Citrus Sinensis ID: 005259
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 705 | ||||||
| 255546349 | 717 | Golgin-84, putative [Ricinus communis] g | 0.992 | 0.976 | 0.714 | 0.0 | |
| 297738766 | 712 | unnamed protein product [Vitis vinifera] | 0.992 | 0.983 | 0.701 | 0.0 | |
| 356560629 | 702 | PREDICTED: golgin candidate 1-like [Glyc | 0.977 | 0.981 | 0.674 | 0.0 | |
| 356497595 | 703 | PREDICTED: golgin candidate 1-like [Glyc | 0.981 | 0.984 | 0.680 | 0.0 | |
| 225445112 | 694 | PREDICTED: golgin candidate 1-like [Viti | 0.970 | 0.985 | 0.688 | 0.0 | |
| 449466268 | 709 | PREDICTED: golgin candidate 1-like [Cucu | 0.987 | 0.981 | 0.649 | 0.0 | |
| 334184316 | 710 | golgin candidate 1 [Arabidopsis thaliana | 0.954 | 0.947 | 0.613 | 0.0 | |
| 164708702 | 710 | putative golgin-84-like protein [Arabido | 0.954 | 0.947 | 0.612 | 0.0 | |
| 79557632 | 707 | golgin candidate 1 [Arabidopsis thaliana | 0.950 | 0.947 | 0.610 | 0.0 | |
| 297832160 | 746 | hypothetical protein ARALYDRAFT_899882 [ | 0.946 | 0.894 | 0.590 | 0.0 |
| >gi|255546349|ref|XP_002514234.1| Golgin-84, putative [Ricinus communis] gi|223546690|gb|EEF48188.1| Golgin-84, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 922 bits (2383), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 516/722 (71%), Positives = 582/722 (80%), Gaps = 22/722 (3%)
Query: 1 MASWLKAAEDLFEVVDRRAKLVVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSA 60
MASWLKAAEDLFEVVDRRAKLVV+ELADE SD Q+PASNGQGSQ K + + KAQ+R S
Sbjct: 1 MASWLKAAEDLFEVVDRRAKLVVSELADEHSDSQSPASNGQGSQPKTARGKKKAQKRLSK 60
Query: 61 DESLKINDTAREQANTQASPVDVTPNKDTATLAVEKETITTGKT--QKNGEQQQTNERDA 118
ES K + E TQ S +++ ++D A L+VE +T T K+ Q EQQQ ++DA
Sbjct: 61 IESDKASSAKAEFITTQTSQLEME-SEDRAALSVEHDTAPTSKSILQVVAEQQQDTDKDA 119
Query: 119 PSIPLTEQ-SKDMSKHDADRVEIP--ETFTDLDTATPNGEILNENDSDVHLNHPPSPLPP 175
SI E+ + ++ KHD D VE+P D T+T NGEILNE D L HPPSPLP
Sbjct: 120 SSIKSPERLANEVVKHDTDNVEVPVAAADADAKTSTSNGEILNEKAPDGFLEHPPSPLPA 179
Query: 176 KEMGIVNEDRID---DAGQITKSADADAPLKID---SKIQAVDPPVNSESSLKDADVKVE 229
KE+ ++NED D DAG K +DA+ PL+ D S+ +D P+N E LKDAD+K
Sbjct: 180 KEIEVLNEDHQDHPIDAGVNIKLSDAEVPLETDQERSQSANIDTPINDEIVLKDADLKAN 239
Query: 230 TLSNKRKQQALKADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVCAGLSSRLQEYK 289
+ N++ KAD+ P K QDQL+EAQGLLKT ISTGQSKEARLARVCAGLS+RLQEYK
Sbjct: 240 PVVNQQDHHQQKADNSPKKIQDQLEEAQGLLKTAISTGQSKEARLARVCAGLSTRLQEYK 299
Query: 290 SENAQLEELLVAERELSRSYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLV 349
SENAQLEELL+AERELS+S E RIKQL+Q+LS KSEVT+VESN+ EALAAKNSEIE LV
Sbjct: 300 SENAQLEELLIAERELSKSLETRIKQLQQDLSRSKSEVTRVESNMGEALAAKNSEIEALV 359
Query: 350 SSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQALREELASVERRAEEERAAH 409
+SID LKKQAALSEGNLASLQ NMESIMRNRELTETRM+QALREEL+S ERRAEEERAAH
Sbjct: 360 NSIDVLKKQAALSEGNLASLQANMESIMRNRELTETRMMQALREELSSAERRAEEERAAH 419
Query: 410 NATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQEL 469
NATKMAAMEREVELEHRA EAS ALARIQRIADERTAKA ELEQKVA+LEVECA+L QEL
Sbjct: 420 NATKMAAMEREVELEHRAVEASTALARIQRIADERTAKAAELEQKVALLEVECASLNQEL 479
Query: 470 QDMEARLKRGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMA 529
QDME R++RGQKKSPEEANQ IQMQAWQ+EVERARQGQRDAENKLSS EAE+QKMRVEMA
Sbjct: 480 QDMETRVRRGQKKSPEEANQVIQMQAWQEEVERARQGQRDAENKLSSTEAELQKMRVEMA 539
Query: 530 AMKRDAEHYSREEHMELEKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQEV- 588
AMKRDAEHYSR+EHMELEKRYRELTDLLYYKQTQLE MASEKAAAEFQLEKE+ R+++
Sbjct: 540 AMKRDAEHYSRQEHMELEKRYRELTDLLYYKQTQLEAMASEKAAAEFQLEKEVKRIKKXX 599
Query: 589 ----QSEAE-RSRVSRRSWSSWEEDAEMKSLENNGRPLPLHHRHIAGASVQLQKAAKLLD 643
Q EAE R S SSWEED+EMK+LE PLPLHHRH+A AS+QLQKAAKLLD
Sbjct: 600 IDVKQIEAERSRVSRRASSSSWEEDSEMKALE----PLPLHHRHMAVASMQLQKAAKLLD 655
Query: 644 SGAVRATRFLWRYPIARIILLFYLVFVHLFLMYLLHRLQEQADNFAAREVAESMGLTTSN 703
SGA RATRFLWRYP AR+ILLFYLVFVHLFLMYLLHRLQEQAD+ +AREVA+SMGL T
Sbjct: 656 SGAARATRFLWRYPTARLILLFYLVFVHLFLMYLLHRLQEQADDLSAREVAQSMGLATPT 715
Query: 704 LP 705
LP
Sbjct: 716 LP 717
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738766|emb|CBI28011.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356560629|ref|XP_003548593.1| PREDICTED: golgin candidate 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497595|ref|XP_003517645.1| PREDICTED: golgin candidate 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225445112|ref|XP_002280503.1| PREDICTED: golgin candidate 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449466268|ref|XP_004150848.1| PREDICTED: golgin candidate 1-like [Cucumis sativus] gi|449488127|ref|XP_004157946.1| PREDICTED: golgin candidate 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|334184316|ref|NP_001189556.1| golgin candidate 1 [Arabidopsis thaliana] gi|330251854|gb|AEC06948.1| golgin candidate 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|164708702|gb|ABY67248.1| putative golgin-84-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79557632|ref|NP_179585.3| golgin candidate 1 [Arabidopsis thaliana] gi|85681038|sp|Q8S8N9.2|GOGC1_ARATH RecName: Full=Golgin candidate 1; Short=AtGC1; AltName: Full=Golgin-84 gi|44917433|gb|AAS49041.1| At2g19950 [Arabidopsis thaliana] gi|110738790|dbj|BAF01318.1| hypothetical protein [Arabidopsis thaliana] gi|330251853|gb|AEC06947.1| golgin candidate 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297832160|ref|XP_002883962.1| hypothetical protein ARALYDRAFT_899882 [Arabidopsis lyrata subsp. lyrata] gi|297329802|gb|EFH60221.1| hypothetical protein ARALYDRAFT_899882 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 705 | ||||||
| UNIPROTKB|Q6GNT7 | 722 | golga5 "Golgin subfamily A mem | 0.597 | 0.583 | 0.250 | 2.4e-19 | |
| UNIPROTKB|Q8TBA6 | 731 | GOLGA5 "Golgin subfamily A mem | 0.548 | 0.529 | 0.237 | 8.8e-19 | |
| UNIPROTKB|E2QWJ2 | 731 | GOLGA5 "Uncharacterized protei | 0.817 | 0.787 | 0.208 | 1.1e-18 | |
| UNIPROTKB|F1SD67 | 729 | GOLGA5 "Uncharacterized protei | 0.775 | 0.750 | 0.220 | 8.5e-18 | |
| MGI|MGI:1351475 | 729 | Golga5 "golgi autoantigen, gol | 0.548 | 0.530 | 0.225 | 1.4e-17 | |
| UNIPROTKB|A5D7A5 | 732 | GOLGA5 "GOLGA5 protein" [Bos t | 0.548 | 0.528 | 0.225 | 6.4e-17 | |
| UNIPROTKB|E1C947 | 735 | GOLGA5 "Uncharacterized protei | 0.551 | 0.529 | 0.229 | 1.1e-16 | |
| RGD|1308163 | 728 | Golga5 "golgin A5" [Rattus nor | 0.550 | 0.532 | 0.217 | 2.2e-16 | |
| ZFIN|ZDB-GENE-040426-2749 | 760 | golga5 "golgi autoantigen, gol | 0.798 | 0.740 | 0.229 | 6.3e-15 | |
| ZFIN|ZDB-GENE-030131-9795 | 1336 | rrbp1a "ribosome binding prote | 0.741 | 0.391 | 0.226 | 2.2e-13 |
| UNIPROTKB|Q6GNT7 golga5 "Golgin subfamily A member 5" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Score = 264 (98.0 bits), Expect = 2.4e-19, P = 2.4e-19
Identities = 114/455 (25%), Positives = 192/455 (42%)
Query: 216 NSESSLKDADVKVETLSNKRKQQALKADDPPTKE-QDQLDEAQGLLKTTISTGQSKEARL 274
N ++S D + +A+ A D + +L EA LLK+ T +S +
Sbjct: 261 NGDNSKNDRTARELRAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLKSRTETLESLQIEK 320
Query: 275 ARVCAGLS--SRLQEYKSENAQLEELLVAERELSRSYEARIKQLEQELSVYKSEVTKVES 332
+R+ S S + + Q E L AE L R E+ KQ++ E + S++
Sbjct: 321 SRILQDQSEGSSIHNQALQTMQ-ERLREAESTLIREQES-YKQIQNEFATRLSKIEAERQ 378
Query: 333 NLAEA-LAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQXX 391
NLAEA + A+ +E S D L++Q S+ L SL+ M + TR++Q
Sbjct: 379 NLAEAVILAEKKHMEEKRKS-DDLQQQLKTSKVGLDSLKQEMADYKQKA----TRILQSK 433
Query: 392 XXXXXXXXXXXXXXXX-XHNATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGE 450
H+A+ M ELE E M IQ++ + E
Sbjct: 434 EKLINSLKEGSGIEGLDSHSASTM-------ELEEMRHERDMQREEIQKLMGQIQQLKAE 486
Query: 451 LEQKVAMLEVECATLQQELQDMEARLKRGQKKSPE-EANQAIQMQAWQDEVERARQGQRD 509
L+ E + +++LQD+ + Q+ E EA Q Q +Q E + +
Sbjct: 487 LQDVETQQVSEAESAREQLQDVHEQFATQQRAKQELEAELERQKQEFQYIQEDLYKTKNT 546
Query: 510 AENKLSSLEAEVQKMRVEMAAMKRDAEHYSREEHMELEKRYRELTDLLYYKQTQLETMAS 569
+ ++ E E+QK+R ++ + S ELE R +LT+ L KQT LE +++
Sbjct: 547 LQGRIRDREDEIQKLRNQLTN-----KALSSSSQTELENRLHQLTETLIQKQTMLENLST 601
Query: 570 EKAAAEFQLEKEMNRLQXXXXXXXXXXXXXXXXXXXXXXXXMKS---LENNGRPLPLHHR 626
EK + +QLE+ ++L+ M++ L ++ P
Sbjct: 602 EKNSLVYQLERLEHQLKNVQGSSLNGTSINMSVIESNEGARMRNVPVLFSDSDP------ 655
Query: 627 HIAGASVQLQKAAKLLDSGAVRATRFLWRYPIARI 661
++AG +++KAA +D ++R FL RYPIAR+
Sbjct: 656 NVAGMYGRVRKAATSIDQFSIRLGIFLRRYPIARV 690
|
|
| UNIPROTKB|Q8TBA6 GOLGA5 "Golgin subfamily A member 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QWJ2 GOLGA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SD67 GOLGA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351475 Golga5 "golgi autoantigen, golgin subfamily a, 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7A5 GOLGA5 "GOLGA5 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C947 GOLGA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1308163 Golga5 "golgin A5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2749 golga5 "golgi autoantigen, golgin subfamily a, 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9795 rrbp1a "ribosome binding protein 1 homolog a (dog)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 705 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| pfam09787 | 509 | pfam09787, Golgin_A5, Golgin subfamily A member 5 | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 4e-04 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.002 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.002 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.003 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.003 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.004 | |
| PRK12718 | 510 | PRK12718, flgL, flagellar hook-associated protein | 0.004 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 63.9 bits (156), Expect = 2e-10
Identities = 61/293 (20%), Positives = 122/293 (41%), Gaps = 11/293 (3%)
Query: 301 AERELSR-SYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQA 359
A+ S I++LE+++ + ++ ++E LAE E+E L ++ L+K+
Sbjct: 666 AKTNSSILERRREIEELEEKIEELEEKIAELEKALAELR----KELEELEEELEQLRKEL 721
Query: 360 ALSEGNLASLQMNMESIMRNRELTETRM--IQALREELASVERRAEEERAAHNATKMAAM 417
+++L+ ++ + E E R+ + EL + EE A
Sbjct: 722 EELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAE 781
Query: 418 EREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLK 477
ELE + + L ++ DE A+ L ++ A L +L++ + E RL+
Sbjct: 782 AEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLE 841
Query: 478 RGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDAEH 537
+++ E + + A E+E + + E++L +L E + +A ++ + E
Sbjct: 842 DLEEQIEELSEDIESLAA---EIEELEELIEELESELEALLNERASLEEALALLRSELEE 898
Query: 538 YSREEHMELEKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQEVQS 590
S E ELE + EL L + +L + E +++ RL E S
Sbjct: 899 LSEELR-ELESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYS 950
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|220402 pfam09787, Golgin_A5, Golgin subfamily A member 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|79176 PRK12718, flgL, flagellar hook-associated protein FlgL; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 705 | |||
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 100.0 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 99.98 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 99.5 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 99.16 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.98 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 98.93 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.89 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.87 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.83 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.81 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.74 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.65 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.63 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.62 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.54 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.54 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.54 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.53 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.51 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.5 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.45 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.44 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.43 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.42 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.41 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.39 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.32 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.29 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.27 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.27 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.26 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.23 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.23 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.21 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.2 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.2 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.19 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.18 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.1 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.07 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.04 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.04 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.01 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.0 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.97 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.91 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.88 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.84 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.8 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.79 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.77 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.73 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 97.67 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.66 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.62 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.61 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.52 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.47 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.47 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.41 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.39 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.37 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.34 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.28 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.25 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.22 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.18 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.18 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.15 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.11 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.1 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.04 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.03 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.01 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.0 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.96 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.82 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.81 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.76 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.75 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.71 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.56 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.54 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.54 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.53 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.5 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.48 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.44 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.43 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.35 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.34 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.28 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.27 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.22 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.2 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.08 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.04 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.03 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.99 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.97 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 95.96 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.95 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.89 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.87 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.73 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.7 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.65 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.49 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 95.41 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.28 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.19 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.19 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 95.07 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 94.97 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.96 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 94.92 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.86 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.8 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.78 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 94.69 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.68 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.61 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.54 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 94.51 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 94.4 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 94.39 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.37 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.32 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.32 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.27 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 94.22 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.05 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 93.97 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.89 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.89 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 93.83 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 93.74 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.54 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 93.51 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.46 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 93.41 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.35 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.25 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 93.16 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.13 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 93.09 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 93.0 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 93.0 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 92.95 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 92.93 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 92.89 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.59 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 92.45 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 92.35 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 92.35 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.1 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 91.99 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 91.81 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 91.73 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 91.67 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 91.66 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.53 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 91.41 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 91.18 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.09 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.78 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 90.57 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 90.14 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.96 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.85 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 89.82 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 89.69 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 89.62 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 89.59 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 89.44 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.17 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.96 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 88.7 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 88.68 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.43 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.34 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 88.02 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 88.01 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 87.87 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 87.73 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 87.56 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 87.56 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 87.47 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 87.28 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 87.26 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 86.91 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.81 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 86.36 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.1 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 86.1 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 86.09 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 86.06 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 86.02 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 84.99 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 84.67 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 84.41 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 84.37 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 84.05 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 84.0 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 83.93 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 83.87 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 83.26 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 83.08 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 82.04 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 81.05 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 81.04 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 80.08 |
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-32 Score=308.21 Aligned_cols=373 Identities=26% Similarity=0.338 Sum_probs=253.3
Q ss_pred HHHHHHHHhhhhHHHHHHHHHHHHHHHHHHH--------------HHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005259 271 EARLARVCAGLSSRLQEYKSENAQLEELLVA--------------ERELSRSYEARIKQLEQELSVYKSEVTKVESNLAE 336 (705)
Q Consensus 271 e~qLa~~~~RLrk~~~elks~~aqLEell~e--------------l~e~~~~L~~rl~~LQaeL~~EQ~~l~q~es~~~e 336 (705)
.+++++++++|.+..++++....+|+++-++ +....+.|.+++..|+.++......+......|..
T Consensus 108 ~~e~a~lk~~l~e~~~El~~l~~~l~~l~~~~~~~~~~~~~~~~l~~~~~~sL~ekl~lld~al~~~~~~~~~~~~~fl~ 187 (511)
T PF09787_consen 108 SSELAVLKIRLQELDQELRRLRRQLEELQNEKSRILSDESTVSRLQNGAPRSLQEKLSLLDEALKREDGNAITAVVEFLK 187 (511)
T ss_pred cchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCchhHHHHHHHHHHHhhHHHHHHHHHHHHHhcCccHHHHHHHHHH
Confidence 4499999999999999999999999997111 11124888889999999999999999999999999
Q ss_pred HHHhhhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhhh----------HHHHHHHHHHHHHHHHHHHHHH-H
Q 005259 337 ALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNREL----------TETRMIQALREELASVERRAEE-E 405 (705)
Q Consensus 337 alsak~~eie~Le~rl~~Le~el~~~K~rleele~E~~rl~e~l~~----------~ekeilqSLE~eLkslq~~le~-E 405 (705)
+...++..+..|+.+.. +...+........+++...+.++..... ++..+++++++.|.+|+.+... .
T Consensus 188 rtl~~e~~~~~L~~~~~-A~~~~~~~l~~~~e~~~~l~l~~~~~~~~~~el~~Yk~kA~~iLq~kEklI~~LK~~~~~~~ 266 (511)
T PF09787_consen 188 RTLKKEIERQELEERPK-ALRHYIEYLRESGELQEQLELLKAEGESEEAELQQYKQKAQRILQSKEKLIESLKEGCLEEG 266 (511)
T ss_pred HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhcCHHHHHHHHHhcccccc
Confidence 99999999999999888 4456666666777776666665555544 3788999999999999984333 1
Q ss_pred HHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHcccCCh
Q 005259 406 RAAHNA-TKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSP 484 (705)
Q Consensus 406 ~~aH~a-Tk~ea~~Re~eLEee~~eLseALaelQrkLeEe~aea~eLeqQls~LE~elkqLkQeLq~lE~e~~r~qek~~ 484 (705)
...+.. ...+ .|..+..-+.+-+..++..+.+-+.++.+++.++ ..+.+.+++....+..........
T Consensus 267 ~~~~~~~~el~------~l~~E~~~~~ee~~~l~~Qi~~l~~e~~d~e~~~---~~~~~~~~~~~~~~~~~~~~~~~~-- 335 (511)
T PF09787_consen 267 FDSSTNSIELE------ELKQERDHLQEEIQLLERQIEQLRAELQDLEAQL---EGEQESFREQPQELSQQLEPELTT-- 335 (511)
T ss_pred cccccchhcch------hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HhHHHHHHHHHHHHHHHHHHHhch--
Confidence 221111 1111 1222222223333344444444444443333322 222333333333333333333322
Q ss_pred HHHH---HHHHHHHHHHHHHHHHhhhHHHHhhhhhHHHHHHHHHHHHHHhhhhhcccchhhhHHHHHHHHHHHHHHHHHH
Q 005259 485 EEAN---QAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDAEHYSREEHMELEKRYRELTDLLYYKQ 561 (705)
Q Consensus 485 ~ea~---q~~qL~~Lk~EL~~~rq~qr~l~~kl~s~E~elqkLr~e~~~~k~q~~els~q~~~elE~rl~eLtE~L~eKQ 561 (705)
+++ ....+..+..++.+. ...+..++...+.|+++|+.++..-- +.....++|.|++.||+.|++||
T Consensus 336 -e~e~~l~~~el~~~~ee~~~~---~s~~~~k~~~ke~E~q~lr~~l~~~~------~~s~~~elE~rl~~lt~~Li~KQ 405 (511)
T PF09787_consen 336 -EAELRLYYQELYHYREELSRQ---KSPLQLKLKEKESEIQKLRNQLSARA------SSSSWNELESRLTQLTESLIQKQ 405 (511)
T ss_pred -HHHHHHHHHHHHHHHHHHHHh---cChHHHHHHHHHHHHHHHHHHHHHHh------ccCCcHhHHHHHhhccHHHHHHH
Confidence 111 111233344444322 23357788899999999999996522 12334799999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccC--CCCcccchhhhccccCCCCCCCcCccchhhhHHHHHHH
Q 005259 562 TQLETMASEKAAAEFQLEKEMNRLQEVQSEAERSRVSRRS--WSSWEEDAEMKSLENNGRPLPLHHRHIAGASVQLQKAA 639 (705)
Q Consensus 562 ~qlE~L~~Er~sL~~qLE~~~~~~~~e~~~~~~sr~sr~~--~~~~~~d~~~~~~~~~~~~~p~~~~~~~~~~~~vk~Aa 639 (705)
+++|.|.+||++|.+|||++...+++.. ...+.+... +..+.+|.... +. .+....+|.++++++|++||
T Consensus 406 ~~lE~l~~ek~al~lqlErl~~~l~~~~---~~~~~~~~~~~~~~~~~d~~~r-~~----~~~~~~~~d~~~~~r~~~a~ 477 (511)
T PF09787_consen 406 TQLESLGSEKNALRLQLERLETQLKEEA---SNNRPSSILMKYSNSEDDAESR-VP----LLMKDSPHDIGVARRVKRAA 477 (511)
T ss_pred HHHHHHHhhhhhccccHHHHHHHHHhhc---cCCCCchhhHhhccCCCchhhh-hh----hhccCCCccchHHHHHHHHH
Confidence 9999999999999999999999999721 112222221 22344444443 22 22233445568999999999
Q ss_pred hHhhhhhhhhhHhhhcchhHHHHHHHHHHHHHHH
Q 005259 640 KLLDSGAVRATRFLWRYPIARIILLFYLVFVHLF 673 (705)
Q Consensus 640 ~~lDs~slr~g~fLRRyP~ARl~vlvYmvlLHLW 673 (705)
++||+|+||+|+||||||++|+||||||++||||
T Consensus 478 ~~iD~~~ir~g~fLrr~p~~R~~~i~Y~~~LhlW 511 (511)
T PF09787_consen 478 SVIDSFSIRLGIFLRRYPMARIFVIIYMALLHLW 511 (511)
T ss_pred HHHhHhhHHHHHHHhcCHHHHHHHHHHHHHHcCC
Confidence 9999999999999999999999999999999999
|
They stimulate the formation of Golgi stacks and ribbons, and are involved in intra-Golgi retrograde transport. Two main interactions have been characterised: one with RAB1A that has been activated by GTP-binding and another with isoform CASP of CUTL1 []. |
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 705 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-17 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-13 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 9e-07 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 6e-06 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 1e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 9e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 1e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-05 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 6e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 86.4 bits (214), Expect = 2e-17
Identities = 61/341 (17%), Positives = 139/341 (40%), Gaps = 43/341 (12%)
Query: 248 KEQDQLDEAQGLLKTTISTGQSKEARLARVCAGLSSRLQEYKSENAQLEELLVAERELSR 307
++ QL E + LL+ + A + L+++ QE + ++E + E E S+
Sbjct: 885 QKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQ 944
Query: 308 SYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLA 367
+A K+++Q++ + ++ + E+ + K T I ++ + E
Sbjct: 945 QLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEK----VTADGKIKKMEDDILIMEDQNN 1000
Query: 368 SLQMNMESIMRNRELTETRMIQALREELASVERR-AEEERAAHNATKMAAMEREVELEHR 426
L T+ + L E ++ + AEEE A N TK+ + E
Sbjct: 1001 KL---------------TKERKLLEERVSDLTTNLAEEEEKAKNLTKLKN-----KHESM 1040
Query: 427 AAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSPEE 486
+E + L + ++ E +LE + + L + A LQ ++ +++A+L + ++
Sbjct: 1041 ISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEE----- 1095
Query: 487 ANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDAEHYSREEHMEL 546
++QA +E + +A K+ LE+ + ++ ++ + + +
Sbjct: 1096 -----ELQAALARLEDETSQKNNALKKIRELESHISDLQEDLES--------EKAARNKA 1142
Query: 547 EKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQE 587
EK+ R+L++ L +T+LE A + + +
Sbjct: 1143 EKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDD 1183
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 705 | |||
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 99.88 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.13 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.75 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.62 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.31 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.21 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.8 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.71 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.56 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.56 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.18 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.94 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.9 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.63 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.05 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 94.07 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.06 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.93 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 93.9 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 93.07 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.45 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.27 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 91.82 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 90.95 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 89.68 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 88.69 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 88.08 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 88.07 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 87.84 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 87.18 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 85.38 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 84.64 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 83.52 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 83.47 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 83.41 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 83.26 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 82.98 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 82.97 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 82.89 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 81.58 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 81.58 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 81.22 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 80.63 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 80.56 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 80.52 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 80.07 |
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.88 E-value=2.4e-21 Score=187.04 Aligned_cols=159 Identities=23% Similarity=0.227 Sum_probs=139.7
Q ss_pred hcCCCCchhhhhHHHHHHHHHhhhhhcchHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHH
Q 005259 241 KADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVCAGLSSRLQEYKSENAQLEELLVAERELSRSYEARIKQLEQEL 320 (705)
Q Consensus 241 ~~~ek~~~lqkQLee~n~~LrsE~eal~~ke~qLa~~~~RLrk~~~elks~~aqLEell~el~e~~~~L~~rl~~LQaeL 320 (705)
+.|||+++|++||+|+|.+||+|+|+ ++||+|..+++.+..+++|..+++++++++.|+.....|+.++
T Consensus 3 ~~neKi~~LekQL~E~n~kLk~EsE~-----------~~rlkK~~tEl~k~~~~~E~~~rELq~~~~~L~~~k~~Leke~ 71 (168)
T 3o0z_A 3 LANEKLSQLQKQLEEANDLLRTESDT-----------AVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDY 71 (168)
T ss_dssp -------CTHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred chhHHHHHHHHHHHHHHHHHHHhHHH-----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 36899999999999999999999996 9999999999999999999999999999999999888888888
Q ss_pred HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhhhHHHHHHHHHH----HHHH
Q 005259 321 SVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQALR----EELA 396 (705)
Q Consensus 321 ~~EQ~~l~q~es~~~ealsak~~eie~Le~rl~~Le~el~~~K~rleele~E~~rl~e~l~~~ekeilqSLE----~eLk 396 (705)
...|..+.+.++ ... -+.+.+.+|++++.+|+.++.+++.++.+++.+++.|++++++++|+ +++++ ++|+
T Consensus 72 ~~LQa~L~qEr~-~r~---q~se~~~elq~ri~~L~~El~~~k~~~~k~~~e~r~L~Ekl~~lEKe-~a~~eid~~~eLK 146 (168)
T 3o0z_A 72 YQLQAILEAERR-DRG---HDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKE-KNNLEIDLNYKLK 146 (168)
T ss_dssp HHHHHHHHHHHH-HHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHH-HHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhhhHHHHHHHH
Confidence 888888888876 222 36778889999999999999999999999999999999999999999 99999 8899
Q ss_pred HHHHHHHHHHHHHHHHHHH
Q 005259 397 SVERRAEEERAAHNATKMA 415 (705)
Q Consensus 397 slq~~le~E~~aH~aTk~e 415 (705)
++|++|++|..+|++|++.
T Consensus 147 alQ~~~eqE~~~H~~Tkar 165 (168)
T 3o0z_A 147 SLQQRLEQEVNEHKVTKAR 165 (168)
T ss_dssp HHHHHHHHHHHHHCC----
T ss_pred HHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999773
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00