92.92
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	92.8
KOG0646		476	consensus WD40 repeat protein [General function pr	92.7
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	92.69
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	92.61
KOG1963		792	consensus WD40 repeat protein [General function pr	92.46
KOG0270		463	consensus WD40 repeat-containing protein [Function	92.41
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	92.11
COG1073		299	Hydrolases of the alpha/beta superfamily [General	92.1
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	92.04
KOG0308		735	consensus Conserved WD40 repeat-containing protein	91.59
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	91.59
KOG0290		364	consensus Conserved WD40 repeat-containing protein	91.54
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	91.51
KOG4388		880	consensus Hormone-sensitive lipase HSL [Lipid tran	91.44
COG3319		257	Thioesterase domains of type I polyketide synthase	91.41
PLN02209		437	serine carboxypeptidase	91.39
PRK13615		557	lipoprotein LpqB; Provisional	91.18
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	91.11
PF03022		287	MRJP: Major royal jelly protein; InterPro: IPR0035	91.07
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	90.89
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	90.31
KOG2111		346	consensus Uncharacterized conserved protein, conta	90.3
KOG2100		755	consensus Dipeptidyl aminopeptidase [Posttranslati	90.16
KOG1963		792	consensus WD40 repeat protein [General function pr	90.03
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	89.95
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	89.9
COG4257		353	Vgb Streptogramin lyase [Defense mechanisms]	89.7
KOG3621		726	consensus WD40 repeat-containing protein [General	89.62
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	89.37
PLN02454		414	triacylglycerol lipase	89.31
PLN03016		433	sinapoylglucose-malate O-sinapoyltransferase	89.1
COG2319		466	FOG: WD40 repeat [General function prediction only	88.74
PF03959		212	FSH1: Serine hydrolase (FSH1); InterPro: IPR005645	88.65
PF11288		207	DUF3089: Protein of unknown function (DUF3089); In	88.54
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	88.5
PF13449		326	Phytase-like: Esterase-like activity of phytase	88.41
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	88.38
PF05705		240	DUF829: Eukaryotic protein of unknown function (DU	88.14
KOG4532		344	consensus WD40-like repeat containing protein [Gen	87.93
KOG1214		1289	consensus Nidogen and related basement membrane pr	87.76
PF13449		326	Phytase-like: Esterase-like activity of phytase	87.23
COG4814		288	Uncharacterized protein with an alpha/beta hydrola	86.71
PLN02408		365	phospholipase A1	86.56
KOG1282		454	consensus Serine carboxypeptidases (lysosomal cath	86.55
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	86.06
KOG0267		825	consensus Microtubule severing protein katanin p80	85.78
PLN02571		413	triacylglycerol lipase	85.71
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	85.57
PRK10252		1296	entF enterobactin synthase subunit F; Provisional	85.55
KOG0267		825	consensus Microtubule severing protein katanin p80	85.22
KOG3724		973	consensus Negative regulator of COPII vesicle form	85.16
PF04083		63	Abhydro_lipase: Partial alpha/beta-hydrolase lipas	84.99
KOG2931		326	consensus Differentiation-related gene 1 protein (	84.83
PF10605		690	3HBOH: 3HB-oligomer hydrolase (3HBOH) ; InterPro:	84.81
PRK13613		599	lipoprotein LpqB; Provisional	84.74
COG1075		336	LipA Predicted acetyltransferases and hydrolases w	84.72
PF05787		524	DUF839: Bacterial protein of unknown function (DUF	84.62
COG3946		456	VirJ Type IV secretory pathway, VirJ component [In	84.55
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	84.26
PLN02324		415	triacylglycerol lipase	84.19
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	84.12
KOG1912		1062	consensus WD40 repeat protein [General function pr	84.11
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	83.6
TIGR01849		406	PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase,	83.45
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	83.36
PLN02802		509	triacylglycerol lipase	82.9
KOG2041		1189	consensus WD40 repeat protein [General function pr	82.6
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	82.58

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=7.9e-42  Score=380.00  Aligned_cols=532  Identities=19%  Similarity=0.208  Sum_probs=348.3

Q ss_pred             CcccceeeCCCCCeEEEEeeccccccccCCceeEEEEEcCCCceeecccCCCccccccccceEEecCCcEEEEEecCCCC
Q 005240           31 AKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRR  110 (706)
Q Consensus        31 ~~~~~~~~SPDG~~laf~~~~~~~~~~~~~~~~l~~~d~~~g~~~~lt~~~~~~~~~~~~~~~wSpDg~~l~~~~~~~~~  110 (706)
                      ..+..+..+|+|+.++|+.+.-+... ......+|+.+...  .+.++....      ...+.|||||+.+++...... 
T Consensus        13 ~~~~~~~~~~~~~~~~~i~~~~~~~~-~~~~~~~~~~d~~~--~~~~~~~~~------~~~~~~spdg~~~~~~~~~~~-   82 (620)
T COG1506          13 ARVSDPRVSPPGGRLAYILTGLDFLK-PLYKSSLWVSDGKT--VRLLTFGGG------VSELRWSPDGSVLAFVSTDGG-   82 (620)
T ss_pred             hcccCcccCCCCceeEEeeccccccc-cccccceEEEeccc--ccccccCCc------ccccccCCCCCEEEEEeccCC-
Confidence            35778999999999999987311111 24567899977554  444443332      678899999999999852111 


Q ss_pred             CCCCCCCCCCCCceeecCCCcccccccchhccCCchhhhhhhhcccceEEEEccCCCceecCCC-ceEeeeeeCCCCcEE
Q 005240          111 DPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTP-AVYTAVEPSPDQKYV  189 (706)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~l~~~~l~g~~~~lt~~-~~~~~~~~SpDG~~i  189 (706)
                                                                  ...++|+++.+|   .++.. ..+....|+|+|+.+
T Consensus        83 --------------------------------------------~~~~l~l~~~~g---~~~~~~~~v~~~~~~~~g~~~  115 (620)
T COG1506          83 --------------------------------------------RVAQLYLVDVGG---LITKTAFGVSDARWSPDGDRI  115 (620)
T ss_pred             --------------------------------------------CcceEEEEecCC---ceeeeecccccceeCCCCCeE
Confidence                                                        126889888875   22222 456788999999999


Q ss_pred             EEEeeccCccccccc-------------cc-ccceEEEEecCCCeeEEcccCCCCCCCCcccCccCCCCcceeeecCCCc
Q 005240          190 LITSMHRPYSYKVPC-------------AR-FSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPS  255 (706)
Q Consensus       190 ~~~~~~~~~~~~~~~-------------~~-~~~~i~~~~~~~~~~~~l~~~~~~~~~p~~~~~~~~g~~~~~~spdg~~  255 (706)
                      ++...........-.             .. ....+++++.++ ....+....             .....+.+.++++.
T Consensus       116 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~d~~~-~~~~~~~~~-------------~~~~~~~~~~~~~~  181 (620)
T COG1506         116 AFLTAEGASKRDGGDHLFVDRLPVWFDGRGGERSDLYVVDIES-KLIKLGLGN-------------LDVVSFATDGDGRL  181 (620)
T ss_pred             EEEecccccccCCceeeeecccceeecCCCCcccceEEEccCc-ccccccCCC-------------CceeeeeeCCCCce
Confidence            983322211000000             00 112333444333 111111111             11113344444443


Q ss_pred             eEEEEEeccCCCCccccCccceeeeecCCCCCCCCceEEeecccccccceecCCCceEEEEeeccc----cceEEEEEcC
Q 005240          256 TLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKT----SQTRTWLVCP  331 (706)
Q Consensus       256 ~l~~~~~~~~~~~~~~~~~~~~l~~~d~~~~~~~~~~~l~~~~~~~~~~~wspDg~~l~~~~~~~~----~~~~l~~~d~  331 (706)
                       ++.+..........     ...+....   .++.+..++.....+..+.|.+||+.+++......    ....++.++.
T Consensus       182 -~~~~~~~~~~~~~~-----~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~gk~~~~~~~~~~~~~~~~~~~~~~~~  252 (620)
T COG1506         182 -VASIRLDDDADPWV-----TNLYVLIE---GNGELESLTPGEGSISKLAFDADGKSIALLGTESDRGLAEGDFILLLDG  252 (620)
T ss_pred             -eEEeeeccccCCce-----EeeEEEec---CCCceEEEcCCCceeeeeeeCCCCCeeEEeccCCccCccccceEEEEec
Confidence             33332222212211     11222222   35667777777777899999999998877654322    2334555552


Q ss_pred             CCCCCCceeeecCcccccccCCCCCceEeccCCCEEEEeeeccCCcceEEEEecCCCCCCCCCCceeeeecCCCceeeee
Q 005240          332 GSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIW  411 (706)
Q Consensus       332 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~s~dg~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~~d~~~g~~~~l~  411 (706)
                      ..+.  ....  ....+ . ..+.......-++..+++.....                 .....++.++..++. ..+.
T Consensus       253 ~~~~--~d~~--~~~~~-~-~~~~~~~~~~~~~~~~~~~~~~~-----------------~g~~~l~~~~~~~~~-~~~~  308 (620)
T COG1506         253 ELGE--VDGD--LSSGD-D-TRGAWAVEGGLDGDGLLFIATDG-----------------GGSSPLFRVDDLGGG-VEGL  308 (620)
T ss_pred             cccc--ccee--eccCC-c-ccCcHHhccccCCCcEEEEEecC-----------------CCceEEEEEeccCCc-eeee
Confidence            2211  1110  00000 0 00111111223444555444220                 112234444433332 2222


Q ss_pred             cccchhhhhhhhhhccCCCceecccCCCEEEEEEecCCCCcEEEEEECCCCceeEeecCCCCC-CCCCCCceEEEEEEcc
Q 005240          412 ESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPY-PTLASLQKEMIKYQRK  490 (706)
Q Consensus       412 ~~~~~~~~~~~~~~~~~~~~~~~s~Dg~~l~~~~~~~~~p~~v~~~~~~~~~~~~lt~~~~~~-~~~~~~~~~~~~~~~~  490 (706)
                      ..+.             .....|+.+++.+++.++++..|+++|+++.  ++..+++..+... ......++|.+++++.
T Consensus       309 ~~~~-------------~~v~~f~~~~~~~~~~~s~~~~p~~i~~~~~--~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~  373 (620)
T COG1506         309 SGDD-------------GGVPGFDVDGRKLALAYSSPTEPPEIYLYDR--GEEAKLTSSNNSGLKKVKLAEPEPVTYKSN  373 (620)
T ss_pred             cCCC-------------ceEEEEeeCCCEEEEEecCCCCccceEEEcC--CCceEEeecccccccccccCCceEEEEEcC
Confidence            2221             1245677799999999999999999999986  6666666655443 4566789999999999


Q ss_pred             CCeEEEEEEEecCCCCCCCCCCceEEEEEcCCCCCCcCcCCcccCCCCCcCCCCchHHHHHHHCCeEEEEcCCCCcCCCC
Q 005240          491 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEG  570 (706)
Q Consensus       491 dg~~i~~~l~~P~~~~~~~~~~~p~vv~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~v~~~~~~~~~g~g  570 (706)
                      ||.+|++|+++|+++++.|+  ||+||++||||+..      +.  +     .....+|.|+++||+|+.+|+||+.|||
T Consensus       374 dG~~i~~~l~~P~~~~~~k~--yP~i~~~hGGP~~~------~~--~-----~~~~~~q~~~~~G~~V~~~n~RGS~GyG  438 (620)
T COG1506         374 DGETIHGWLYKPPGFDPRKK--YPLIVYIHGGPSAQ------VG--Y-----SFNPEIQVLASAGYAVLAPNYRGSTGYG  438 (620)
T ss_pred             CCCEEEEEEecCCCCCCCCC--CCEEEEeCCCCccc------cc--c-----ccchhhHHHhcCCeEEEEeCCCCCCccH
Confidence            99999999999999988764  99999999999641      21  1     1235679999999999999999999999


Q ss_pred             CCCCch---hhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEechHHHHHHHHHHhCCCceeEEEeccCCCCCCCC-----
Q 005240          571 DKLPND---RFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLT-----  642 (706)
Q Consensus       571 ~~~~~~---~~~~~~~~D~~~~~~~l~~~~~id~~~i~i~G~S~GG~~a~~~~~~~p~~~~a~v~~~~~~d~~~~-----  642 (706)
                      ++|...   .++...++|++++++++.+++.+|++||+|+|+|||||||++++++.| +|+|+++.+++.++..+     
T Consensus       439 ~~F~~~~~~~~g~~~~~D~~~~~~~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~~  517 (620)
T COG1506         439 REFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGEST  517 (620)
T ss_pred             HHHHHhhhhccCCccHHHHHHHHHHHHhCCCcChHHeEEeccChHHHHHHHHHhcCc-hhheEEeccCcchhhhhccccc
Confidence            998863   456678999999999999999999999999999999999999999996 99999999987664421     


Q ss_pred             -------------Cc----cc------------------------------hHHHHHHHHHhCCCcEEEEEeCCCCccCC
Q 005240          643 -------------PF----GF------------------------------QAERFFDALKGHGALSRLVLLPFEHHVYA  675 (706)
Q Consensus       643 -------------~~----~~------------------------------~~~~~~~~l~~~~~~~~~~~~~~~~H~~~  675 (706)
                                   +.    .|                              |+++|+++|+.+|+++++++||+++|++.
T Consensus       518 ~~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~~i~~P~LliHG~~D~~v~~~q~~~~~~aL~~~g~~~~~~~~p~e~H~~~  597 (620)
T COG1506         518 EGLRFDPEENGGGPPEDREKYEDRSPIFYADNIKTPLLLIHGEEDDRVPIEQAEQLVDALKRKGKPVELVVFPDEGHGFS  597 (620)
T ss_pred             hhhcCCHHHhCCCcccChHHHHhcChhhhhcccCCCEEEEeecCCccCChHHHHHHHHHHHHcCceEEEEEeCCCCcCCC
Confidence                         11    01                              33499999999999999999999999999


Q ss_pred             CcccHHHHHHHHHHHHHHHhcc
Q 005240          676 ARENVMHVIWETDRWLQKYCLS  697 (706)
Q Consensus       676 ~~~~~~~~~~~~~~f~~~~l~~  697 (706)
                      .+.++...++++++||++|++.
T Consensus       598 ~~~~~~~~~~~~~~~~~~~~~~  619 (620)
T COG1506         598 RPENRVKVLKEILDWFKRHLKQ  619 (620)
T ss_pred             CchhHHHHHHHHHHHHHHHhcC
Confidence            9889999999999999999864

>PRK10115 protease 2; Provisional	Back alignment and domain information

>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1770 PtrB Protease II [Amino acid transport and metabolism]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway	Back alignment and domain information

>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins	Back alignment and domain information

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>PLN02442 S-formylglutathione hydrolase	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>COG0657 Aes Esterase/lipase [Lipid metabolism]	Back alignment and domain information

>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms]	Back alignment and domain information

>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>COG4099 Predicted peptidase [General function prediction only]	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PRK10439 enterobactin/ferric enterobactin esterase; Provisional	Back alignment and domain information

>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only]	Back alignment and domain information

>COG1647 Esterase/lipase [General function prediction only]	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate []	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PF10503 Esterase_phd: Esterase PHB depolymerase	Back alignment and domain information

>TIGR00976 /NonD putative hydrolase, CocE/NonD family	Back alignment and domain information

>KOG3101 consensus Esterase D [General function prediction only]	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PLN00021 chlorophyllase	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively []	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae	Back alignment and domain information

>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>PLN02872 triacylglycerol lipase	Back alignment and domain information

>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>COG0400 Predicted esterase [General function prediction only]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>COG2272 PnbA Carboxylesterase type B [Lipid metabolism]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>COG2936 Predicted acyl esterases [General function prediction only]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0627 Predicted esterase [General function prediction only]	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG4188 Predicted dienelactone hydrolase [General function prediction only]	Back alignment and domain information

>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG1838 consensus Alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171	Back alignment and domain information

>COG1770 PtrB Protease II [Amino acid transport and metabolism]	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only]	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold	Back alignment and domain information

>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>KOG4667 consensus Predicted esterase [Lipid transport and metabolism]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PTZ00472 serine carboxypeptidase (CBP1); Provisional	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>PRK06765 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>COG4947 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2984 consensus Predicted hydrolase [General function prediction only]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4757 Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases	Back alignment and domain information

>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function	Back alignment and domain information

>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []	Back alignment and domain information

>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants	Back alignment and domain information

>PRK04940 hypothetical protein; Provisional	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK13614 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3150 Predicted esterase [General function prediction only]	Back alignment and domain information

>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised	Back alignment and domain information

>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic	Back alignment and domain information

>PRK13613 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ]	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>PRK13615 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2	Back alignment and domain information

>KOG3967 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only]	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK13614 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]	Back alignment and domain information

>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism]	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02209 serine carboxypeptidase	Back alignment and domain information

>PRK13615 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>COG4257 Vgb Streptogramin lyase [Defense mechanisms]	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>PLN03016 sinapoylglucose-malate O-sinapoyltransferase	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family	Back alignment and domain information

>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism]	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PRK10252 entF enterobactin synthase subunit F; Provisional	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function	Back alignment and domain information

>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown]	Back alignment and domain information

>PF10605 3HBOH: 3HB-oligomer hydrolase (3HBOH) ; InterPro: IPR016582 This entry represents a group of predicted D-(-)-3-hydroxybutyrate oligomer hydrolases (also known as 3HB-oligomer hydrolase), which function in the degradation of poly-3-hydroxybutyrate (PHB)	Back alignment and domain information

>PRK13613 lipoprotein LpqB; Provisional	Back alignment and domain information

>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function	Back alignment and domain information

>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>PLN02324 triacylglycerol lipase	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		706
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	4e-12
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	2e-11
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	4e-11
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	9e-11
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	1e-10
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	4e-10
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	6e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-10
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	9e-10
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	1e-09
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	4e-09
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	6e-09
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	3e-05
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	8e-09
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	2e-08
3c8d_A		403	Enterochelin esterase; alpha-beta-alpha sandwich,	2e-08
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	1e-07
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	7e-07
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	2e-06
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	3e-06
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	3e-06
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	4e-06
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	6e-06
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	9e-06
1k32_A		1045	Tricorn protease; protein degradation, substrate g	1e-05
1k32_A		1045	Tricorn protease; protein degradation, substrate g	3e-04
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	2e-05
2d81_A		318	PHB depolymerase; alpha/beta hydrolase fold, circu	1e-04
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	2e-04
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	3e-04
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	3e-04
3gff_A		331	IROE-like serine hydrolase; NP_718593.1, structura	3e-04
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	5e-04
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	5e-04
1mpx_A		615	Alpha-amino acid ester hydrolase; alpha/beta hydro	6e-04

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662	Back alignment and structure

 Score = 68.3 bits (167), Expect = 4e-12
 Identities = 30/175 (17%), Positives = 48/175 (27%), Gaps = 47/175 (26%)

Query: 483 EMIKYQRKDGVPLTATLYLPPG--YDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           ++  +   DG  + A +Y P    +    D   P +  A+          G     P   
Sbjct: 392 QIRTFTAPDGREIHAHIYPPHSPDFTGPADELPPYVVMAHG---------GPTSRVPAVL 442

Query: 541 SGMTPTSSLIFLARR-FAVLAGPSIPIIGEGDKLPNDR--------FVEQL--------V 583
                     +   R   V                N          + E+L        V
Sbjct: 443 DLDVA-----YFTSRGIGVAD-------------VNYGGSTGYGRAYRERLRGRWGVVDV 484

Query: 584 SSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYN 638
               A    +   G AD +R+AV G S G +  A  L     ++ CG       +
Sbjct: 485 EDCAAVATALAEEGTADRARLAVRGGSAGGWTAASSLVS-TDVYACGTVLYPVLD 538

PyMOL of 3azo

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706	Back alignment and structure

>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Length = 403	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Length = 391	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Length = 398	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} Length = 209	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223	Back alignment and structure

>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Length = 318	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Length = 397	Back alignment and structure

>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Length = 331	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Length = 297	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Length = 275	Back alignment and structure

>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Length = 615	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		706
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	100.0
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	100.0
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	100.0
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	100.0
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	100.0
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	100.0
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	100.0
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	100.0
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	100.0
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	100.0
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	100.0
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	100.0
4hvt_A		711	Ritya.17583.B, post-proline cleaving enzyme; ssgci	100.0
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.94
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.9
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.9
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.89
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.89
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.89
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.88
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.87
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.87
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.86
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.85
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.84
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.82
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.81
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.81
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	99.81
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.79
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.78
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.78
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	99.77
4ao6_A		259	Esterase; hydrolase, thermo label; 1.60A {Unidenti	99.76
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	99.76
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	99.76
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	99.76
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.74
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	99.74
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.74
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	99.74
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.74
1jjf_A		268	Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x	99.74
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.73
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	99.73
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	99.72
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	99.71
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	99.71
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	99.71
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	99.71
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	99.71
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.7
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.7
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.69
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	99.69
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	99.69
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	99.69
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	99.69
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.68
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	99.68
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.68
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.68
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	99.68
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	99.68
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	99.67
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	99.67
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.67
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.67
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	99.67
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	99.67
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	99.67
1gkl_A		297	Endo-1,4-beta-xylanase Y; hydrolase, esterase fami	99.67
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	99.67
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.67
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	99.66
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	99.66
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	99.66
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.66
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	99.66
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	99.65
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	99.65
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	99.65
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	99.64
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	99.64
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.64
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.63
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.63
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	99.63
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.63
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.63
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.63
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	99.62
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.62
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.62
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	99.61
2b9v_A		652	Alpha-amino acid ester hydrolase; catalytic triad,	99.61
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.6
1mpx_A		615	Alpha-amino acid ester hydrolase; alpha/beta hydro	99.6
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.58
3h04_A		275	Uncharacterized protein; protein with unknown func	99.58
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.58
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.58
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	99.58
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	99.58
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	99.58
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	99.57
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	99.57
3vis_A		306	Esterase; alpha/beta-hydrolase fold, polyethylene	99.57
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	99.57
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	99.57
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	99.57
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	99.56
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	99.56
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.56
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.55
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.55
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.54
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	99.54
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.54
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.54
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	99.54
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.53
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	99.53
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	99.53
1sfr_A		304	Antigen 85-A; alpha/beta hydrolase, structural gen	99.53
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	99.53
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	99.53
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.53
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.53
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	99.53
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.52
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.52
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	99.52
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.52
3c8d_A		403	Enterochelin esterase; alpha-beta-alpha sandwich,	99.52
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.52
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.52
3d59_A		383	Platelet-activating factor acetylhydrolase; secret	99.5
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	99.5
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.5
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.5
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.5
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	99.5
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	99.5
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.49
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.49
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.49
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.49
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	99.48
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	99.48
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.48
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.47
3iii_A		560	COCE/NOND family hydrolase; structural genomics, c	99.47
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	99.47
2gzs_A		278	IROE protein; enterobactin, salmochelin, DFP, hydr	99.47
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.47
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.47
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.47
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.47
1r88_A		280	MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP	99.46
1lns_A		763	X-prolyl dipeptidyl aminopetidase; alpha beta hydr	99.46
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.45
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.44
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	99.44
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	99.44
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.44
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.44
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	99.44
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.43
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.43
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	99.43
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.42
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	99.42
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.42
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.42
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.42
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	99.42
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	99.42
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.41
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	99.41
3llc_A		270	Putative hydrolase; structural genomics, joint cen	99.41
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	99.41
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	99.41
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	99.4
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.4
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.39
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.39
4fol_A		299	FGH, S-formylglutathione hydrolase; D-type esteras	99.38
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.38
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	99.37
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.37
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	99.37
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.35
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.35
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.35
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	99.34
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.34
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.34
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.34
3i2k_A		587	Cocaine esterase; alpha/beta hydrolase, hydrolase;	99.34
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.33
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	99.33
3pic_A		375	CIP2; alpha/beta hydrolase fold, glucuronoyl ester	99.33
1qe3_A		489	PNB esterase, para-nitrobenzyl esterase; alpha-bet	99.32
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.32
1dqz_A		280	85C, protein (antigen 85-C); fibronectin, structur	99.32
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	99.31
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.31
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	99.31
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	99.3
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.3
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.3
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.29
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.29
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.28
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.27
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.27
3gff_A		331	IROE-like serine hydrolase; NP_718593.1, structura	99.27
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.27
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.26
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	99.26
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.26
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.26
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	99.26
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.26
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.25
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.25
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.25
4g4g_A		433	4-O-methyl-glucuronoyl methylesterase; alpha/beta	99.25
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.24
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.24
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.24
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.23
4f21_A		246	Carboxylesterase/phospholipase family protein; str	99.23
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	99.22
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	99.2
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.19
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.19
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.18
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.17
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	99.17
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.16
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.16
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	99.15
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.15
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	99.14
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.14
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	99.14
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.13
2h7c_A		542	Liver carboxylesterase 1; enzyme, cholesteryl este	99.13
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	99.12
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.11
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	99.11
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.11
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.11
2ogt_A		498	Thermostable carboxylesterase EST50; alpha/beta hy	99.11
2ha2_A		543	ACHE, acetylcholinesterase; hydrolase fold, serine	99.1
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.1
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.1
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	99.09
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	99.09
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.08
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.08
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	99.08
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	99.08
2pm7_B		297	Protein transport protein SEC13, protein transport	99.08
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	99.08
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.07
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.07
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.07
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	99.07
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.07
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.07
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	99.07
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	99.07
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.07
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	99.06
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.06
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.05
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	99.04
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	99.04
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.04
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	99.04
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.04
1p0i_A		529	Cholinesterase; serine hydrolase, butyrate, hydrol	99.04
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.03
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.03
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	99.03
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	99.03
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	99.02
3guu_A		462	Lipase A; protein structure, hydrolase; HET: 1PE;	99.02
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.02
1ea5_A		537	ACHE, acetylcholinesterase; hydrolase, serine hydr	99.01
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.01
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	99.0
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	98.99
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	98.99
1ukc_A		522	ESTA, esterase; fungi, A/B hydrolase fold, acetylc	98.99
2fj0_A		551	JuvenIle hormone esterase; manduca sexta, alpha-be	98.98
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	98.98
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	98.98
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	98.97
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	98.97
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	98.97
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	98.97
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	98.96
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	98.96
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	98.96
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	98.95
2bce_A		579	Cholesterol esterase; hydrolase, serine esterase,	98.95
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	98.95
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	98.95
2pm7_B		297	Protein transport protein SEC13, protein transport	98.94
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.94
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	98.94
1llf_A		534	Lipase 3; candida cylindracea cholesterol esterase	98.93
1dx4_A		585	ACHE, acetylcholinesterase; hydrolase, serine este	98.93
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.93
3jro_A		753	Fusion protein of protein transport protein SEC13	98.92
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	98.91
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	98.91
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	98.91
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	98.91
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	98.91
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	98.91
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	98.9
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	98.89
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.89
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.88
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	98.88
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	98.88
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	98.88
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	98.87
1thg_A		544	Lipase; hydrolase(carboxylic esterase); HET: NAG N	98.87
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	98.86
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	98.86
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	98.86
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	98.85
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	98.85
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	98.84
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	98.84
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	98.84
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	98.83
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	98.82
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	98.82
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	98.81
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.8
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	98.79
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	98.78
3jro_A		753	Fusion protein of protein transport protein SEC13	98.77
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	98.77
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	98.77
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	98.76
1ycd_A		243	Hypothetical 27.3 kDa protein in AAP1-SMF2 interge	98.76
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	98.75
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	98.75
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	98.75
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	98.74
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	98.74
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.73
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	98.73
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	98.72
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.72
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	98.71
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.7
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	98.7
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	98.7
3bix_A		574	Neuroligin-1, neuroligin I; esterase domain, alpha	98.7
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	98.7
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	98.69
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	98.68
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	98.67
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	98.66
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.66
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	98.65
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	98.63
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	98.63
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	98.62
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	98.61
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	98.61
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	98.61
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	98.6
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.59
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.59
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.59
2d81_A		318	PHB depolymerase; alpha/beta hydrolase fold, circu	98.58
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	98.58
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	98.58
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	98.56
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	98.56
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	98.56
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	98.55
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	98.55
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.53
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	98.52
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	98.52
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	98.51
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	98.51
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	98.5
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	98.5
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	98.49
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	98.48
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	98.47
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.47
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	98.47
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	98.45
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	98.44
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	98.44
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.44
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	98.44
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	98.43
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.42
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.41
1iup_A		282	META-cleavage product hydrolase; aromatic compound	98.41
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	98.4
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.4
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	98.4
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	98.4
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.4
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	98.38
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	98.38
1r3d_A		264	Conserved hypothetical protein VC1974; structural	98.37
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.37
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.35
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	98.33
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.33
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	98.32
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	98.32
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	98.31
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	98.31
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	98.3
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	98.3
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	98.3
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	98.29
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	98.29
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	98.29
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	98.29
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	98.29
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	98.28
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.28
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	98.28
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	98.27
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	98.25
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	98.24
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.24
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	98.24
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.22
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	98.22
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.22
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	98.22
3g02_A		408	Epoxide hydrolase; alpha/beta hydrolase fold, enan	98.21
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	97.51
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	98.19
1hpl_A		449	Lipase; hydrolase(carboxylic esterase); 2.30A {Equ	98.15
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	98.14
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	98.11
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.09
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	98.09
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	98.08
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	98.08
1rp1_A		450	Pancreatic lipase related protein 1; hydrolase, li	98.05
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	98.04
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	97.99
2qe8_A		343	Uncharacterized protein; structural genomics, join	97.95
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	97.93
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	97.92
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.91
2zyr_A		484	Lipase, putative; fatty acid, hydrolase; HET: 1PE;	97.89
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.85
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.84
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	97.83
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.82
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	97.82
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	97.78
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	97.78
2qe8_A		343	Uncharacterized protein; structural genomics, join	97.71
3lp5_A		250	Putative cell surface hydrolase; structural genom	97.69
1ei9_A		279	Palmitoyl protein thioesterase 1; alpha/beta hydro	97.69
2p4o_A		306	Hypothetical protein; putative lactonase, structur	97.64
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	97.63
4ebb_A		472	Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2	97.57
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.5
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.43
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.41
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.41
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.35
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.31
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.29
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.23
3tej_A		329	Enterobactin synthase component F; nonribosomal pe	97.23
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	97.2
3kya_A		496	Putative phosphatase; structural genomics, joint c	97.18
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.15
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	97.14
2dsn_A		387	Thermostable lipase; T1 lipase, hydrolase; 1.50A {	96.97
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	96.95
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	96.86
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	96.7
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	96.67
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	96.66

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

Probab=100.00  E-value=8e-51  Score=470.51  Aligned_cols=567  Identities=13%  Similarity=0.047  Sum_probs=393.0

Q ss_pred             ceeEeecCCCCCCCCeeeeecCCCCC--cc--cceeeCCCCCeEEEEeeccccccccCCceeEEEEEcCCCceeecccCC
Q 005240            6 GIGIHRLLPDDSLGPEKEVHGYPDGA--KI--NFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESP   81 (706)
Q Consensus         6 ~~~~~~~~~~~~~g~~~~i~~~~~~~--~~--~~~~~SPDG~~laf~~~~~~~~~~~~~~~~l~~~d~~~g~~~~lt~~~   81 (706)
                      +|+++++.+    |+.+++.......  .+  ..+.|||||++|||..+... ....+...++|++|+++++.++|+...
T Consensus        37 ~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~Spdg~~l~~~~~~~~-~~r~~~~~~~~~~d~~~~~~~~l~~~~  111 (740)
T 4a5s_A           37 NILVFNAEY----GNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVK-QWRHSYTASYDIYDLNKRQLITEERIP  111 (740)
T ss_dssp             EEEEEETTT----CCEEEEECTTTTTTCCSCCCEEEECTTSSEEEEEEEEEE-CSSSCEEEEEEEEETTTTEECCSSCCC
T ss_pred             cEEEEECCC----CceEEEEechhhhhhcccccceEECCCCCEEEEEECCee-eEEEccceEEEEEECCCCcEEEcccCC
Confidence            588999977    8877764322211  22  23899999999999876211 111133478999999999999987654


Q ss_pred             CccccccccceEEecCCcEEEEEecCCCCCCCCCCCCCCCCceeecCCCcccccccchhccCCchhhhhhhhcccceEEE
Q 005240           82 DICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVL  161 (706)
Q Consensus        82 ~~~~~~~~~~~~wSpDg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~l~~  161 (706)
                      ..     +..++|||||++|+|..+                                                  ..||+
T Consensus       112 ~~-----~~~~~~SPdG~~la~~~~--------------------------------------------------~~i~~  136 (740)
T 4a5s_A          112 NN-----TQWVTWSPVGHKLAYVWN--------------------------------------------------NDIYV  136 (740)
T ss_dssp             TT-----EEEEEECSSTTCEEEEET--------------------------------------------------TEEEE
T ss_pred             Cc-----ceeeEECCCCCEEEEEEC--------------------------------------------------CeEEE
Confidence            43     678999999999999842                                                  57999


Q ss_pred             Ecc-CCCceecCCCc---eE-----------------eeeeeCCCCcEEEEEeeccCcc--ccc----------c-----
Q 005240          162 GSL-DGTAKDFGTPA---VY-----------------TAVEPSPDQKYVLITSMHRPYS--YKV----------P-----  203 (706)
Q Consensus       162 ~~l-~g~~~~lt~~~---~~-----------------~~~~~SpDG~~i~~~~~~~~~~--~~~----------~-----  203 (706)
                      +++ +|+.++|+..+   .+                 ..+.|||||++|+|.+.+...-  +..          +     
T Consensus       137 ~~~~~~~~~~lt~~g~~~~~~~g~~~~v~~ee~~~~~~~~~wSpDg~~la~~~~d~~~v~~~~~~~~~~~~~~~~~~~~~  216 (740)
T 4a5s_A          137 KIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRV  216 (740)
T ss_dssp             ESSTTSCCEECCSCCBTTTEEESBCCHHHHHHTSSSSBCEEECTTSSEEEEEEEECTTCCEEEEEECCSTTCSSCEEEEE
T ss_pred             EECCCCceEEEcCCCCccceecCcccccccchhcCCCcceEECCCCCEEEEEEEcccCCceEEEEeecCCCCCCCcceee
Confidence            999 55888887641   11                 2488999999999987654310  000          0     


Q ss_pred             ----cc--cccceEEEEecCC---C---eeEEcccCCCCCCCCcccCccCCCCcceeeecCCCceEEEEEeccCCCCccc
Q 005240          204 ----CA--RFSQKVQVWTTDG---K---LVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVE  271 (706)
Q Consensus       204 ----~~--~~~~~i~~~~~~~---~---~~~~l~~~~~~~~~p~~~~~~~~g~~~~~~spdg~~~l~~~~~~~~~~~~~~  271 (706)
                          ..  .....|++|++++   +   +.+++..........       .....++|||||+. +++..+...      
T Consensus       217 ~yp~~G~~~~~~~l~v~d~~~~~~~~~~~~~~l~~~~~~~~~~-------~~~~~~~wspdg~~-~~~~~~r~~------  282 (740)
T 4a5s_A          217 PYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGD-------HYLCDVTWATQERI-SLQWLRRIQ------  282 (740)
T ss_dssp             ECCBTTSCCCEEEEEEEETTSCCSSSCCCEEEECCCHHHHTSC-------EEEEEEEEEETTEE-EEEEEESST------
T ss_pred             cCCCCcCcCCeeEEEEEECCCCCCCCcceEEEecCCccCCCCC-------eEEEEEEEeCCCeE-EEEEeCCCC------
Confidence                00  0113799999998   6   555554311000000       11336799999985 555543321      


Q ss_pred             cCccceeeeecCCCCCCCC-------ceEEe--ecccc-----cccceecCCCceEE-EEeeccccceEEEEEcCCCCCC
Q 005240          272 VSPRDIIYTQPAEPAEGEK-------PEILH--KLDLR-----FRSVSWCDDSLALV-NETWYKTSQTRTWLVCPGSKDV  336 (706)
Q Consensus       272 ~~~~~~l~~~d~~~~~~~~-------~~~l~--~~~~~-----~~~~~wspDg~~l~-~~~~~~~~~~~l~~~d~~~~~~  336 (706)
                        +...|+++|+   ++++       .+++.  .....     ...|.|||||+.|+ +.+ ..++..+||++|+++  +
T Consensus       283 --~~~~i~~~d~---~tg~~~~~~~~~~~l~~~~~~~~v~~~~~~~p~fspDG~~l~~~~s-~~~G~~~l~~~~~~~--~  354 (740)
T 4a5s_A          283 --NYSVMDICDY---DESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIIS-NEEGYRHICYFQIDK--K  354 (740)
T ss_dssp             --TEEEEEEEEE---ETTTTEEEECGGGCEEEECSSSCSSSSSCCCCEECTTSSEEEEEEE-CTTSCEEEEEEETTC--S
T ss_pred             --CEEEEEEEEC---CCCccccceeEEEEeeeccCCceEccCcCCCceEcCCCCEEEEEEE-cCCCceEEEEEECCC--C
Confidence              2235889998   6666       34442  22222     34799999999988 554 455788999999998  4


Q ss_pred             CceeeecCcccccccCCCCCceEeccCCCEEEEeeeccCCcceEEEEecCCCCCCCCCCceeeeecCCCcee-eeecccc
Q 005240          337 APRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKE-RIWESNR  415 (706)
Q Consensus       337 ~~~~l~~~~~~~~~~~~~~~~~~~s~dg~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~~d~~~g~~~-~l~~~~~  415 (706)
                      +.++|+.......        ..+++||+.|+|.....            +.  +....+||++++++++.+ .|+..-.
T Consensus       355 ~~~~lT~g~~~v~--------~~~~~d~~~i~f~~~~~------------~~--~~~~~~ly~v~~~g~~~~~~lt~~~~  412 (740)
T 4a5s_A          355 DCTFITKGTWEVI--------GIEALTSDYLYYISNEY------------KG--MPGGRNLYKIQLIDYTKVTCLSCELN  412 (740)
T ss_dssp             SCEESCCSSSCEE--------EEEEECSSEEEEEESCG------------GG--CTTCBEEEEEETTEEEEEEESSTTTS
T ss_pred             ceEecccCCEEEE--------EEEEEeCCEEEEEEecC------------CC--CCceeEEEEEECCCCCcceeeccccC
Confidence            5778765543211        11346688888876320            00  134568999999876544 4442100


Q ss_pred             hhhhhhhhhhccCCCceecccCCCEEEEEEecCCCCcEEEEEECCCCceeEeecCCCCC----CCCCCCceEEEEEEccC
Q 005240          416 EKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPY----PTLASLQKEMIKYQRKD  491 (706)
Q Consensus       416 ~~~~~~~~~~~~~~~~~~~s~Dg~~l~~~~~~~~~p~~v~~~~~~~~~~~~lt~~~~~~----~~~~~~~~~~~~~~~~d  491 (706)
                      .        -......++||||++++++++++.. |+.++++++.+++..++...|...    ........+.+++ ..|
T Consensus       413 ~--------~~~~~~~~~~S~dg~~~~~~~s~~~-~p~~~l~~~~~~~~~~~l~~n~~~~~~~~~~~~~~~~~~~~-~~d  482 (740)
T 4a5s_A          413 P--------ERCQYYSVSFSKEAKYYQLRCSGPG-LPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFI-ILN  482 (740)
T ss_dssp             T--------TTBCBEEEEECTTSSEEEEEECSBS-SCEEEEEETTTTEEEEEEECCHHHHHHHTTEECCEEEEEEE-EET
T ss_pred             C--------CCCceEEEEECCCCCEEEEEeCCCC-CCEEEEEECCCCcEEEEeccChhhhhhhhhccCCccEEEEE-ccC
Confidence            0        0012346899999999999999886 889999999888877777655332    2233456778888 679


Q ss_pred             CeEEEEEEEecCCCCCCCCCCceEEEEEcCCCCCCcCcCCcccCCCCCcCCCCchHHHHHHH-CCeEEEEcCCCCcCCCC
Q 005240          492 GVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLA-RRFAVLAGPSIPIIGEG  570 (706)
Q Consensus       492 g~~i~~~l~~P~~~~~~~~~~~p~vv~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-~G~~v~~~~~~~~~g~g  570 (706)
                      |.++++++++|+++++.+  ++|+||++|||+...     .+...      +...+...|++ +||+|++++++|..++|
T Consensus       483 g~~l~~~~~~P~~~~~~~--~~P~vv~~HGg~~~~-----~~~~~------~~~~~~~~l~~~~G~~Vv~~D~rG~g~~g  549 (740)
T 4a5s_A          483 ETKFWYQMILPPHFDKSK--KYPLLLDVYAGPCSQ-----KADTV------FRLNWATYLASTENIIVASFDGRGSGYQG  549 (740)
T ss_dssp             TEEEEEEEEECTTCCTTS--CEEEEEECCCCTTCC-----CCCCC------CCCSHHHHHHHTTCCEEEEECCTTCSSSC
T ss_pred             CeEEEEEEEeCCCCCCCC--CccEEEEECCCCccc-----ccccc------cCcCHHHHHHhcCCeEEEEEcCCCCCcCC
Confidence            999999999999987654  599999999987431     11111      12234556664 99999999998776555


Q ss_pred             CCCCc---hhhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEechHHHHHHHHHHhCCCceeEEEeccCCCCCCCC-----
Q 005240          571 DKLPN---DRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLT-----  642 (706)
Q Consensus       571 ~~~~~---~~~~~~~~~D~~~~~~~l~~~~~id~~~i~i~G~S~GG~~a~~~~~~~p~~~~a~v~~~~~~d~~~~-----  642 (706)
                      ..+..   ..+....++|+.+++++|.+++++|++||+|+|+||||++|++++.++|++|+|+++.+|+.++...     
T Consensus       550 ~~~~~~~~~~~~~~~~~D~~~~i~~l~~~~~~d~~ri~i~G~S~GG~~a~~~a~~~p~~~~~~v~~~p~~~~~~~~~~~~  629 (740)
T 4a5s_A          550 DKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYT  629 (740)
T ss_dssp             HHHHGGGTTCTTSHHHHHHHHHHHHHHTSTTEEEEEEEEEEETHHHHHHHHHHTTTCSCCSEEEEESCCCCGGGSBHHHH
T ss_pred             hhHHHHHHhhhCcccHHHHHHHHHHHHhcCCcCCccEEEEEECHHHHHHHHHHHhCCCceeEEEEcCCccchHHhhhHHH
Confidence            44322   1233456899999999999888899999999999999999999999999999999999998764310     


Q ss_pred             ------C-------------------------cc------------chHHHHHHHHHhCCCcEEEEEeCCCCccCCCccc
Q 005240          643 ------P-------------------------FG------------FQAERFFDALKGHGALSRLVLLPFEHHVYAAREN  679 (706)
Q Consensus       643 ------~-------------------------~~------------~~~~~~~~~l~~~~~~~~~~~~~~~~H~~~~~~~  679 (706)
                            |                         ..            -+..+++++|+..++++++++||+++|.+.....
T Consensus       630 ~~~~~~p~~~~~~~~~~~~~~~~~~~~i~~~P~Lii~G~~D~~v~~~~~~~l~~~l~~~g~~~~~~~~~~~~H~~~~~~~  709 (740)
T 4a5s_A          630 ERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTA  709 (740)
T ss_dssp             HHHHCCSSTTTTHHHHHHSCSGGGGGGGGGSEEEEEEETTCSSSCTHHHHHHHHHHHHTTCCCEEEEETTCCTTCCSHHH
T ss_pred             HHHcCCCCccccHHHHHhCCHHHHHhcCCCCcEEEEEcCCCCccCHHHHHHHHHHHHHCCCCeEEEEECCCCCcCCCCcc
Confidence                  1                         00            0223899999999999999999999999966667


Q ss_pred             HHHHHHHHHHHHHHHhccCC
Q 005240          680 VMHVIWETDRWLQKYCLSNT  699 (706)
Q Consensus       680 ~~~~~~~~~~f~~~~l~~~~  699 (706)
                      ..++++.+.+||+++|....
T Consensus       710 ~~~~~~~i~~fl~~~l~~~~  729 (740)
T 4a5s_A          710 HQHIYTHMSHFIKQCFSLPA  729 (740)
T ss_dssp             HHHHHHHHHHHHHHHTTCC-
T ss_pred             HHHHHHHHHHHHHHHcCCCC
Confidence            78999999999999997544

PyMOL of 4a5s

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A*	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A*	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba}	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A*	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A*	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A*	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A*	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans}	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A*	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina}	Back alignment and structure

>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A*	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A*	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp}	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A*	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A	Back alignment and structure

>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ...	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ...	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A*	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ...	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17	Back alignment and structure

>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A*	Back alignment and structure

>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A*	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A*	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A*	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A*	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A*	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A*	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus}	Back alignment and structure

>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		706
d1mpxa2		381	c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol	2e-10
d1wb4a1		273	c.69.1.2 (A:803-1075) Feruloyl esterase domain of	8e-10
d2b9va2		385	c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol	3e-09
d1xfda2		258	c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li	4e-09
d2d81a1		318	c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer	1e-07
d2gzsa1		265	c.69.1.38 (A:41-305) Enterobactin and salmochelin	7e-07
d2bgra2		258	c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26	9e-07
d3c8da2		246	c.69.1.2 (A:151-396) Enterochelin esterase, cataly	2e-05
d1sfra_		288	c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo	5e-05
d1r88a_		267	c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu	7e-05
d2hqsa1		269	b.68.4.1 (A:163-431) TolB, C-terminal domain {Esch	9e-05
d2hu7a2		260	c.69.1.33 (A:322-581) Acylamino-acid-releasing enz	1e-04
d1pv1a_		299	c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake	2e-04
d1dqza_		280	c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo	2e-04
d1qfma2		280	c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term	5e-04
d1ju3a2		347	c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t	0.001
d1jjfa_		255	c.69.1.2 (A:) Feruloyl esterase domain of the cell	0.002

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: PepX catalytic domain-like
domain: Alpha-amino acid ester hydrolase
species: Xanthomonas citri [TaxId: 346]

 Score = 61.3 bits (147), Expect = 2e-10
 Identities = 25/182 (13%), Positives = 53/182 (29%), Gaps = 18/182 (9%)

Query: 466 QITNFPHPYPTLAS-LQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDY 524
            IT  P      ++   K  +    +DGV L   + LP G         P +    P D 
Sbjct: 7   DITGKPFVAADASNDYIKREVMIPMRDGVKLHTVIVLPKG-----AKNAPIVLTRTPYDA 61

Query: 525 KSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGP--------SIPIIGEGDKLPND 576
               +    R +      +      +F+   +  +              ++    + P +
Sbjct: 62  ----SGRTERLASPHMKDLLSAGDDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLN 117

Query: 577 RFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGS 636
                  + A   ++ +V+       ++ + G SY  F     L +        +  S  
Sbjct: 118 PSEVDHATDAWDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPM 177

Query: 637 YN 638
            +
Sbjct: 178 ID 179

PyMOL of d1mpxa2

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273	Back information, alignment and structure

>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258	Back information, alignment and structure

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318	Back information, alignment and structure

>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265	Back information, alignment and structure

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258	Back information, alignment and structure

>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288	Back information, alignment and structure

>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 269	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260	Back information, alignment and structure

>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280	Back information, alignment and structure

>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Length = 255	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		706
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	99.92
d2bgra2		258	Dipeptidyl peptidase IV/CD26, C-terminal domain {P	99.92
d2hu7a2		260	Acylamino-acid-releasing enzyme, C-terminal donain	99.9
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.88
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.88
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.87
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.86
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.85
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	99.84
d1qfma2		280	Prolyl oligopeptidase, C-terminal domain {Pig (Sus	99.83
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.82
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.78
d1vlqa_		322	Acetyl xylan esterase TM0077 {Thermotoga maritima	99.76
d1jkma_		358	Carboxylesterase {Bacillus subtilis, brefeldin A e	99.74
d1lzla_		317	Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	99.74
d1l7aa_		318	Cephalosporin C deacetylase {Bacillus subtilis [Ta	99.73
d2jbwa1		360	2,6-dihydropseudooxynicotine hydrolase {Arthrobact	99.73
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	99.72
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.72
d1jjfa_		255	Feruloyl esterase domain of the cellulosomal xylan	99.72
d1mpxa2		381	Alpha-amino acid ester hydrolase {Xanthomonas citr	99.7
d1dina_		233	Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI	99.69
d1jfra_		260	Lipase {Streptomyces exfoliatus [TaxId: 1905]}	99.68
d1u4na_		308	Carboxylesterase {Alicyclobacillus acidocaldarius	99.67
d1jjia_		311	Carboxylesterase {Archaeon Archaeoglobus fulgidus	99.66
d3c8da2		246	Enterochelin esterase, catalytic domain {Shigella	99.65
d1ju3a2		347	Bacterial cocaine esterase N-terminal domain {Rhod	99.65
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	99.65
d2b9va2		385	Alpha-amino acid ester hydrolase {Acetobacter past	99.63
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.61
d1wb4a1		273	Feruloyl esterase domain of the cellulosomal xylan	99.6
d1sfra_		288	Antigen 85a {Mycobacterium tuberculosis [TaxId: 17	99.6
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	99.59
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.58
d2i3da1		218	Hypothetical protein Atu1826 {Agrobacterium tumefa	99.58
d2gzsa1		265	Enterobactin and salmochelin hydrolase IroE {Esche	99.57
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.57
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.53
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.52
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.51
d1ufoa_		238	Hypothetical protein TT1662 {Thermus thermophilus	99.5
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	99.48
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.48
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	99.48
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	99.48
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.47
d1lnsa3		405	X-Prolyl dipeptidyl aminopeptidase PepX, middle do	99.44
d1pv1a_		299	Hypothetical esterase YJL068C {Baker's yeast (Sacc	99.44
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.43
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.42
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.42
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.4
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.4
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.39
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.39
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	99.38
d1r88a_		267	Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta	99.38
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.37
d1dqza_		280	Antigen 85c {Mycobacterium tuberculosis [TaxId: 17	99.35
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.35
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	99.33
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	99.32
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	99.32
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	99.31
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.29
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.28
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	99.28
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	99.27
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.26
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.25
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.23
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.22
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	99.2
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.18
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	99.18
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	99.18
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.18
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	99.15
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	99.15
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.14
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.13
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.11
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	99.11
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.09
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.08
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.07
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	99.07
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.06
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	99.05
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	99.05
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	99.05
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	99.04
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	99.04
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	99.03
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	99.02
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	99.01
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	99.0
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	98.99
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	98.99
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.98
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	98.98
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	98.93
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	98.91
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	98.9
d1llfa_		534	Type-B carboxylesterase/lipase {Candida cylindrace	98.82
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	98.81
d2h7ca1		532	Mammalian carboxylesterase (liver carboxylesterase	98.8
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	98.78
d2hu7a1		313	Acylamino-acid-releasing enzyme, N-terminal donain	98.75
d1qe3a_		483	Thermophilic para-nitrobenzyl esterase (PNB estera	98.75
d1thga_		544	Type-B carboxylesterase/lipase {Fungus (Geotrichum	98.75
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	98.72
d2bcea_		579	Bile-salt activated lipase (cholesterol esterase)	98.69
d2ha2a1		542	Acetylcholinesterase {Mouse (Mus musculus) [TaxId:	98.69
d1tbga_		340	beta1-subunit of the signal-transducing G protein	98.68
d1ea5a_		532	Acetylcholinesterase {Pacific electric ray (Torped	98.68
d1ukca_		517	Esterase EstA {Aspergillus niger [TaxId: 5061]}	98.68
d1qlwa_		318	A novel bacterial esterase {Alcaligenes sp. [TaxId	98.65
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.65
d1p0ia_		526	Butyryl cholinesterase {Human (Homo sapiens) [TaxI	98.64
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	98.62
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.61
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	98.6
d1dx4a_		571	Acetylcholinesterase {Fruit fly (Drosophila melano	98.6
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.59
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.53
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	98.51
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.49
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.45
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	98.44
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	98.42
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.38
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	98.36
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	98.36
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.33
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	98.29
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	98.28
d1qo7a_		394	Bacterial epoxide hydrolase {Aspergillus niger [Ta	98.26
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	98.25
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.22
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.19
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.18
d2d81a1		318	Polyhydroxybutyrate depolymerase {Penicillium funi	98.16
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	98.15
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	98.12
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	98.12
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.11
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	98.1
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	98.07
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	98.0
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	97.98
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	97.89
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	97.87
d2dsta1		122	Hypothetical protein TTHA1544 {Thermus thermophilu	97.8
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	97.78
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	97.77
d2b61a1		357	Homoserine O-acetyltransferase {Haemophilus influe	97.76
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	97.44
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	97.43
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	97.39
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	97.38
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	97.1
d2vata1		376	Acetyl-CoA:deacetylcephalosporin C acetyltransfera	97.1
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	97.08
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	97.02
d2pl5a1		362	Homoserine O-acetyltransferase {Leptospira interro	96.95
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	96.93
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	96.5
d2hu7a1		313	Acylamino-acid-releasing enzyme, N-terminal donain	96.43
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	95.81
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	95.55
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	95.43
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	95.37
d1ku0a_		388	Lipase L1 {Bacillus stearothermophilus [TaxId: 142	94.49
d1ivya_		452	Human 'protective protein', HPP {Human (Homo sapie	94.43
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	93.27
g1wht.1		409	Serine carboxypeptidase II {Wheat (Triticum vulgar	92.34
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	89.77
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	89.11
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	88.51
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	88.23
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	87.94
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	87.44
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	87.19
d1wpxa1		421	Serine carboxypeptidase II {Baker's yeast (Sacchar	86.3
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	85.63
g1gxs.1		425	Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T	82.65
d1ac5a_		483	Serine carboxypeptidase II {Baker's yeast (Sacchar	80.82

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: DPP6 catalytic domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=3.5e-26  Score=226.26  Aligned_cols=195  Identities=18%  Similarity=0.209  Sum_probs=153.1

Q ss_pred             cCCeEEEEEEEecCCCCCCCCCCceEEEEEcCCCCCCcCcCCcccCCCCCcCCCCchHHHHHHHCCeEEEEcCCCCcCCC
Q 005240          490 KDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGE  569 (706)
Q Consensus       490 ~dg~~i~~~l~~P~~~~~~~~~~~p~vv~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~v~~~~~~~~~g~  569 (706)
                      .||.+|+++|++|+++++++  ++|+||++||||...     ...+.   +.  .....+.|+++||+|+++++||+.++
T Consensus        10 ~dg~~l~~~l~~P~~~~~~~--k~Pviv~~HGGp~~~-----~~~~~---~~--~~~~~~~la~~G~~vv~~d~rGs~~~   77 (258)
T d1xfda2          10 IDDYNLPMQILKPATFTDTT--HYPLLLVVDGTPGSQ-----SVAEK---FE--VSWETVMVSSHGAVVVKCDGRGSGFQ   77 (258)
T ss_dssp             ETTEEECCBEEBCSSCCSSS--CEEEEEECCCCTTCC-----CCCCC---CC--CSHHHHHHHTTCCEEECCCCTTCSSS
T ss_pred             eCCeEEEEEEEECCCcCCCC--ceeEEEEEcCCcccc-----CcCCC---cC--cchHHHHHhcCCcEEEEecccccccc
Confidence            49999999999999998776  499999999986431     11111   11  11345678899999999999988877


Q ss_pred             CCCCCc---hhhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEechHHHHHHHHHHhCCC----ceeEEEeccCCCCCCCC
Q 005240          570 GDKLPN---DRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPH----LFCCGIARSGSYNKTLT  642 (706)
Q Consensus       570 g~~~~~---~~~~~~~~~D~~~~~~~l~~~~~id~~~i~i~G~S~GG~~a~~~~~~~p~----~~~a~v~~~~~~d~~~~  642 (706)
                      |..+..   ..++...+.|+.++++|+++++.+|++||+|+|+|+||++|++++...++    .|++.+..+++..+...
T Consensus        78 g~~~~~~~~~~~g~~~~~d~~~~i~~l~~~~~id~~ri~v~G~S~GG~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (258)
T d1xfda2          78 GTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLY  157 (258)
T ss_dssp             HHHHHHTTTTCTTTHHHHHHHHHHHHHHSSSSEEEEEEEEEEETHHHHHHHHCCCCSSSTTCCCCSEEEEESCCCCTTSS
T ss_pred             chhHhhhhhccchhHHHHHHHHhhhhhcccccccccceeccccCchHHHHHHHHhcCCcccceeeeeeeccccceeeecc
Confidence            754322   23344668899999999999999999999999999999999999877654    68888888876543210


Q ss_pred             ----------------------------------Ccc------------chHHHHHHHHHhCCCcEEEEEeCCCCccCCC
Q 005240          643 ----------------------------------PFG------------FQAERFFDALKGHGALSRLVLLPFEHHVYAA  676 (706)
Q Consensus       643 ----------------------------------~~~------------~~~~~~~~~l~~~~~~~~~~~~~~~~H~~~~  676 (706)
                                                        |..            .+.++++++|++.++++++++||+++|.+..
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~p~Li~hG~~D~~vp~~~s~~~~~~l~~~~~~~~~~~~p~~~H~~~~  237 (258)
T d1xfda2         158 ASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTS  237 (258)
T ss_dssp             BHHHHHHHHCCCSSCCSSTTTTCTHHHHTSCCSCEEEEEEETTCSSSCHHHHHHHHHHHHHTTCCCEEEEETTCCSSCCC
T ss_pred             ccccccccccccccchHHhhccchhhhhhhhhcccccccccCCCCCcCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Confidence                                              000            0334899999999999999999999999987


Q ss_pred             cccHHHHHHHHHHHHHHHhc
Q 005240          677 RENVMHVIWETDRWLQKYCL  696 (706)
Q Consensus       677 ~~~~~~~~~~~~~f~~~~l~  696 (706)
                      .....++++.+++||+++|+
T Consensus       238 ~~~~~~~~~~~~~f~~~~~~  257 (258)
T d1xfda2         238 SSLKQHLYRSIINFFVECFR  257 (258)
T ss_dssp             HHHHHHHHHHHHHHHTTTTC
T ss_pred             CcCHHHHHHHHHHHHHHhhC
Confidence            77778899999999999885

PyMOL of d1xfda2

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}	Back information, alignment and structure

>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}	Back information, alignment and structure

>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}	Back information, alignment and structure

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}	Back information, alignment and structure

>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}	Back information, alignment and structure

>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}	Back information, alignment and structure

>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure

>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]}	Back information, alignment and structure