Citrus Sinensis ID: 005267

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-----
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
cccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccHHcccccccEEEccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEEEEccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccEEccccccccccccccEEEcccccccccccHHHHHHHHHcccccccccEEEccccccccEEEEEEEEEEccHHHHHHHHccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEEEEEccccccccccccc
cccccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEEcccccccccccHHHHHHHHcccEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEccccccccccccccccccEEEEcccccccccccccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccEEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccccHHHccccccEEEEccccccEEcccHHHHHcccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEc
mftnltqlsslnladnqligsipssIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNIslsvstkltvnssfpnlwalglsacnisefpdilktqhqldwldlsenqirgripswmwdigvHTLFRLDLSRNfltsidhlpwknlefLTLDSnllqgslpnlpphmvqlsisnnsltgeipssfcnlsSIQYLYLsnnslsgqipqclgnstlenldlgmnnfqgtipqtyakgcnltylrlsgnhlegplppslsncvnlqvldvgnnnlsgpipeclgnstrlsfldvrnnnlsgpipeclgnstslsfldvgnnslsgpipeylgnstLEVLDMRMnkfsgslpqtfgkSCVLVSLKlngnrlegplppslvncrhlevidvgnnqinetfphwldvlpeLQVLtlrsnrfcgpigdtktrvpfpklriidlsynqftgvlpiwyLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATidlssnrfQGEISEVLGKLNSlkslnishnnltggipsslrnltelesldlssnklagriptqlASLNYLSVLNlsnnqlegpipggpqfntfgidsysgnvglcgfplskicrideapepttptgfiegddasswFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRfcgpigdtktrvpfPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERqqsrklrrvirrgragrrsllvhl
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQlaslnylsvlnlsnnqlEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSrklrrvirrgragrrSLLVHL
**********LNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGI*******************LAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIER************************
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFK**************MRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFP****************************FDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGR**L****
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
*FTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKIC********************SSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVI*******RS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query705 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 yes no 0.951 0.792 0.358 1e-105
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.805 0.453 0.338 1e-70
C0LGQ5 1249 LRR receptor-like serine/ no no 0.832 0.469 0.336 2e-68
Q8VZG8 1045 Probable LRR receptor-lik no no 0.720 0.486 0.332 7e-63
Q9FL28 1173 LRR receptor-like serine/ no no 0.809 0.486 0.338 1e-62
Q9LP24 1120 Probable leucine-rich rep no no 0.843 0.531 0.302 1e-61
Q9LYN8 1192 Leucine-rich repeat recep no no 0.913 0.540 0.312 1e-60
O82318 960 Probably inactive leucine no no 0.802 0.589 0.320 5e-60
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.856 0.500 0.326 2e-59
Q8L899 1207 Systemin receptor SR160 O N/A no 0.856 0.500 0.324 6e-58
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  383 bits (983), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 269/750 (35%), Positives = 394/750 (52%), Gaps = 79/750 (10%)

Query: 5   LTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSN 64
           L  L  L+L +  L G IPSS+  L +LT V+L FN F G +       L  L++LIL+N
Sbjct: 109 LQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPA-SIGNLNQLRHLILAN 167

Query: 65  ISLSVSTKLTVNSSFPNLWALG----LSACNISEFPDILKTQHQLDWLDLSENQIRGRIP 120
             L+      + SS  NL  L      S   + + PD +    QL  L L+ N + G IP
Sbjct: 168 NVLTGE----IPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIP 223

Query: 121 SWMWDIGVHTLFRLDLSRNFL-----TSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQ 175
           S + ++    L  L L+ N L      SI +L    L  ++ ++N L G++P    ++ +
Sbjct: 224 SSLGNLS--NLVHLVLTHNQLVGEVPASIGNL--IELRVMSFENNSLSGNIPISFANLTK 279

Query: 176 LSI---SNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCL----------------- 215
           LSI   S+N+ T   P       +++Y  +S NS SG  P+ L                 
Sbjct: 280 LSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFT 339

Query: 216 ---------GNSTLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCV 266
                     ++ L++L LG N   G IP++ ++  NL  L +S N+  G +PP++S  V
Sbjct: 340 GPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLV 399

Query: 267 NLQVLDVGNNNLSGPIPECLG--NSTRLSF------------------LDVRNNNLSGPI 306
           NL  LD+  NNL G +P CL   N+  LS                   LD+ +N+  GPI
Sbjct: 400 NLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPI 459

Query: 307 PECLGNSTSLSFLDVGNNSLSGPIPEYLGN--STLEVLDMRMNKFSGSLPQTFGKSCVLV 364
           P  +   +SL FLD+ NN  SG IP  + N   +++ L++  N FSG+LP  F K+  LV
Sbjct: 460 PYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELV 519

Query: 365 SLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGP 424
           SL ++ N+LEG  P SL+NC+ LE+++V +N+I + FP WL+ LP L VL LRSN+F GP
Sbjct: 520 SLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGP 579

Query: 425 IGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAM--MRRDDNSIEVNYMRSLNYSY 482
           +      + F  LRIID+S+N F+G LP +Y + +K M  +  + +     + R  + SY
Sbjct: 580 LYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYAD-SY 638

Query: 483 YESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGI 542
           Y  + +  KG D+  ERI   F  ID S N+  G I E LG L  L+ LN+S N  T  I
Sbjct: 639 YHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVI 698

Query: 543 PSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGID 602
           P  L NLT+LE+LD+S NKL+G+IP  LA+L++LS +N S+N L+GP+P G QF      
Sbjct: 699 PRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCS 758

Query: 603 SYSGNVGLCGFPLSKICRIDEAPEPTT--PTGFIEGDDASSWFDWKLAMLGYASGVVIGL 660
           S+  N GL G  L  ICR   A  PT+  P    E ++  + F+W  A + Y  GV+ GL
Sbjct: 759 SFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE--NMFNWVAAAIAYGPGVLCGL 814

Query: 661 SIGYMAFVTGRPQWFVRMIERQQSRKLRRV 690
            IG+  + +   +WF     R+Q + L  V
Sbjct: 815 VIGHF-YTSHNHEWFTEKFGRKQHKALTSV 843
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query705
225462116 1001 PREDICTED: receptor-like protein 12-like 0.941 0.663 0.420 1e-137
296082718745 unnamed protein product [Vitis vinifera] 0.882 0.834 0.451 1e-134
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.946 0.677 0.448 1e-130
3894387 944 Hcr2-0B [Solanum lycopersicum] 0.963 0.719 0.437 1e-129
1184075 1112 Cf-2.1 [Solanum pimpinellifolium] gi|603 0.970 0.615 0.417 1e-129
359493539 1001 PREDICTED: receptor-like protein 12-like 0.943 0.664 0.45 1e-128
3894391799 Hcr2-5B [Solanum lycopersicum var. ceras 0.965 0.852 0.418 1e-128
359493544 978 PREDICTED: receptor-like protein 12-like 0.958 0.691 0.438 1e-128
356551688 1135 PREDICTED: receptor-like protein 12-like 0.876 0.544 0.424 1e-127
225459979 979 PREDICTED: receptor-like protein 12-like 0.950 0.684 0.438 1e-127
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  497 bits (1279), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 329/783 (42%), Positives = 443/783 (56%), Gaps = 119/783 (15%)

Query: 11  LNLADNQLIGSIPSSIFELVNLTFVSLSFN----------NFSGSVELYDFAK------- 53
           ++L+  QL G  P    +L NL  + L  N          N S S+ L D +        
Sbjct: 217 MDLSSCQLYGRFPDDDLQLPNLKVLKLKGNHDLSGNFPKFNESNSMLLLDLSSTNFSGEL 276

Query: 54  ------LKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNIS-EFPDILKTQHQLD 106
                 LK+L+ L LS+   S     ++  S  +L +L LS CN S   P +L    Q+ 
Sbjct: 277 PSSIGILKSLESLDLSSTKFSGELPSSI-GSLKSLESLDLSHCNFSGSIPSVLGNLTQIT 335

Query: 107 WLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRN-----FLTSIDHLPWKNLEFLTLDSNL 161
            LDLS NQ  G I +    I    L  LDLS N     F+ S+D+L    L FL L +N 
Sbjct: 336 HLDLSRNQFDGEISNVFNKI--RKLIVLDLSSNSFRGQFIASLDNL--TELSFLDLSNNN 391

Query: 162 LQGSLPNLPPHMVQLS---ISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGNS 218
           L+G +P+    +  LS   +SNN L G IPS   +L S+  L LS+N L+G I +   + 
Sbjct: 392 LEGIIPSHVKELSSLSDIHLSNNLLNGTIPSWLFSLPSLIRLDLSHNKLNGHIDE-FQSP 450

Query: 219 TLENLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSL---------------- 262
           +LE++DL  N   G +P +  +  NLTYL+LS N+L G +   +                
Sbjct: 451 SLESIDLSSNELDGPVPSSIFELVNLTYLQLSSNNLGGIVETDMFMNLENLVYLDLSYNI 510

Query: 263 --------SNCV-------------------------NLQVLDVGNNNLSGPIPECLGNS 289
                   SNC                           L+ LD+ NN + G +P+   N 
Sbjct: 511 LTLSNYSHSNCALPFLETLLLSSCNISEFPRFLCSQEVLEFLDLSNNKIYGQLPKWAWNM 570

Query: 290 ---------------TRLS--------FLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSL 326
                          TR          FLD+ +N L GP+P  +   + +S LD  NN+L
Sbjct: 571 GTETLSYFNLSQNLLTRFERFPWKNMLFLDLHSNLLQGPLPSLICEMSYISVLDFSNNNL 630

Query: 327 SGPIPEYLGN--STLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNC 384
           SG IP+ LGN   +L VLD+RMN+  G++P+TF K   + +L  NGN+LEGPLP SL+NC
Sbjct: 631 SGLIPQCLGNFSESLSVLDLRMNQLHGNIPETFSKGNFIRNLGFNGNQLEGPLPRSLINC 690

Query: 385 RHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSY 444
           R L+V+D+GNN+IN+TFP+WL+ LPELQVL LRSNRF G I  +  + PFPKLRI+DLS 
Sbjct: 691 RRLQVLDLGNNRINDTFPYWLETLPELQVLILRSNRFHGHISGSNFQFPFPKLRIMDLSR 750

Query: 445 NQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTF 504
           N F+G LP  YL  FKAMM   ++ +++ YM    Y Y +SI  T+KG D +   IL+TF
Sbjct: 751 NDFSGSLPEMYLKNFKAMMNVTEDKMKLKYMGE--YYYRDSIMGTIKGFDFEF-VILSTF 807

Query: 505 ATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAG 564
            TIDLSSNRFQGEI + +G L+SL+ LN+SHNNLTG IPSSL NL  LESLDLSSNKL+G
Sbjct: 808 TTIDLSSNRFQGEILDFIGSLSSLRELNLSHNNLTGHIPSSLGNLMVLESLDLSSNKLSG 867

Query: 565 RIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEA 624
           RIP +L SL +L VLNLS N L G IP G QF+TF  +SYSGN+GLCG PLSK C +DEA
Sbjct: 868 RIPRELTSLTFLEVLNLSKNHLTGVIPRGNQFDTFANNSYSGNIGLCGLPLSKKCVVDEA 927

Query: 625 PEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQS 684
           P+P       E  ++ + FDWK+ ++GY  G+V+GL +G + F+T +P+WFV MIE  + 
Sbjct: 928 PQPPKE----EEVESDTGFDWKVILMGYGCGLVVGLFMGCLVFLTRKPKWFVTMIEGDRH 983

Query: 685 RKL 687
           +K+
Sbjct: 984 KKV 986

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296082718|emb|CBI21723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|3894387|gb|AAC78593.1| Hcr2-0B [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|1184075|gb|AAC15779.1| Cf-2.1 [Solanum pimpinellifolium] gi|60327192|gb|AAX19019.1| Cf-2.1 [Solanum pimpinellifolium] gi|1587673|prf||2207203A Cf-2 gene Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|3894391|gb|AAC78595.1| Hcr2-5B [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356551688|ref|XP_003544206.1| PREDICTED: receptor-like protein 12-like [Glycine max] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query705
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.940 0.782 0.358 2.5e-97
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.917 0.797 0.358 1.1e-94
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.937 0.843 0.348 2.5e-88
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.940 0.667 0.346 3.7e-87
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.919 0.635 0.358 9.9e-87
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.926 0.755 0.359 2.6e-86
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.947 0.776 0.335 1.4e-85
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.801 0.794 0.387 2.4e-85
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.940 0.794 0.344 4.9e-85
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.934 0.815 0.344 2.1e-84
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 967 (345.5 bits), Expect = 2.5e-97, P = 2.5e-97
 Identities = 250/698 (35%), Positives = 358/698 (51%)

Query:     4 NLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSV--ELYDFAKLKNLKYLI 61
             NL QL  L LA+N L G IPSS+  L  L  + L  N   G +   + D  +L+NL  L 
Sbjct:   156 NLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLS-LA 214

Query:    62 LSNISLSVSTKLTVNSSFPNLWALGLSACN-ISEFPDILKTQHQLDWLDLSENQIRGRIP 120
              +N+   + + L    +  NL  L L+    + E P  +    +L  +    N + G IP
Sbjct:   215 SNNLIGEIPSSL---GNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIP 271

Query:   121 SWMWDIGVHTLFRLDLSRNFLTSI--DHLPWKNLEFLTLDSNLLQGSLPN---LPPHMVQ 175
                 ++   ++F L  S NF ++   D   + NLE+  +  N   G  P    L P +  
Sbjct:   272 ISFANLTKLSIFVLS-SNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLES 330

Query:   176 LSISNNSLTGEIPSSFCNLSS---IQYLYLSNNSLSGQIPQCLGNS-TLENLDLGMNNFQ 231
             + +  N  TG  P  F N SS   +Q L L  N L G IP+ +     LE LD+  NNF 
Sbjct:   331 IYLQENQFTG--PIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFT 388

Query:   232 GTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTR 291
             G IP T +K  NL +L LS N+LEG +P  L   +N  VL   +N+ S            
Sbjct:   389 GAIPPTISKLVNLLHLDLSKNNLEGEVPACLWR-LNTMVLS--HNSFSS-FENTSQEEAL 444

Query:   292 LSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGN--STLEVLDMRMNKF 349
             +  LD+ +N+  GPIP  +   +SL FLD+ NN  SG IP  + N   +++ L++  N F
Sbjct:   445 IEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF 504

Query:   350 SGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLP 409
             SG+LP  F K+  LVSL ++ N+LEG  P SL+NC+ LE+++V +N+I + FP WL+ LP
Sbjct:   505 SGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLP 564

Query:   410 ELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAM--MRRDD 467
              L VL LRSN+F GP+      + F  LRIID+S+N F+G LP +Y + +K M  +  + 
Sbjct:   565 SLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEM 624

Query:   468 NSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNS 527
             +     + R  + SYY  + +  KG D+  ERI   F  ID S N+  G I E LG L  
Sbjct:   625 DQYMTEFWRYAD-SYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKE 683

Query:   528 LKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQXXXXXXXXXXXXXXXXXE 587
             L+ LN+S N  T  IP  L NLT+LE+LD+S NKL+G+IP                   +
Sbjct:   684 LRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQ 743

Query:   588 GPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTT--PTGFIEGDDASSWFDW 645
             GP+P G QF      S+  N GL G  L  ICR   A  PT+  P    E ++  + F+W
Sbjct:   744 GPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE--NMFNW 799

Query:   646 KLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQ 683
               A + Y  GV+ GL IG+  + +   +WF     R+Q
Sbjct:   800 VAAAIAYGPGVLCGLVIGHF-YTSHNHEWFTEKFGRKQ 836
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query705
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-78
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-52
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-46
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-27
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  269 bits (688), Expect = 3e-78
 Identities = 194/615 (31%), Positives = 296/615 (48%), Gaps = 76/615 (12%)

Query: 3   TNLTQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLIL 62
            N +++ S++L+   + G I S+IF L  +  ++LS N  SG +    F    +L+YL L
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNL 125

Query: 63  SNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSW 122
           SN + + S       S PNL  L                       DLS N + G IP+ 
Sbjct: 126 SNNNFTGSIP---RGSIPNLETL-----------------------DLSNNMLSGEIPN- 158

Query: 123 MWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMVQL---SIS 179
             DIG                     + +L+ L L  N+L G +PN   ++  L   +++
Sbjct: 159 --DIGS--------------------FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLA 196

Query: 180 NNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGN-STLENLDLGMNNFQGTIPQTY 238
           +N L G+IP     + S++++YL  N+LSG+IP  +G  ++L +LDL  NN  G IP + 
Sbjct: 197 SNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL 256

Query: 239 AKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVR 298
               NL YL L  N L GP+PPS+ +   L  LD+ +N+LSG IPE +     L  L + 
Sbjct: 257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLF 316

Query: 299 NNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLG-NSTLEVLDMRMNKFSGSLPQTF 357
           +NN +G IP  L +   L  L + +N  SG IP+ LG ++ L VLD+  N  +G +P+  
Sbjct: 317 SNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGL 376

Query: 358 GKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLR 417
             S  L  L L  N LEG +P SL  CR L  + + +N  +   P     LP +  L + 
Sbjct: 377 CSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDIS 436

Query: 418 SNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRS 477
           +N   G I   K  +P   L+++ L+ N+F G LP               +S     + +
Sbjct: 437 NNNLQGRINSRKWDMP--SLQMLSLARNKFFGGLP---------------DSFGSKRLEN 479

Query: 478 LNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNN 537
           L+ S  +       G   +    L+    + LS N+  GEI + L     L SL++SHN 
Sbjct: 480 LDLSRNQ-----FSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQ 534

Query: 538 LTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFN 597
           L+G IP+S   +  L  LDLS N+L+G IP  L ++  L  +N+S+N L G +P    F 
Sbjct: 535 LSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFL 594

Query: 598 TFGIDSYSGNVGLCG 612
                + +GN+ LCG
Sbjct: 595 AINASAVAGNIDLCG 609

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 705
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
PLN03150623 hypothetical protein; Provisional 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PLN03150623 hypothetical protein; Provisional 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.91
PRK15386426 type III secretion protein GogB; Provisional 97.9
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.75
KOG4341483 consensus F-box protein containing LRR [General fu 97.65
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG4341483 consensus F-box protein containing LRR [General fu 97.58
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.5
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.47
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.6
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.34
KOG4308478 consensus LRR-containing protein [Function unknown 91.79
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.61
smart0037026 LRR Leucine-rich repeats, outliers. 91.61
KOG4308478 consensus LRR-containing protein [Function unknown 91.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.15
smart0037026 LRR Leucine-rich repeats, outliers. 90.15
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.64
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.34
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-66  Score=613.04  Aligned_cols=540  Identities=33%  Similarity=0.512  Sum_probs=456.6

Q ss_pred             CCCCEEECCCCCCCccCCccCcCCCCCCEEeCCCCCCccccCcccccCCCCCCEEEccCCCCcceecccCccCCCCCCEE
Q 005267            6 TQLSSLNLADNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWAL   85 (705)
Q Consensus         6 ~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~L   85 (705)
                      .+++.|||++|.+++.++..|..+++|++|+|++|.++|.+|..+|..+++|++|+|++|  ...+.+|. ..+++|++|
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n--~l~~~~p~-~~l~~L~~L  145 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNN--NFTGSIPR-GSIPNLETL  145 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCC--ccccccCc-cccCCCCEE
Confidence            467788888888887777788888888888888888887888777678888888888888  44444443 256778888


Q ss_pred             ecCCCCC-CCCChhccCCCCCCEEEccCCcCCCCCchHHHhcCCCCccEEECCCCCCCCCCCCCCCCCcEEEccCCcCCC
Q 005267           86 GLSACNI-SEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQG  164 (705)
Q Consensus        86 ~L~~n~l-~~lp~~l~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~~~L~~L~ls~n~l~~~~~~~~~~L~~L~l~~n~~~~  164 (705)
                      ++++|.+ +.+|..+..+++|++|++++|.+.+.+|..+.++  ++|++|++++|.+.+..+..+.              
T Consensus       146 ~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l--~~L~~L~L~~n~l~~~~p~~l~--------------  209 (968)
T PLN00113        146 DLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL--TSLEFLTLASNQLVGQIPRELG--------------  209 (968)
T ss_pred             ECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhC--cCCCeeeccCCCCcCcCChHHc--------------
Confidence            8888877 5677777778888888888887777777777766  6777777776666554441111              


Q ss_pred             CCCCCCCCCcEEEcccCCCCCCCcccccCCCCCcEEEcccCcCCccCCcccCC-CCCCEEEcCCCcCCcccchhccCCCC
Q 005267          165 SLPNLPPHMVQLSISNNSLTGEIPSSFCNLSSIQYLYLSNNSLSGQIPQCLGN-STLENLDLGMNNFQGTIPQTYAKGCN  243 (705)
Q Consensus       165 ~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~ls~n~~~~~~~~~~~~-~~L~~L~L~~n~l~~~~~~~~~~l~~  243 (705)
                          .+++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|..++. ++|++|++++|.+.+..|..+..+++
T Consensus       210 ----~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  285 (968)
T PLN00113        210 ----QMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQK  285 (968)
T ss_pred             ----CcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccC
Confidence                1356666677777777777777888888888888888888777777766 78888888888888888888888888


Q ss_pred             CCEEECcCCcCcCCCCccCCCCCcCcEEEccCCcCCCCCCccccCCCCCcEEEccCccccCCCCccccCCCCCCeEeccC
Q 005267          244 LTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGN  323 (705)
Q Consensus       244 L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~  323 (705)
                      |++|++++|.+.+.+|..+.++++|++|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++
T Consensus       286 L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~  365 (968)
T PLN00113        286 LISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLST  365 (968)
T ss_pred             cCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCC
Confidence            88888888888888888888888899999988888888888888888899999999988888888888888999999999


Q ss_pred             cccccccCccccc-CcccEEEcCCCcccccccccccCCCCccEEEccCCcCCCCCCccccCCCCCcEEEccCCcCCCCcc
Q 005267          324 NSLSGPIPEYLGN-STLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFP  402 (705)
Q Consensus       324 n~l~~~~~~~~~~-~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~  402 (705)
                      |.+.+.+|..+.. .+|+.|++++|.+.+.+|..+..+++|+.|++++|.+++.+|..+..++.|+.|++++|++++.++
T Consensus       366 n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~  445 (968)
T PLN00113        366 NNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN  445 (968)
T ss_pred             CeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccC
Confidence            9888888876654 388999999999998999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhCCCCCCEEEccCCcCcCCCCCCCCCCCCCCccEEEccCCcCcccCChHhhhhccccccccCCcccccccccccccc
Q 005267          403 HWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSY  482 (705)
Q Consensus       403 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  482 (705)
                      ..+..+++|+.|++++|++.+..|...   ..++|+.||+++|++++.+|..+.                          
T Consensus       446 ~~~~~l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~~~--------------------------  496 (968)
T PLN00113        446 SRKWDMPSLQMLSLARNKFFGGLPDSF---GSKRLENLDLSRNQFSGAVPRKLG--------------------------  496 (968)
T ss_pred             hhhccCCCCcEEECcCceeeeecCccc---ccccceEEECcCCccCCccChhhh--------------------------
Confidence            888899999999999999998887654   357899999999999988875431                          


Q ss_pred             eeeEEEEecCchHHHhhhhccccEEEccCCccccccchhhhcCCCCCEEecCCCcCCccCCccccCCCCCCeeeCCCCcC
Q 005267          483 YESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKL  562 (705)
Q Consensus       483 ~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l  562 (705)
                                       .+++|+.|+|++|++.+.+|..++++++|++|+|++|.+++.+|..++.+++|+.|||++|++
T Consensus       497 -----------------~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l  559 (968)
T PLN00113        497 -----------------SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQL  559 (968)
T ss_pred             -----------------hhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcc
Confidence                             167899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCcccccCCCCCCeEecccCcccccCCCCCCCCCCCCCcccCCCCCCCCC
Q 005267          563 AGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFP  614 (705)
Q Consensus       563 ~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lcg~~  614 (705)
                      ++.+|..+..+++|++|++++|+++|.+|..++|.++...++.||+.+||.+
T Consensus       560 ~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        560 SGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query705
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-48
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-26
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-48
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-26
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 3e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 5e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 5e-05
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 3e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 5e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 5e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-04
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 7e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  191 bits (485), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 207/672 (30%), Positives = 303/672 (45%), Gaps = 76/672 (11%)
Query: 2   FTNLTQLSSLNLADNQLIGSIPS--SIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKY 59
           F     L+SL+L+ N L G + +  S+     L F+++S N      ++    KL +L+ 
Sbjct: 96  FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEV 155
Query: 60  LILSNISLSVSTKL--TVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRG 117
           L LS  S+S +  +   ++     L  L +S   IS   D+ +  + L++LD+S N    
Sbjct: 156 LDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVN-LEFLDVSSNNFST 214
Query: 118 RIPSWMWDIGVHTLFRLDLSRNFLT---SIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMV 174
            IP ++ D     L  LD+S N L+   S        L+ L + SN   G +P LP   +
Sbjct: 215 GIP-FLGD--CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSL 271
Query: 175 Q-LSISNNSLTGEIP---SSFCNLSSIQYLYLSNNSLSGQIPQCLGNSTLENLDLGM-NN 229
           Q LS++ N  TGEIP   S  C+  ++  L LS N   G +P   G+ +L        NN
Sbjct: 272 QYLSLAENKFTGEIPDFLSGACD--TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN 329
Query: 230 FQGTIP-QTYAKGCNLTYLRLSGNHLEGPLPPSLSN-CVNLQVLDVGNNNLSGPI-PE-C 285
           F G +P  T  K   L  L LS N   G LP SL+N   +L  LD+ +NN SGPI P  C
Sbjct: 330 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC 389
Query: 286 LGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGN-STLEVLDM 344
                 L  L ++NN  +G IP  L N + L  L +  N LSG IP  LG+ S L  L +
Sbjct: 390 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 449
Query: 345 RMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHW 404
            +N   G +PQ       L +L L+ N L G +P  L NC +L  I + NN++    P W
Sbjct: 450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW 509
Query: 405 LDVLPELQVLTLRSNRFCGPI----GDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFK 460
           +  L  L +L L +N F G I    GD ++ +       +DL+ N F G +P        
Sbjct: 510 IGRLENLAILKLSNNSFSGNIPAELGDCRSLI------WLDLNTNLFNGTIP-------- 555
Query: 461 AMMRRDDNSIEVNYMRSLNYSYYESISLTMK----GNDIQMERI-------LTTFATIDL 509
           A M +    I  N++    Y Y ++  +  +    GN ++ + I       L+T    ++
Sbjct: 556 AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNI 615
Query: 510 SSNRFQGEISEVLGKLNSLKSLNISHNNL------------------------TGGIPSS 545
           +S  + G  S       S+  L++S+N L                        +G IP  
Sbjct: 616 TSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDE 675
Query: 546 LRNLTELESLDLSSNKLAGRIPTQXXXXXXXXXXXXXXXXXEGPIPGGPQFNTFGIDSYS 605
           + +L  L  LDLSSNKL GRIP                    GPIP   QF TF    + 
Sbjct: 676 VGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFL 735
Query: 606 GNVGLCGFPLSK 617
            N GLCG+PL +
Sbjct: 736 NNPGLCGYPLPR 747
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query705
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-165
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-119
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-119
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-79
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-100
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-71
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-70
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-76
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-72
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-42
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-56
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-41
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-50
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-43
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-43
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-43
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-39
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-38
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-33
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-38
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-35
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-31
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-29
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-29
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-24
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  493 bits (1271), Expect = e-165
 Identities = 184/637 (28%), Positives = 284/637 (44%), Gaps = 53/637 (8%)

Query: 2   FTNLTQLSSLNLADNQLIGSIPSSIFE---LVNLTFVSLSFNNFSGSVELYDFAKLKNLK 58
              L  L  L+L+ N + G+             L  +++S N  SG V++   ++  NL+
Sbjct: 147 GLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV---SRCVNLE 203

Query: 59  YLILSNISLSVSTKLTVNSSFPNLWALGLSACNIS-EFPDILKTQHQLDWLDLSENQIRG 117
           +L +S+ + S    +        L  L +S   +S +F   + T  +L  L++S NQ  G
Sbjct: 204 FLDVSSNNFSTG--IPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG 261

Query: 118 RIPSWMWDIGVHTLFRLDLSRNFLT-----SIDHLPWKNLEFLTLDSNLLQGSLP----N 168
            IP         +L  L L+ N  T      +       L  L L  N   G++P    +
Sbjct: 262 PIPPLPL----KSLQYLSLAENKFTGEIPDFLSGA-CDTLTGLDLSGNHFYGAVPPFFGS 316

Query: 169 LPPHMVQLSISNNSLTGEIP-SSFCNLSSIQYLYLSNNSLSGQIPQCLGN--STLENLDL 225
               +  L++S+N+ +GE+P  +   +  ++ L LS N  SG++P+ L N  ++L  LDL
Sbjct: 317 CS-LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 375

Query: 226 GMNNFQGTIPQTYAKGC--NLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIP 283
             NNF G I     +     L  L L  N   G +PP+LSNC  L  L +  N LSG IP
Sbjct: 376 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP 435

Query: 284 ECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNST-LEVL 342
             LG+ ++L  L +  N L G IP+ L    +L  L +  N L+G IP  L N T L  +
Sbjct: 436 SSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWI 495

Query: 343 DMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFP 402
            +  N+ +G +P+  G+   L  LKL+ N   G +P  L +CR L  +D+  N  N T P
Sbjct: 496 SLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP 555

Query: 403 HWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAM 462
             +          + +N   G            K      +  +F G+            
Sbjct: 556 AAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR----- 606

Query: 463 MRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVL 522
                       + + N     S      G+         +   +D+S N   G I + +
Sbjct: 607 ------------LSTRNPCNITSRVYG--GHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 652

Query: 523 GKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLS 582
           G +  L  LN+ HN+++G IP  + +L  L  LDLSSNKL GRIP  +++L  L+ ++LS
Sbjct: 653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 712

Query: 583 NNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKIC 619
           NN L GPIP   QF TF    +  N GLCG+PL +  
Sbjct: 713 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCD 749
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query705
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.93
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.47
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=9.3e-77  Score=683.98  Aligned_cols=610  Identities=34%  Similarity=0.493  Sum_probs=509.3

Q ss_pred             CcCCCCCCEEECCCCCCCccCCc--cCcCCCCCCEEeCCCCCCccccCcccccCCCCCCEEEccCCCCcceecccCc---
Q 005267            2 FTNLTQLSSLNLADNQLIGSIPS--SIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVN---   76 (705)
Q Consensus         2 ~~~l~~L~~L~Ls~n~~~~~~~~--~l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~---   76 (705)
                      |+++++|++|||++|.+.+.+|.  .++++++|++|+|++|.+.+.+|..++.++++|++|++++|  ...+..+..   
T Consensus        96 ~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n--~l~~~~~~~~~~  173 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSAN--SISGANVVGWVL  173 (768)
T ss_dssp             CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSS--CCEEETHHHHHH
T ss_pred             hccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCC--ccCCcCChhhhh
Confidence            56677888888888888777777  77888888888888888877777666677888888888888  344444432   


Q ss_pred             c-CCCCCCEEecCCCCCCCCChhccCCCCCCEEEccCCcCCCCCchHHHhcCCCCccEEECCCCCCCCCCC---CCCCCC
Q 005267           77 S-SFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDH---LPWKNL  152 (705)
Q Consensus        77 ~-~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~~~L~~L~ls~n~l~~~~~---~~~~~L  152 (705)
                      . ++++|++|++++|.+..... +..+++|++|++++|.+++.+|. +..+  ++|++|++++|.+++..+   ..+++|
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n~l~~~~~~-l~~l--~~L~~L~Ls~n~l~~~~~~~l~~l~~L  249 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNNFSTGIPF-LGDC--SALQHLDISGNKLSGDFSRAISTCTEL  249 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSSCCCSCCCB-CTTC--CSCCEEECCSSCCCSCHHHHTTTCSSC
T ss_pred             hccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCCcCCCCCcc-cccC--CCCCEEECcCCcCCCcccHHHhcCCCC
Confidence            2 67888888888888733322 37788899999999988877776 7766  899999999999887654   678889


Q ss_pred             cEEEccCCcCCCCCCCC-CCCCcEEEcccCCCCCCCcccccCC-CCCcEEEcccCcCCccCCcccCC-CCCCEEEcCCCc
Q 005267          153 EFLTLDSNLLQGSLPNL-PPHMVQLSISNNSLTGEIPSSFCNL-SSIQYLYLSNNSLSGQIPQCLGN-STLENLDLGMNN  229 (705)
Q Consensus       153 ~~L~l~~n~~~~~~~~~-~~~L~~L~l~~n~l~~~~~~~~~~l-~~L~~L~ls~n~~~~~~~~~~~~-~~L~~L~L~~n~  229 (705)
                      ++|++++|.+++.+|.. +++|++|++++|.+++.+|..+... ++|++|++++|.+++.+|..++. ++|++|++++|.
T Consensus       250 ~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~  329 (768)
T 3rgz_A          250 KLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN  329 (768)
T ss_dssp             CEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSE
T ss_pred             CEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCc
Confidence            99999999998887776 7889999999999998888888775 99999999999999888888876 899999999999


Q ss_pred             CCcccchh-ccCCCCCCEEECcCCcCcCCCCccCCCCC-cCcEEEccCCcCCCCCCccccC--CCCCcEEEccCccccCC
Q 005267          230 FQGTIPQT-YAKGCNLTYLRLSGNHLEGPLPPSLSNCV-NLQVLDVGNNNLSGPIPECLGN--STRLSFLDVRNNNLSGP  305 (705)
Q Consensus       230 l~~~~~~~-~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~--l~~L~~L~L~~n~l~~~  305 (705)
                      +.+.+|.. +..+++|++|++++|.+++.+|..+..++ +|++|++++|.+++.+|..+..  +++|++|++++|.+++.
T Consensus       330 l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~  409 (768)
T 3rgz_A          330 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK  409 (768)
T ss_dssp             EEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEE
T ss_pred             ccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccc
Confidence            98777765 89999999999999999988898888887 8999999999998888888777  88999999999999999


Q ss_pred             CCccccCCCCCCeEeccCcccccccCcccccC-cccEEEcCCCcccccccccccCCCCccEEEccCCcCCCCCCccccCC
Q 005267          306 IPECLGNSTSLSFLDVGNNSLSGPIPEYLGNS-TLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNC  384 (705)
Q Consensus       306 ~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~-~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l  384 (705)
                      +|..+.++++|+.|++++|.+++.+|..++.. +|+.|++++|.+++.+|..+..+++|++|++++|++++.+|..+.++
T Consensus       410 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l  489 (768)
T 3rgz_A          410 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC  489 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             cCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcC
Confidence            99999999999999999999999888877654 99999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEccCCcCCCCcchhhhCCCCCCEEEccCCcCcCCCCCCCCCCCCCCccEEEccCCcCcccCChHhhhhcccccc
Q 005267          385 RHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMR  464 (705)
Q Consensus       385 ~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~~~~l~~  464 (705)
                      ++|++|++++|++++.+|.++..+++|++|++++|++.+.+|..+  ..+++|+.|++++|+++|.+|..+....... .
T Consensus       490 ~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~-~  566 (768)
T 3rgz_A          490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL--GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKI-A  566 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GGCTTCCEEECCSSEEESBCCGGGGTTTTCB-C
T ss_pred             CCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH--cCCCCCCEEECCCCccCCcCChHHhcccchh-h
Confidence            999999999999999999999999999999999999999888766  6789999999999999999998765432211 1


Q ss_pred             ccCCc-cccccccc-----------------------------ccccceeeEEEEecCchHHHhhhhccccEEEccCCcc
Q 005267          465 RDDNS-IEVNYMRS-----------------------------LNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRF  514 (705)
Q Consensus       465 ~~~~~-~~~~~~~~-----------------------------~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l  514 (705)
                      ..... ....++..                             ........  ....|........+++|+.|||++|++
T Consensus       567 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~--~~~~g~~~~~~~~l~~L~~LdLs~N~l  644 (768)
T 3rgz_A          567 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS--RVYGGHTSPTFDNNGSMMFLDMSYNML  644 (768)
T ss_dssp             CSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTS--CEEEEECCCSCSSSBCCCEEECCSSCC
T ss_pred             hhccccccccccccccccccccccccccccccccchhhhcccccccccccc--ceecccCchhhhccccccEEECcCCcc
Confidence            11000 00000000                             00000000  000111111223368899999999999


Q ss_pred             ccccchhhhcCCCCCEEecCCCcCCccCCccccCCCCCCeeeCCCCcCCCcCcccccCCCCCCeEecccCcccccCCCCC
Q 005267          515 QGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGP  594 (705)
Q Consensus       515 ~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~  594 (705)
                      +|.+|..++++++|++|+|++|+++|.+|..++++++|++|||++|+++|.+|..+.++++|++|++++|+++|.||.++
T Consensus       645 ~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          645 SGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             BSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSS
T ss_pred             cccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcccCCCCCCCCCCCCCCCCCC
Q 005267          595 QFNTFGIDSYSGNVGLCGFPLSKICRIDE  623 (705)
Q Consensus       595 ~~~~~~~~~~~~n~~lcg~~~~~~c~~~~  623 (705)
                      +|.+|...+|.||+++||.|+. .|..+.
T Consensus       725 ~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          725 QFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             SGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             hhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            9999999999999999999987 796543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 705
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-12
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 5e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score =  101 bits (252), Expect = 9e-24
 Identities = 71/377 (18%), Positives = 132/377 (35%), Gaps = 33/377 (8%)

Query: 222 NLDLGMNNFQGTIPQTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGP 281
              LG  N   T+ QT      +T L+     ++      +    NL  ++  NN L+  
Sbjct: 26  KTVLGKTNVTDTVSQTDLD--QVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDI 81

Query: 282 IPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEV 341
            P  L N T+L  + + NN ++   P     + +   L     +   P+      + LE+
Sbjct: 82  TP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 342 LDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLV--------------NCRHL 387
               ++  S     T  +     +   +   L        +                 +L
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 388 EVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQF 447
           E +   NNQI++  P  +     L  L+L  N+         T      L  +DL+ NQ 
Sbjct: 200 ESLIATNNQISDITPLGIL--TNLDELSLNGNQLKDI----GTLASLTNLTDLDLANNQI 253

Query: 448 TGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATI 507
           + + P+  L     +    +    ++ +  L       ++      DI     L     +
Sbjct: 254 SNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQL-EDISPISNLKNLTYL 312

Query: 508 DLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIP 567
            L  N         +  L  L+ L  ++N ++    SSL NLT +  L    N+++   P
Sbjct: 313 TLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP 368

Query: 568 TQLASLNYLSVLNLSNN 584
             LA+L  ++ L L++ 
Sbjct: 369 --LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query705
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.02
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.97  E-value=1.6e-30  Score=264.19  Aligned_cols=259  Identities=32%  Similarity=0.570  Sum_probs=179.9

Q ss_pred             cCcEEEccCCcCCC--CCCccccCCCCCcEEEccC-ccccCCCCccccCCCCCCeEeccCcccccccCcccccCcccEEE
Q 005267          267 NLQVLDVGNNNLSG--PIPECLGNSTRLSFLDVRN-NNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLD  343 (705)
Q Consensus       267 ~L~~L~L~~n~l~~--~~~~~~~~l~~L~~L~L~~-n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~  343 (705)
                      +++.|+|++|.+.+  .+|..++++++|++|+|++ |.++|.+|..+.++++|++|++++|++.+               
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~---------------  115 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG---------------  115 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEE---------------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccc---------------
Confidence            34555555555544  2445555555555555554 45555555555555555555555555543               


Q ss_pred             cCCCcccccccccccCCCCccEEEccCCcCCCCCCccccCCCCCcEEEccCCcCCCCcchhhhCCCCCCEEEccCCcCcC
Q 005267          344 MRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCG  423 (705)
Q Consensus       344 l~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~  423 (705)
                              ..+..+..+..|+.+++++|.+.+.+|..+.+++.++.+++++|.+.+.+|..+..+..+            
T Consensus       116 --------~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l------------  175 (313)
T d1ogqa_         116 --------AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL------------  175 (313)
T ss_dssp             --------ECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTT------------
T ss_pred             --------cccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccc------------
Confidence                    333344445555666666666666666666777777777777777766666666554443            


Q ss_pred             CCCCCCCCCCCCCccEEEccCCcCcccCChHhhhhccccccccCCcccccccccccccceeeEEEEecCchHHHhhhhcc
Q 005267          424 PIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTT  503 (705)
Q Consensus       424 ~~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  503 (705)
                                   ++.+++++|++++..|..+.                                            ...
T Consensus       176 -------------~~~l~~~~n~l~~~~~~~~~--------------------------------------------~l~  198 (313)
T d1ogqa_         176 -------------FTSMTISRNRLTGKIPPTFA--------------------------------------------NLN  198 (313)
T ss_dssp             -------------CCEEECCSSEEEEECCGGGG--------------------------------------------GCC
T ss_pred             -------------cccccccccccccccccccc--------------------------------------------ccc
Confidence                         12333344444443332210                                            123


Q ss_pred             ccEEEccCCccccccchhhhcCCCCCEEecCCCcCCccCCccccCCCCCCeeeCCCCcCCCcCcccccCCCCCCeEeccc
Q 005267          504 FATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSN  583 (705)
Q Consensus       504 L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~  583 (705)
                      ...++++++...+.+|..++.+++++.+++++|.+++.+| .++.+++|+.|+|++|+++|.+|+.+.++++|++|+|++
T Consensus       199 ~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~  277 (313)
T d1ogqa_         199 LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSF  277 (313)
T ss_dssp             CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcC
Confidence            3468888888888899989999999999999999997655 688899999999999999999999999999999999999


Q ss_pred             CcccccCCCCCCCCCCCCCcccCCCCCCCCCCCCCC
Q 005267          584 NQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKIC  619 (705)
Q Consensus       584 N~l~g~ip~~~~~~~~~~~~~~~n~~lcg~~~~~~c  619 (705)
                      |+|+|.+|..+.+..+....+.||+.+||.|+. .|
T Consensus       278 N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         278 NNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             SEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             CcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            999999998888888988899999999999885 56
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure