Citrus Sinensis ID: 005282


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700----
MDRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSNPVIVNSSQL
ccccccccHHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccHHHcccccccccccccEEEEEcccEEHHHHHHHHHccHHHHHHHcccccccccccEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccHHHHHHHHHHHHHHHHcccHHcccHHHHHHHHccccccHHHEEHHccccccHHHHcccccccHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccHEHHHHHHccccccccEEEEEcccEEEHHHHHHHHcHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccc
mdrrerqtspaRRSLKRKLEQdfeekpdrkvsiVESGATQQDLVQDIRAQIDILnskfssdeTDRAAAKTASHALVEFAKNEEIVSLIVDngavpalvehlqtppqltnaqipyeHEVEKECAFALGllavkpehqqiivdtgALPHLVSLLKQYknggnsraLSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGnlvhsspsikKEVILAGALQPVIGLLSSSCSESKREAALLLGQFaaadsnskvhivqrgavrpliemlqspdsqLKEMSAFALGRLAqdthnqagiaqdggilPLLKlldskngslqhNAAFALygladnednVADLVRVGgvqklqdgeftvqptKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHlcapddcktifidNNGLELLLGLLESTSVKQREESSVALYKLATKatslspmdaappsptqqvylgeqfvnnptlsdvtfVVEGKQFYAHRICLLASSDAFRAMFdggykeknakdveipniRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFdkmrnkpwFFRLIRCVLPEIRNYFtkafsnpvivnssql
mdrrerqtsparrslkrkleqdfeekpdrkvsivesgatqqdlVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNlahenaniktrvrvEDGIPPLVELLKFVDVKVQRAAAGALrtlafkndenkkLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQfaaadsnskvhIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQklqdgeftvqptkDCVARTLKRleekvhgrvlnhLLYLLRVADRAVKRRVTLALAhlcapddckTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGykeknakdveipnIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYftkafsnpvivnssql
MDRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDnnglelllglleSTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSNPVIVNSSQL
********************************************QDIRAQIDIL******************HALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSC*****EAALLLGQFAAADSNSKVHIVQRGAVRPLIEM*************FALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLES*************Y**********************VYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSNPVIV*****
*****************************************DLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKE*NAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFS**********
******************************VSIVESGATQQDLVQDIRAQIDILNSKFS************SHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSNPVIVNSSQL
MDRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSN*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFSNPVIVNSSQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query704 2.2.26 [Sep-21-2011]
B9DHT4710 ARM REPEAT PROTEIN INTERA yes no 0.982 0.974 0.716 0.0
B7U179737 ARMADILLO BTB ARABIDOPSIS no no 0.985 0.941 0.616 0.0
P0CM60630 Vacuolar protein 8 OS=Cry yes no 0.532 0.595 0.274 2e-21
P0CM61630 Vacuolar protein 8 OS=Cry N/A no 0.532 0.595 0.274 2e-21
Q7TQI71024 Ankyrin repeat and BTB/PO yes no 0.278 0.191 0.314 2e-21
O087641009 Ankyrin repeat and BTB/PO yes no 0.264 0.184 0.320 2e-21
Q8N961839 Ankyrin repeat and BTB/PO yes no 0.278 0.233 0.305 2e-20
Q2U5T5578 Vacuolar protein 8 OS=Asp yes no 0.538 0.655 0.273 3e-19
Q4WVW4578 Vacuolar protein 8 OS=Neo yes no 0.538 0.655 0.276 4e-19
Q6IQ16392 Speckle-type POZ protein- no no 0.184 0.331 0.407 7e-18
>sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 Back     alignment and function desciption
 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/695 (71%), Positives = 600/695 (86%), Gaps = 3/695 (0%)

Query: 2   DRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSD 61
           +RRE ++ P R+  KRKLE+      DR++S V +   Q  L+ ++ AQ+ +LNS FS  
Sbjct: 6   ERREGRSFPERKGQKRKLEEGAAAVEDREISAVSTDGGQA-LLSEVAAQVSVLNSAFSWQ 64

Query: 62  ETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTN--AQIPYEHEVE 119
           E+DRAAAK A+  L E AKNE++V++IVD GAVPAL+ HLQ PP      A+ PYEHEVE
Sbjct: 65  ESDRAAAKRATQVLAELAKNEDLVNVIVDGGAVPALMTHLQAPPYNDGDLAEKPYEHEVE 124

Query: 120 KECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLA 179
           K  AFALGLLA+KPE+Q++IVD GALPHLV+LLK+ K+G +SRA++ VIRRAADAITNLA
Sbjct: 125 KGSAFALGLLAIKPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVIRRAADAITNLA 184

Query: 180 HENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPT 239
           HEN++IKTRVRVE GIPPLVELL+F D KVQRAAAGALRTLAFKND+NK  IVECNALPT
Sbjct: 185 HENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPT 244

Query: 240 LVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAAL 299
           L+LML SEDA++H+EAVGVIGNLVHSSP IKKEV+ AGALQPVIGLLSS C ES+REAAL
Sbjct: 245 LILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSSCCPESQREAAL 304

Query: 300 LLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQD 359
           LLGQFA+ DS+ KVHIVQRGAVRPLIEMLQSPD QLKEMSAFALGRLAQD HNQAGIA  
Sbjct: 305 LLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALGRLAQDAHNQAGIAHS 364

Query: 360 GGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDC 419
           GG+ PLLKLLDS+NGSLQHNAAFALYGLADNEDNV+D +RVGG+QKLQDGEF VQ TKDC
Sbjct: 365 GGLGPLLKLLDSRNGSLQHNAAFALYGLADNEDNVSDFIRVGGIQKLQDGEFIVQATKDC 424

Query: 420 VARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLEL 479
           V++TLKRLEEK+HGRVL HLLYL+R+++++++RRV LALAHLC+P+D +TIFID+NGLEL
Sbjct: 425 VSKTLKRLEEKIHGRVLRHLLYLMRISEKSIQRRVALALAHLCSPEDQRTIFIDDNGLEL 484

Query: 480 LLGLLESTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVT 539
           LLGLL S + KQ+ + + ALYKLA K+ +LSP+DAAPPSPTQ+VYLGEQ+VNN TLSDVT
Sbjct: 485 LLGLLGSLNTKQQLDGAAALYKLANKSMALSPVDAAPPSPTQRVYLGEQYVNNATLSDVT 544

Query: 540 FVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNV 599
           F+VEG+ FYAHRICLLASSDAFRAMFDGGY+EK+A+D+EIPNI+W VFELMMRFIYTG+V
Sbjct: 545 FLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWEVFELMMRFIYTGSV 604

Query: 600 DVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCIL 659
           D++ +I++DLLRAADQYLLEGLKRLCEY+IAQ I++E+I  MYELSEA++A +L+Q+CI+
Sbjct: 605 DITNEISKDLLRAADQYLLEGLKRLCEYTIAQDITLESIGDMYELSEAFHAMSLRQACIM 664

Query: 660 FILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFS 694
           FILE FDK+ + PW   L++  +PEIR YF +A +
Sbjct: 665 FILEHFDKLSSMPWQNELVQRTIPEIREYFCRALT 699




May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2, a transcription factor which controls ABA-dependent gene expression via the G-box-type ABA-responsive elements. Negative regulator of seed germination and young seedling growth.
Arabidopsis thaliana (taxid: 3702)
>sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 Back     alignment and function description
>sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|Q7TQI7|ABTB2_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus GN=Abtb2 PE=2 SV=1 Back     alignment and function description
>sp|O08764|ABTB2_RAT Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Rattus norvegicus GN=Abtb2 PE=2 SV=1 Back     alignment and function description
>sp|Q8N961|ABTB2_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=ABTB2 PE=2 SV=1 Back     alignment and function description
>sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 Back     alignment and function description
>sp|Q6IQ16|SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens GN=SPOPL PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query704
255552325719 protein binding protein, putative [Ricin 0.948 0.929 0.772 0.0
225437008704 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.977 0.977 0.738 0.0
225432592705 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.992 0.991 0.741 0.0
356497472706 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.982 0.980 0.730 0.0
296086739713 unnamed protein product [Vitis vinifera] 0.977 0.964 0.729 0.0
449432712703 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.992 0.994 0.746 0.0
225432594711 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.992 0.983 0.734 0.0
224102035720 predicted protein [Populus trichocarpa] 0.994 0.972 0.725 0.0
356541384708 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.982 0.977 0.725 0.0
356536027707 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.984 0.980 0.723 0.0
>gi|255552325|ref|XP_002517207.1| protein binding protein, putative [Ricinus communis] gi|223543842|gb|EEF45370.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/672 (77%), Positives = 597/672 (88%), Gaps = 4/672 (0%)

Query: 34  VESGATQQDLVQDIRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGA 93
           V  G  +Q L+ ++ +Q++ILNS FS +E DRAAAK A H L EFAKNEE+V++IV+ GA
Sbjct: 46  VPFGDARQALLYEVASQVNILNSTFSWNEADRAAAKRAIHVLAEFAKNEELVNVIVEGGA 105

Query: 94  VPALVEHLQTPP----QLTNAQIPYEHEVEKECAFALGLLAVKPEHQQIIVDTGALPHLV 149
           VPALV+HLQ PP    ++  +  P+EHEVEK  AFALGLLAVKPEHQQ+IVD GAL HLV
Sbjct: 106 VPALVKHLQAPPSSSSEVDRSTKPFEHEVEKGSAFALGLLAVKPEHQQLIVDIGALSHLV 165

Query: 150 SLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDVKV 209
            LLK++K+G  SRA++ VIRRAADAITNLAHEN++IKTRVRVE GIPPLVELL+FVD KV
Sbjct: 166 ELLKRHKDGSVSRAVNSVIRRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFVDTKV 225

Query: 210 QRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSI 269
           QRAAAGALRTLAFKNDENKK IVECNALPTL+LMLRSEDA++H+EAVGVIGNLVHSSP+I
Sbjct: 226 QRAAAGALRTLAFKNDENKKQIVECNALPTLILMLRSEDAAIHYEAVGVIGNLVHSSPNI 285

Query: 270 KKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQ 329
           KKEV+ AGALQPVIGLLSS CSES+REAALLLGQFAA DS+ KVHIVQRGAV+PLIEMLQ
Sbjct: 286 KKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVQPLIEMLQ 345

Query: 330 SPDSQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDSKNGSLQHNAAFALYGLAD 389
           SPD QL+EMSAFALGRLAQD HNQAGIA +GG++PLLKLLDSKNGSLQHNAAFALYGLAD
Sbjct: 346 SPDVQLREMSAFALGRLAQDLHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLAD 405

Query: 390 NEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADRA 449
           NEDNV+D +RVGGVQKLQDGEF VQ TKDCVA+TLKRLEEK+HGRVL+HLLYL+RV ++A
Sbjct: 406 NEDNVSDFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLHHLLYLMRVTEKA 465

Query: 450 VKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLATKATSL 509
           V+RRV LALAHLC+PDD +TIFIDNNGLELLLGLL STS KQ+ + +VALYKLA KA +L
Sbjct: 466 VQRRVALALAHLCSPDDQRTIFIDNNGLELLLGLLGSTSPKQQLDGAVALYKLANKAATL 525

Query: 510 SPMDAAPPSPTQQVYLGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGY 569
           SP+DAAPPSPT QVYLGEQFVNN TLSDVTF+VEG++FYAHRICLLASSDAFRAMFDGGY
Sbjct: 526 SPVDAAPPSPTPQVYLGEQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGY 585

Query: 570 KEKNAKDVEIPNIRWNVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSI 629
           +EK+A+D+EIPNIRW VFELMMRFIYTG+VDVS+DIAQDLLRAADQYLLEGLKRLCEY+I
Sbjct: 586 REKDARDIEIPNIRWEVFELMMRFIYTGSVDVSLDIAQDLLRAADQYLLEGLKRLCEYTI 645

Query: 630 AQIISVENIMLMYELSEAYNATTLKQSCILFILEKFDKMRNKPWFFRLIRCVLPEIRNYF 689
           AQ IS+EN+  MYELSEA++A +L+ +CILFILE+FDK+  KP    LI+ ++PEIRNYF
Sbjct: 646 AQDISLENVASMYELSEAFHAISLRHTCILFILEQFDKLNAKPRHSNLIQRIIPEIRNYF 705

Query: 690 TKAFSNPVIVNS 701
            KA + P   NS
Sbjct: 706 AKALTKPNPHNS 717




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225437008|ref|XP_002272541.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432592|ref|XP_002281388.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 isoform 1 [Vitis vinifera] gi|297737016|emb|CBI26217.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497472|ref|XP_003517584.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|296086739|emb|CBI32374.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432712|ref|XP_004134143.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225432594|ref|XP_002281401.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224102035|ref|XP_002312519.1| predicted protein [Populus trichocarpa] gi|222852339|gb|EEE89886.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356541384|ref|XP_003539157.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|356536027|ref|XP_003536542.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query704
TAIR|locus:2150295710 ARIA "ARM repeat protein inter 0.982 0.974 0.702 2.6e-260
TAIR|locus:2179842737 ABAP1 "ARMADILLO BTB protein 1 0.985 0.941 0.605 7.9e-220
SGD|S000000739578 VAC8 "Phosphorylated and palmi 0.465 0.567 0.292 1.1e-21
FB|FBgn02647111326 CG43980 [Drosophila melanogast 0.220 0.116 0.388 1.9e-21
ASPGD|ASPL0000008980579 AN12408 [Emericella nidulans ( 0.399 0.485 0.308 3.8e-21
CGD|CAL0001835585 VAC8 [Candida albicans (taxid: 0.475 0.572 0.289 1.4e-19
UNIPROTKB|Q59MN0585 VAC8 "Vacuolar protein 8" [Can 0.475 0.572 0.289 1.4e-19
UNIPROTKB|E1BWB81025 E1BWB8 "Uncharacterized protei 0.254 0.174 0.336 2.4e-19
POMBASE|SPBC354.14c550 vac8 "vacuolar protein Vac8 (p 0.539 0.690 0.265 2.5e-18
UNIPROTKB|F1SGS81025 ABTB2 "Uncharacterized protein 0.267 0.183 0.33 6.1e-18
TAIR|locus:2150295 ARIA "ARM repeat protein interacting with ABF2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2505 (886.9 bits), Expect = 2.6e-260, P = 2.6e-260
 Identities = 488/695 (70%), Positives = 589/695 (84%)

Query:     2 DRRERQTSPARRSLKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQIDILNSKFSSD 61
             +RRE ++ P R+  KRKLE+      DR++S V +   Q  L+ ++ AQ+ +LNS FS  
Sbjct:     6 ERREGRSFPERKGQKRKLEEGAAAVEDREISAVSTDGGQA-LLSEVAAQVSVLNSAFSWQ 64

Query:    62 ETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTN--AQIPYEHEVE 119
             E+DRAAAK A+  L E AKNE++V++IVD GAVPAL+ HLQ PP      A+ PYEHEVE
Sbjct:    65 ESDRAAAKRATQVLAELAKNEDLVNVIVDGGAVPALMTHLQAPPYNDGDLAEKPYEHEVE 124

Query:   120 KECAFALGLLAVKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLA 179
             K  AFALGLLA+KPE+Q++IVD GALPHLV+LLK+ K+G +SRA++ VIRRAADAITNLA
Sbjct:   125 KGSAFALGLLAIKPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVIRRAADAITNLA 184

Query:   180 HENANIKTRVRVEDGIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPT 239
             HEN++IKTRVRVE GIPPLVELL+F D KVQRAAAGALRTLAFKND+NK  IVECNALPT
Sbjct:   185 HENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPT 244

Query:   240 LVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAAL 299
             L+LML SEDA++H+EAVGVIGNLVHSSP IKKEV+ AGALQPVIGLLSS C ES+REAAL
Sbjct:   245 LILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSSCCPESQREAAL 304

Query:   300 LLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGIAQD 359
             LLGQFA+ DS+ KVHIVQRGAVRPLIEMLQSPD QLKEMSAFALGRLAQD HNQAGIA  
Sbjct:   305 LLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALGRLAQDAHNQAGIAHS 364

Query:   360 GGILPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQPTKDC 419
             GG+ PLLKLLDS+NGSLQHNAAFALYGLADNEDNV+D +RVGG+QKLQDGEF VQ TKDC
Sbjct:   365 GGLGPLLKLLDSRNGSLQHNAAFALYGLADNEDNVSDFIRVGGIQKLQDGEFIVQATKDC 424

Query:   420 VARTLKRLEEKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDXXXXXX 479
             V++TLKRLEEK+HGRVL HLLYL+R+++++++RRV LALAHLC+P+D +TIFID      
Sbjct:   425 VSKTLKRLEEKIHGRVLRHLLYLMRISEKSIQRRVALALAHLCSPEDQRTIFIDDNGLEL 484

Query:   480 XXXXXXSTSVKQREESSVALYKLATKATSLSPMDAAPPSPTQQVYLGEQFVNNPTLSDVT 539
                   S + KQ+ + + ALYKLA K+ +LSP+DAAPPSPTQ+VYLGEQ+VNN TLSDVT
Sbjct:   485 LLGLLGSLNTKQQLDGAAALYKLANKSMALSPVDAAPPSPTQRVYLGEQYVNNATLSDVT 544

Query:   540 FVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRWNVFELMMRFIYTGNV 599
             F+VEG+ FYAHRICLLASSDAFRAMFDGGY+EK+A+D+EIPNI+W VFELMMRFIYTG+V
Sbjct:   545 FLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWEVFELMMRFIYTGSV 604

Query:   600 DVSVDIAQDLLRAADQYLLEGLKRLCEYSIAQIISVENIMLMYELSEAYNATTLKQSCIL 659
             D++ +I++DLLRAADQYLLEGLKRLCEY+IAQ I++E+I  MYELSEA++A +L+Q+CI+
Sbjct:   605 DITNEISKDLLRAADQYLLEGLKRLCEYTIAQDITLESIGDMYELSEAFHAMSLRQACIM 664

Query:   660 FILEKFDKMRNKPWFFRLIRCVLPEIRNYFTKAFS 694
             FILE FDK+ + PW   L++  +PEIR YF +A +
Sbjct:   665 FILEHFDKLSSMPWQNELVQRTIPEIREYFCRALT 699




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;IMP
GO:0010187 "negative regulation of seed germination" evidence=IMP
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
TAIR|locus:2179842 ABAP1 "ARMADILLO BTB protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000000739 VAC8 "Phosphorylated and palmitoylated vacuolar membrane protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
FB|FBgn0264711 CG43980 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008980 AN12408 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0001835 VAC8 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59MN0 VAC8 "Vacuolar protein 8" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWB8 E1BWB8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
POMBASE|SPBC354.14c vac8 "vacuolar protein Vac8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS8 ABTB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B9DHT4ARIA_ARATHNo assigned EC number0.71650.98290.9746yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
pfam00651101 pfam00651, BTB, BTB/POZ domain 7e-24
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 4e-22
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 5e-22
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-20
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-13
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-13
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 5e-13
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-10
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 2e-09
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-09
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 3e-09
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-09
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 4e-08
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 6e-08
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 2e-07
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 5e-07
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 4e-06
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 5e-06
COG1413335 COG1413, COG1413, FOG: HEAT repeat [Energy product 6e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 7e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 8e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.002
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.003
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 96.1 bits (240), Expect = 7e-24
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 5/105 (4%)

Query: 525 LGEQFVNNPTLSDVTFVVEGKQFYAHRICLLASSDAFRAMFDGGYKEKNAKDVEIPNIRW 584
           L E    N  L DVT VV  K+F+AH+  L A S  F+A+F G  + +    + + ++  
Sbjct: 1   LNELR-ENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFTGNKEVE----ITLEDVSP 55

Query: 585 NVFELMMRFIYTGNVDVSVDIAQDLLRAADQYLLEGLKRLCEYSI 629
             FE ++ FIYTG ++++ +   DLL  AD+  +  L   CE  +
Sbjct: 56  EDFEALLEFIYTGKLEITEENVDDLLALADKLQIPALIDKCEEFL 100


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 704
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
PHA02713 557 hypothetical protein; Provisional 99.93
KOG4441 571 consensus Proteins containing BTB/POZ and Kelch do 99.93
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
PHA02790 480 Kelch-like protein; Provisional 99.92
PHA03098 534 kelch-like protein; Provisional 99.92
KOG4350 620 consensus Uncharacterized conserved protein, conta 99.91
PF05804708 KAP: Kinesin-associated protein (KAP) 99.89
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.84
KOG4591280 consensus Uncharacterized conserved protein, conta 99.81
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.8
KOG2075 521 consensus Topoisomerase TOP1-interacting protein B 99.79
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.79
KOG1048717 consensus Neural adherens junction protein Plakoph 99.78
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.75
KOG4682 488 consensus Uncharacterized conserved protein, conta 99.74
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.73
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.73
KOG1048717 consensus Neural adherens junction protein Plakoph 99.72
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.72
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.69
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.68
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.68
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.62
PRK09687280 putative lyase; Provisional 99.54
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.51
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.5
PRK09687280 putative lyase; Provisional 99.48
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.46
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.44
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.42
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.39
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.39
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.36
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.33
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.33
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.31
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.29
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.29
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.28
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.26
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.24
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.24
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.23
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 99.21
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.16
KOG3678 832 consensus SARM protein (with sterile alpha and arm 99.1
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.1
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 99.03
PTZ00429 746 beta-adaptin; Provisional 99.02
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.02
KOG3678832 consensus SARM protein (with sterile alpha and arm 99.0
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 99.0
PTZ00429746 beta-adaptin; Provisional 98.97
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.95
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.95
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.91
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.88
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.82
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.81
KOG0511516 consensus Ankyrin repeat protein [General function 98.8
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.79
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.77
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.75
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.66
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.65
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.63
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.62
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.58
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.58
KOG18241233 consensus TATA-binding protein-interacting protein 98.54
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.53
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.5
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.49
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.46
COG5369743 Uncharacterized conserved protein [Function unknow 98.45
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.39
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.39
TIGR02270410 conserved hypothetical protein. Members are found 98.38
KOG4646173 consensus Uncharacterized conserved protein, conta 98.37
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.36
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.35
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.32
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.29
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.27
KOG4646173 consensus Uncharacterized conserved protein, conta 98.22
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.22
TIGR02270410 conserved hypothetical protein. Members are found 98.21
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.21
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.19
PF05536543 Neurochondrin: Neurochondrin 98.19
KOG1242569 consensus Protein containing adaptin N-terminal re 98.18
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.16
KOG2838401 consensus Uncharacterized conserved protein, conta 98.15
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 98.14
KOG2734536 consensus Uncharacterized conserved protein [Funct 98.1
PF05536543 Neurochondrin: Neurochondrin 98.1
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.1
KOG2734536 consensus Uncharacterized conserved protein [Funct 98.03
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 97.98
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.96
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.95
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.94
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.94
KOG1242569 consensus Protein containing adaptin N-terminal re 97.93
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.91
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.89
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.89
COG5369743 Uncharacterized conserved protein [Function unknow 97.86
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.84
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.82
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.78
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.74
KOG2259823 consensus Uncharacterized conserved protein [Funct 97.73
KOG2259823 consensus Uncharacterized conserved protein [Funct 97.72
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.69
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.68
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.68
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.65
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.64
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.6
COG5240898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.59
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 97.59
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.59
KOG2838401 consensus Uncharacterized conserved protein, conta 97.59
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.58
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.58
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.58
KOG09151702 consensus Uncharacterized conserved protein [Funct 97.55
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.55
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 97.51
KOG3473112 consensus RNA polymerase II transcription elongati 97.51
KOG0567289 consensus HEAT repeat-containing protein [General 97.49
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.46
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.38
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.34
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.34
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.29
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 97.23
KOG0567289 consensus HEAT repeat-containing protein [General 97.22
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.21
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.2
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.08
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 97.07
KOG3036293 consensus Protein involved in cell differentiation 97.06
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 97.03
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.02
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.0
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.99
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 96.97
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.95
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.94
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.92
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.86
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.86
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.8
KOG2032533 consensus Uncharacterized conserved protein [Funct 96.77
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 96.76
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.75
KOG0511 516 consensus Ankyrin repeat protein [General function 96.73
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.72
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.7
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.7
PRK14707 2710 hypothetical protein; Provisional 96.65
PF13764802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.65
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.64
KOG3036293 consensus Protein involved in cell differentiation 96.62
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.56
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.55
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.52
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.51
PRK14707 2710 hypothetical protein; Provisional 96.5
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 96.48
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.47
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.47
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.44
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.43
KOG12481176 consensus Uncharacterized conserved protein [Funct 96.33
KOG22741005 consensus Predicted importin 9 [Intracellular traf 96.32
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 96.29
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.27
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.19
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.16
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.14
COG5096757 Vesicle coat complex, various subunits [Intracellu 96.12
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.04
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.02
KOG2062929 consensus 26S proteasome regulatory complex, subun 95.96
COG5656970 SXM1 Importin, protein involved in nuclear import 95.82
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.69
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 95.65
KOG1665 302 consensus AFH1-interacting protein FIP2, contains 95.62
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.45
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.44
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.43
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 95.27
KOG22741005 consensus Predicted importin 9 [Intracellular traf 95.22
KOG12481176 consensus Uncharacterized conserved protein [Funct 95.18
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 95.16
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.1
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 95.1
PF05004309 IFRD: Interferon-related developmental regulator ( 95.08
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.0
KOG2025 892 consensus Chromosome condensation complex Condensi 94.9
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 94.84
KOG2025 892 consensus Chromosome condensation complex Condensi 94.82
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 94.82
KOG1566342 consensus Conserved protein Mo25 [Function unknown 94.82
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.81
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 94.77
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 94.72
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.71
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 94.7
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.69
KOG2999713 consensus Regulator of Rac1, required for phagocyt 94.68
KOG2715210 consensus Uncharacterized conserved protein, conta 94.58
KOG2714 465 consensus SETA binding protein SB1 and related pro 94.51
PF11701157 UNC45-central: Myosin-binding striated muscle asse 94.23
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.22
PF05004309 IFRD: Interferon-related developmental regulator ( 94.2
KOG2032533 consensus Uncharacterized conserved protein [Funct 94.05
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 94.0
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 93.95
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 93.95
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 93.91
KOG4653982 consensus Uncharacterized conserved protein [Funct 93.9
KOG1778 319 consensus CREB binding protein/P300 and related TA 93.86
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 93.75
KOG1243690 consensus Protein kinase [General function predict 93.65
KOG04141251 consensus Chromosome condensation complex Condensi 93.43
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 93.42
KOG1566342 consensus Conserved protein Mo25 [Function unknown 93.22
COG5116926 RPN2 26S proteasome regulatory complex component [ 93.09
KOG04141251 consensus Chromosome condensation complex Condensi 93.06
KOG1243690 consensus Protein kinase [General function predict 92.89
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 92.81
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.75
KOG2956516 consensus CLIP-associating protein [General functi 92.5
COG50981128 Chromosome condensation complex Condensin, subunit 92.43
COG5209315 RCD1 Uncharacterized protein involved in cell diff 92.39
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 92.22
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 92.19
KOG2956516 consensus CLIP-associating protein [General functi 92.17
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 91.55
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 91.54
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 91.36
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 91.29
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 90.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 90.47
KOG2611698 consensus Neurochondrin/leucine-rich protein (Neur 90.47
COG50981128 Chromosome condensation complex Condensin, subunit 90.08
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 89.39
KOG1820815 consensus Microtubule-associated protein [Cytoskel 89.38
COG5209315 RCD1 Uncharacterized protein involved in cell diff 89.35
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 89.28
KOG1820815 consensus Microtubule-associated protein [Cytoskel 89.19
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 88.98
COG5116926 RPN2 26S proteasome regulatory complex component [ 88.28
PF1036392 DUF2435: Protein of unknown function (DUF2435) 88.27
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 88.21
KOG2137700 consensus Protein kinase [Signal transduction mech 88.08
PF13251182 DUF4042: Domain of unknown function (DUF4042) 88.0
KOG2933334 consensus Uncharacterized conserved protein [Funct 87.72
KOG2611698 consensus Neurochondrin/leucine-rich protein (Neur 87.66
PF1036392 DUF2435: Protein of unknown function (DUF2435) 86.96
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 86.86
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 86.34
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 85.42
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 85.2
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 85.19
smart00638574 LPD_N Lipoprotein N-terminal Domain. 85.14
KOG2933334 consensus Uncharacterized conserved protein [Funct 84.18
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 83.31
KOG0301745 consensus Phospholipase A2-activating protein (con 83.27
PF08167165 RIX1: rRNA processing/ribosome biogenesis 83.11
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 83.0
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 82.28
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 81.33
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 81.24
PF08167165 RIX1: rRNA processing/ribosome biogenesis 80.55
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 80.35
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 80.31
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 80.18
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=1.1e-38  Score=319.79  Aligned_cols=399  Identities=22%  Similarity=0.313  Sum_probs=339.1

Q ss_pred             hhccCCchhhHHHHHHHHHHHHHhhcChhHHHHHHhCCChHHHHhhccCCCcCCCCCCCCchHHHHHHHHHHHhhc-CCh
Q 005282           55 NSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALGLLA-VKP  133 (704)
Q Consensus        55 ~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~l~~~g~i~~L~~lL~~~~~~~~~~~~~d~~v~~~a~~~L~~l~-~~~  133 (704)
                      ..+.+++.+.+.....+++.+.....+|.... ++.+|+||.+++.|...+.         +.++..|+|+|.|++ +++
T Consensus        73 ~~~~S~~~~~q~~a~~~~rkllS~~~~ppi~~-vi~~G~v~~lV~~l~~~~~---------~~lq~eAAWaLTnIAsgts  142 (514)
T KOG0166|consen   73 AALYSDDPQQQLTATQAFRKLLSKERNPPIDE-VIQSGVVPRLVEFLSRDDN---------PTLQFEAAWALTNIASGTS  142 (514)
T ss_pred             HHHhCCCHHHHHHHHHHHHHHHccCCCCCHHH-HHHcCcHHHHHHHHccCCC---------hhHHHHHHHHHHHHhcCch
Confidence            33445666666666777777776666776644 4566999999999987653         589999999999999 888


Q ss_pred             hhHHHHHHcCCcHHHHHHHhhccCCCCCcchhHHHHHHHHHHHHhhhcChhhhhhhhccCCcHHHHHHhcCCCH-HHHHH
Q 005282          134 EHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFVDV-KVQRA  212 (704)
Q Consensus       134 ~~~~~~~~~g~l~~L~~lL~~~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~~~~~-~~~~~  212 (704)
                      +....++++|++|.+++++.+++.        .++++|+|+|+|++.+++.+|..+...|++++|+.++...++ .+.+.
T Consensus       143 e~T~~vv~agavp~fi~Ll~s~~~--------~v~eQavWALgNIagds~~~Rd~vl~~g~l~pLl~~l~~~~~~~~lRn  214 (514)
T KOG0166|consen  143 EQTKVVVDAGAVPIFIQLLSSPSA--------DVREQAVWALGNIAGDSPDCRDYVLSCGALDPLLRLLNKSDKLSMLRN  214 (514)
T ss_pred             hhccccccCCchHHHHHHhcCCcH--------HHHHHHHHHHhccccCChHHHHHHHhhcchHHHHHHhccccchHHHHH
Confidence            999999999999999999999987        999999999999999999999999999999999999997776 78899


Q ss_pred             HHHHHHHhccCCchhhHHhHhcCChHHHHHhhcCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCCHHHHHHHhcCCChh
Q 005282          213 AAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSE  292 (704)
Q Consensus       213 a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~l~~L~~ll~~~~~~  292 (704)
                      +.|+|.|+|.+.......-.-..++|.|..++.+.|++|...|+|+|.+|+.+.++..+.+++.|+++.|+.+|.+.+..
T Consensus       215 ~tW~LsNlcrgk~P~P~~~~v~~iLp~L~~ll~~~D~~Vl~Da~WAlsyLsdg~ne~iq~vi~~gvv~~LV~lL~~~~~~  294 (514)
T KOG0166|consen  215 ATWTLSNLCRGKNPSPPFDVVAPILPALLRLLHSTDEEVLTDACWALSYLTDGSNEKIQMVIDAGVVPRLVDLLGHSSPK  294 (514)
T ss_pred             HHHHHHHHHcCCCCCCcHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhcCChHHHHHHHHccchHHHHHHHcCCCcc
Confidence            99999999986643333333345799999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhccCCcchHHHHhcCChHHHHHhhC-CCCHHHHHHHHHHHHHhhcCCchh-hhHHhhCChHHHHHhhc
Q 005282          293 SKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQ-SPDSQLKEMSAFALGRLAQDTHNQ-AGIAQDGGILPLLKLLD  370 (704)
Q Consensus       293 ~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~-~~~~~v~~~a~~~L~~l~~~~~~~-~~~~~~~~~~~L~~ll~  370 (704)
                      ++..|+++++|++.+++...+.+++.|+++.|..++. ++...+++.|||+++|++.+...+ ..++..|.++.|+.+++
T Consensus       295 v~~PaLRaiGNIvtG~d~QTq~vi~~~~L~~l~~ll~~s~~~~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~  374 (514)
T KOG0166|consen  295 VVTPALRAIGNIVTGSDEQTQVVINSGALPVLSNLLSSSPKESIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQ  374 (514)
T ss_pred             cccHHHhhccceeeccHHHHHHHHhcChHHHHHHHhccCcchhHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHh
Confidence            9999999999999999999999999999999999998 566679999999999999987755 45778899999999999


Q ss_pred             CCChhHHHHHHHHHHHccc--CCchhhHHHhhCCcccccccccccccchHHHHHHHHHHHHHhhcchhHHHHHHHhhccH
Q 005282          371 SKNGSLQHNAAFALYGLAD--NEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLNHLLYLLRVADR  448 (704)
Q Consensus       371 ~~~~~v~~~a~~~L~~l~~--~~~~~~~l~~~g~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~ll~~~~~  448 (704)
                      +++..+|++|+|++.|++.  +++...++++.|.++++                                 ..+|...+.
T Consensus       375 ~~ef~~rKEAawaIsN~ts~g~~~qi~yLv~~giI~pl---------------------------------cdlL~~~D~  421 (514)
T KOG0166|consen  375 TAEFDIRKEAAWAISNLTSSGTPEQIKYLVEQGIIKPL---------------------------------CDLLTCPDV  421 (514)
T ss_pred             ccchHHHHHHHHHHHhhcccCCHHHHHHHHHcCCchhh---------------------------------hhcccCCCh
Confidence            9999999999999999995  67778889988876664                                 455666677


Q ss_pred             HHHHHHHHHHHhcc-----CC----CccceeeecCCcHHHHHHHHhhcchhhhhhHHHHHHHHhh
Q 005282          449 AVKRRVTLALAHLC-----AP----DDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLAT  504 (704)
Q Consensus       449 ~v~~~a~~~L~~l~-----~~----~~~~~~l~~~~~i~~L~~ll~~~~~~~~~~a~~~L~~L~~  504 (704)
                      .+...+..+|.++-     ..    +.....+.+.||+..+-.|-.+++.++-..|...+..--.
T Consensus       422 ~ii~v~Ld~l~nil~~~e~~~~~~~n~~~~~IEe~ggldkiE~LQ~hen~~Iy~~A~~II~~yf~  486 (514)
T KOG0166|consen  422 KIILVALDGLENILKVGEAEKNRGTNPLAIMIEEAGGLDKIENLQSHENEEIYKKAYKIIDTYFS  486 (514)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHccChhHHHHhhccccHHHHHHHHHHHHHhcC
Confidence            77777777777771     11    3334556678999999999999999998888777665433



>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 3e-18
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 2e-12
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 6e-17
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 1e-16
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 6e-14
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 5e-13
4b8j_A528 Rimp_alpha1a Length = 528 6e-13
4b8j_A528 Rimp_alpha1a Length = 528 2e-09
2yns_A490 Rimp_alpha_b54nls Length = 490 7e-13
2yns_A490 Rimp_alpha_b54nls Length = 490 3e-09
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 9e-13
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 5e-04
1ial_A453 Importin Alpha, Mouse Length = 453 2e-12
1ial_A453 Importin Alpha, Mouse Length = 453 4e-04
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 2e-12
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 5e-04
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 2e-12
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 4e-04
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 2e-12
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 5e-04
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 3e-12
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 5e-04
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 3e-12
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 4e-04
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 3e-12
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 6e-04
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 3e-12
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 5e-04
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 3e-12
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 6e-04
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 3e-12
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 7e-04
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 3e-12
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 7e-04
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 3e-12
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 7e-04
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 3e-12
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 9e-04
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 3e-12
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 7e-04
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 1e-11
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 3e-06
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 7e-11
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 1e-10
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 2e-10
3htm_A172 Structures Of Spop-Substrate Complexes: Insights In 4e-10
3l6x_A584 Crystal Structure Of P120 Catenin In Complex With E 9e-09
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 9e-09
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-08
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-08
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 1e-08
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 1e-08
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 1e-08
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 1e-08
4ap2_A297 Crystal Structure Of The Human Klhl11-cul3 Complex 1e-08
3i3n_A279 Crystal Structure Of The Btb-Back Domains Of Human 7e-08
2gl7_A550 Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX 2e-07
1i7x_A538 Beta-CateninE-Cadherin Complex Length = 538 3e-07
3ouw_A540 Structure Of Beta-Catenin With Lef-1 Length = 540 3e-07
1jpw_A540 Crystal Structure Of A Human Tcf-4 BETA-Catenin Com 3e-07
2z6h_A644 Crystal Structure Of Beta-Catenin Armadillo Repeat 3e-07
1g3j_A532 Crystal Structure Of The Xtcf3-CbdBETA-Catenin Arma 3e-07
1qz7_A533 Beta-Catenin Binding Domain Of Axin In Complex With 4e-07
3tx7_A527 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 4e-07
1luj_A514 Crystal Structure Of The Beta-CateninICAT COMPLEX L 4e-07
2bct_A516 The Armadillo Repeat Region From Murine Beta-Cateni 4e-07
4djs_A518 Structure Of Beta-Catenin In Complex With A Stapled 4e-07
1jdh_A529 Crystal Structure Of Beta-Catenin And Htcf-4 Length 4e-07
1t08_A519 Crystal Structure Of Beta-CateninICAT HELICAL Domai 4e-07
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 1e-06
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 5e-05
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 1e-06
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 5e-05
1xm9_A457 Structure Of The Armadillo Repeat Domain Of Plakoph 9e-06
2if5_A120 Structure Of The Poz Domain Of Human Lrf, A Master 2e-05
3ifq_A553 Interction Of Plakoglobin And Beta-Catenin With Des 2e-05
2nn2_A133 Crystal Structure Of The Btb Domain From The LrfZBT 2e-05
3ltm_A211 Structure Of A New Family Of Artificial Alpha Helic 5e-05
3ltj_A201 Structure Of A New Family Of Artificial Alpha Helic 7e-05
3ga1_A129 Crystal Structure Of The Human Nac1 Poz Domain Leng 9e-05
3sla_A168 X-Ray Structure Of First Four Repeats Of Human Beta 2e-04
3sl9_A167 X-Ray Structure Of Beta Catenin In Complex With Bcl 2e-04
3tt9_A233 Crystal Structure Of The Stable Degradation Fragmen 3e-04
2z6g_A780 Crystal Structure Of A Full-Length Zebrafish Beta-C 3e-04
1cs3_A116 Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN 4e-04
1buo_A121 Btb Domain From Plzf Length = 121 4e-04
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Iteration: 1

Score = 90.1 bits (222), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 66/192 (34%), Positives = 101/192 (52%), Gaps = 1/192 (0%) Query: 194 GIPPLVELLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHF 253 G+ LV+LL D +VQ+ AA AL +A DE K IV+ + LV +L S D+ V Sbjct: 45 GVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQK 104 Query: 254 EAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKV 313 EA + N+ K ++ AG ++ ++ LL+S+ SE ++EAA L A+ + Sbjct: 105 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIK 164 Query: 314 HIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQD-THNQAGIAQDGGILPLLKLLDSK 372 IV G V L+++L S DS++++ +A AL +A T I GG+ L KLL S Sbjct: 165 AIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTST 224 Query: 373 NGSLQHNAAFAL 384 + +Q A AL Sbjct: 225 DSEVQKEAQRAL 236
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|3HTM|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Spopbtb3-Box Length = 172 Back     alignment and structure
>pdb|3L6X|A Chain A, Crystal Structure Of P120 Catenin In Complex With E-Cadherin Length = 584 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|4AP2|A Chain A, Crystal Structure Of The Human Klhl11-cul3 Complex At 2.8a Resolution Length = 297 Back     alignment and structure
>pdb|3I3N|A Chain A, Crystal Structure Of The Btb-Back Domains Of Human Klhl11 Length = 279 Back     alignment and structure
>pdb|2GL7|A Chain A, Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX Length = 550 Back     alignment and structure
>pdb|1I7X|A Chain A, Beta-CateninE-Cadherin Complex Length = 538 Back     alignment and structure
>pdb|3OUW|A Chain A, Structure Of Beta-Catenin With Lef-1 Length = 540 Back     alignment and structure
>pdb|1JPW|A Chain A, Crystal Structure Of A Human Tcf-4 BETA-Catenin Complex Length = 540 Back     alignment and structure
>pdb|2Z6H|A Chain A, Crystal Structure Of Beta-Catenin Armadillo Repeat Region And Its C-Terminal Domain Length = 644 Back     alignment and structure
>pdb|1G3J|A Chain A, Crystal Structure Of The Xtcf3-CbdBETA-Catenin Armadillo Repeat Complex Length = 532 Back     alignment and structure
>pdb|1QZ7|A Chain A, Beta-Catenin Binding Domain Of Axin In Complex With Beta- Catenin Length = 533 Back     alignment and structure
>pdb|3TX7|A Chain A, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 527 Back     alignment and structure
>pdb|1LUJ|A Chain A, Crystal Structure Of The Beta-CateninICAT COMPLEX Length = 514 Back     alignment and structure
>pdb|2BCT|A Chain A, The Armadillo Repeat Region From Murine Beta-Catenin Length = 516 Back     alignment and structure
>pdb|4DJS|A Chain A, Structure Of Beta-Catenin In Complex With A Stapled Peptide Inhibitor Length = 518 Back     alignment and structure
>pdb|1JDH|A Chain A, Crystal Structure Of Beta-Catenin And Htcf-4 Length = 529 Back     alignment and structure
>pdb|1T08|A Chain A, Crystal Structure Of Beta-CateninICAT HELICAL DomainUNPHOSPHORYLATED APC R3 Length = 519 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|1XM9|A Chain A, Structure Of The Armadillo Repeat Domain Of Plakophilin 1 Length = 457 Back     alignment and structure
>pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 Back     alignment and structure
>pdb|3IFQ|A Chain A, Interction Of Plakoglobin And Beta-Catenin With Desmosomal Cadherins Length = 553 Back     alignment and structure
>pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 Back     alignment and structure
>pdb|3LTM|A Chain A, Structure Of A New Family Of Artificial Alpha Helicoidal Repeat Proteins (Alpha-Rep) Based On Thermostable Heat-Like Repeats Length = 211 Back     alignment and structure
>pdb|3LTJ|A Chain A, Structure Of A New Family Of Artificial Alpha Helicoidal Repeat Proteins (Alpha-Rep) Based On Thermostable Heat-Like Repeats Length = 201 Back     alignment and structure
>pdb|3GA1|A Chain A, Crystal Structure Of The Human Nac1 Poz Domain Length = 129 Back     alignment and structure
>pdb|3SLA|A Chain A, X-Ray Structure Of First Four Repeats Of Human Beta-Catenin Length = 168 Back     alignment and structure
>pdb|3SL9|A Chain A, X-Ray Structure Of Beta Catenin In Complex With Bcl9 Length = 167 Back     alignment and structure
>pdb|3TT9|A Chain A, Crystal Structure Of The Stable Degradation Fragment Of Human Plakophilin 2 Isoform A (Pkp2a) C752r Variant Length = 233 Back     alignment and structure
>pdb|2Z6G|A Chain A, Crystal Structure Of A Full-Length Zebrafish Beta-Catenin Length = 780 Back     alignment and structure
>pdb|1CS3|A Chain A, Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN FROM PROMELOCYTIC Leukemia Zinc Finger Oncoprotein Length = 116 Back     alignment and structure
>pdb|1BUO|A Chain A, Btb Domain From Plzf Length = 121 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-72
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-64
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-63
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 9e-62
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 6e-60
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 7e-50
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-42
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-72
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 9e-65
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-64
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-63
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-57
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-51
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-42
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-29
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-71
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-64
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-63
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-62
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-59
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-41
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-32
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 7e-66
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-58
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-51
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-65
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-44
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-42
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-36
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-16
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-64
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-45
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-42
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-35
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-64
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-50
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-44
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 7e-64
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-45
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-43
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-28
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-16
3nmz_A458 APC variant protein; protein-protein complex, arma 9e-07
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-59
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-58
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-46
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-40
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-58
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-42
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-33
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-33
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-23
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 4e-20
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-52
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 5e-48
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 2e-47
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-38
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-33
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-28
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-18
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-17
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-36
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-35
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-35
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-24
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-09
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 7e-36
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 4e-35
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-34
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 7e-32
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 6e-24
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-35
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-23
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 9e-20
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-18
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-34
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-27
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-27
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-16
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-31
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 8e-29
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 3e-25
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 2e-24
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-24
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-22
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 1e-22
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 3e-22
2vpk_A116 Myoneurin; transcription regulation, transcription 4e-22
3b84_A119 Zinc finger and BTB domain-containing protein 48; 4e-22
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 6e-22
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-21
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 7e-20
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 9e-20
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 3e-19
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 4e-18
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-15
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-10
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 5e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-14
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-14
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 9e-09
2db0_A253 253AA long hypothetical protein; heat repeats, hel 4e-14
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 4e-14
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-08
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-10
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-07
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 4e-06
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-10
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 7e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-08
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 2e-06
3grl_A651 General vesicular transport factor P115; vesicle t 2e-06
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 8e-06
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 8e-04
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 8e-04
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
 Score =  243 bits (623), Expect = 2e-72
 Identities = 84/386 (21%), Positives = 146/386 (37%), Gaps = 34/386 (8%)

Query: 134 EHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVED 193
                 + T A+P L  LL       +      V+ +AA  +  L+ + A+    +R   
Sbjct: 8   YQDDAELATRAIPELTKLLN----DEDQ----VVVNKAAVMVHQLSKKEASRHAIMRSPQ 59

Query: 194 GIPPLVELLKF-VDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVH 252
            +  +V  ++   DV+  R  AG L  L+  + E    I +   +P LV ML S   SV 
Sbjct: 60  MVSAIVRTMQNTNDVETARCTAGTLHNLS-HHREGLLAIFKSGGIPALVKMLGSPVDSVL 118

Query: 253 FEAVGVIGNLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSK 312
           F A+  + NL+      K  V LAG LQ ++ LL+ +  +        L   A  +  SK
Sbjct: 119 FYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESK 178

Query: 313 VHIVQRGAVRPLIEMLQSPD-SQLKEMSAFALGRLAQDTHNQAGIAQDGGILPLLKLLDS 371
           + I+  G  + L+ ++++    +L   ++  L  L+  + N+  I + GG+  L   L  
Sbjct: 179 LIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTD 238

Query: 372 KNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKL----QDGEFTVQPTKDCVARTLKRL 427
            +  L  N  + L  L+D           G +  L       +  V     C A  L  L
Sbjct: 239 PSQRLVQNCLWTLRNLSDAATKQ--EGMEGLLGTLVQLLGSDDINVV---TCAAGILSNL 293

Query: 428 --------EEKVHGRVLNHLLYLLRVA--DRAVKRRVTLALAHLCAPDDC----KTIFID 473
                           +  L+  +  A     +      AL HL +        +     
Sbjct: 294 TCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRL 353

Query: 474 NNGLELLLGLLESTSVKQREESSVAL 499
           + GL +++ LL   S     +++V L
Sbjct: 354 HYGLPVVVKLLHPPSHWPLIKATVGL 379


>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query704
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.98
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.96
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.95
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.93
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.92
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.91
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.91
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.88
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.88
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.87
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.86
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.86
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.86
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.85
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.85
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.85
2vpk_A116 Myoneurin; transcription regulation, transcription 99.85
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.83
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.83
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.83
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.82
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.82
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.82
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.79
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.78
3grl_A651 General vesicular transport factor P115; vesicle t 99.72
3grl_A651 General vesicular transport factor P115; vesicle t 99.66
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.65
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.64
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.62
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.62
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.57
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.54
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.54
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.52
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.47
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.46
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.44
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.43
1qgr_A876 Protein (importin beta subunit); transport recepto 99.41
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.4
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.38
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.38
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.37
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.36
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.34
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.31
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.29
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.25
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.19
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.15
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.11
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.09
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.07
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 98.98
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.96
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 98.89
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.74
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.71
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.66
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.61
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.6
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.59
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.57
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.56
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.55
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.53
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.49
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.45
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.42
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.39
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.34
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.29
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.27
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.26
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.24
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.21
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.19
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.18
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.97
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.91
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.84
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.78
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.67
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.4
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.26
2x19_B963 Importin-13; nuclear transport, protein transport; 97.01
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.99
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.98
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.92
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 96.9
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.87
2x19_B963 Importin-13; nuclear transport, protein transport; 96.85
3oc3_A800 Helicase MOT1, MOT1; regulation of transcription, 96.84
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.8
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.77
3oc3_A800 Helicase MOT1, MOT1; regulation of transcription, 96.76
2x1g_F971 Cadmus; transport protein, developmental protein, 96.74
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.73
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.53
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.53
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.47
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 96.33
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.3
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.2
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.17
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 95.93
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.88
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 95.87
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.67
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.67
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.35
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.27
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.02
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 94.88
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.68
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 94.64
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 94.58
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 94.56
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.25
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 94.17
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 93.88
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 93.7
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 93.51
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 92.96
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 92.63
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 91.43
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 91.13
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 89.03
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 87.64
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 86.68
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 86.44
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 85.14
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 84.68
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=100.00  E-value=1.6e-38  Score=343.76  Aligned_cols=403  Identities=20%  Similarity=0.287  Sum_probs=340.3

Q ss_pred             HHHHHHHhhhccCCchhhHHHHHHHHHHHHHhhcChhHHHHHHhCCChHHHHhhccCCCcCCCCCCCCchHHHHHHHHHH
Q 005282           47 IRAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFAL  126 (704)
Q Consensus        47 ~~~l~~~l~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~l~~~g~i~~L~~lL~~~~~~~~~~~~~d~~v~~~a~~~L  126 (704)
                      +++++..+   .+.+.+.+.....+++.|.+...+|.. +.+++.|+||.|+++|+..+.         ++++..|+|+|
T Consensus        59 i~~~v~~l---~s~d~~~q~~a~~~~rklls~e~~ppi-~~ii~~G~ip~LV~lL~~~~~---------~~lq~~Aa~aL  125 (510)
T 3ul1_B           59 VEDIVKGI---NSNNLESQLQATQAARKLLSREKQPPI-DNIIRAGLIPKFVSFLGKTDC---------SPIQFESAWAL  125 (510)
T ss_dssp             HHHHHHHH---TSSCHHHHHHHHHHHHHHHTCSSCCCH-HHHHHTTHHHHHHHHTTCTTC---------HHHHHHHHHHH
T ss_pred             HHHHHHHh---cCCCHHHHHHHHHHHHHHhcCCCCchH-HHHHHCCCHHHHHHHHCCCCC---------HHHHHHHHHHH
Confidence            56666554   344444444444444444333345555 677899999999999987653         58999999999


Q ss_pred             Hhhc-CChhhHHHHHHcCCcHHHHHHHhhccCCCCCcchhHHHHHHHHHHHHhhhcChhhhhhhhccCCcHHHHHHhcCC
Q 005282          127 GLLA-VKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKFV  205 (704)
Q Consensus       127 ~~l~-~~~~~~~~~~~~g~l~~L~~lL~~~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~~~  205 (704)
                      +||+ ++++.+..+++.|++|.|+.+|++++.        ++++.|+|+|+|++.+++..+..+...|+++.|+.++.++
T Consensus       126 ~nias~~~e~~~~vv~~GaIp~Lv~lL~s~~~--------~v~e~A~~aL~nLa~d~~~~r~~v~~~G~i~~Ll~lL~~~  197 (510)
T 3ul1_B          126 TNIASGTSEQTKAVVDGGAIPAFISLLASPHA--------HISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVP  197 (510)
T ss_dssp             HHHHTSCHHHHHHHHHTTHHHHHHHHTTCSCH--------HHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSS
T ss_pred             HHHhcCCHHHHHHHHHCCCHHHHHHHHcCCCH--------HHHHHHHHHHHHHHhCCHHHHHHHHHcCChHHHHHHHHhc
Confidence            9999 899999999999999999999998765        9999999999999998999999999999999999999865


Q ss_pred             C-----HHHHHHHHHHHHHhccCCchhhHHhHhcCChHHHHHhhcCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCCHH
Q 005282          206 D-----VKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQ  280 (704)
Q Consensus       206 ~-----~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~l~  280 (704)
                      +     ..+++.+++++.+++.+...........++++.|+.++.+++++++..++++|.+++..++.....+...|+++
T Consensus       198 ~~~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~A~~aL~~L~~~~~~~~~~i~~~g~i~  277 (510)
T 3ul1_B          198 DLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVP  277 (510)
T ss_dssp             CGGGSCHHHHHHHHHHHHHHHCCCSSCCCHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTSSCHHHHHHHHTTTCHH
T ss_pred             cchhhhHHHHHHHHHHHHHHhhcccchhHHHHHHhHHHHHHHHHhcCCHHHHHHHHHHHHHHhhchhhhHHHHHhcccch
Confidence            4     45788999999999975555444455567899999999999999999999999999988888888888999999


Q ss_pred             HHHHHhcCCChhHHHHHHHHHHHHhccCCcchHHHHhcCChHHHHHhhCCCCHHHHHHHHHHHHHhhcCCchh-hhHHhh
Q 005282          281 PVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQ-AGIAQD  359 (704)
Q Consensus       281 ~L~~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~-~~~~~~  359 (704)
                      .|+.++.+++..++..++++|+|++.+++.....+.+.|+++.|+.++++++..+++.|+|+|+|++.+.... ..+.+.
T Consensus       278 ~Lv~lL~~~~~~v~~~al~aL~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~~~~v~~~A~~aL~nl~a~~~~~~~~v~~~  357 (510)
T 3ul1_B          278 QLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH  357 (510)
T ss_dssp             HHHHHHTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTGGGGCC-CTTCSSHHHHHHHHHHHHHHTTSCHHHHHHHHHT
T ss_pred             hhhhhhcCCChhhhhHHHHHHHHhhcCCHHHHHHHhhccchHHHHHHhcCCCHHHHHHHHHHHHHHHcCcHHHHHHHHhc
Confidence            9999999999999999999999999888888888999999999999999999999999999999999876554 456778


Q ss_pred             CChHHHHHhhcCCChhHHHHHHHHHHHccc--CCchhhHHHhhCCcccccccccccccchHHHHHHHHHHHHHhhcchhH
Q 005282          360 GGILPLLKLLDSKNGSLQHNAAFALYGLAD--NEDNVADLVRVGGVQKLQDGEFTVQPTKDCVARTLKRLEEKVHGRVLN  437 (704)
Q Consensus       360 ~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~--~~~~~~~l~~~g~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  437 (704)
                      |+++.|+.++.+++..++..|+++|.|++.  +++.+..+++.|+++                                 
T Consensus       358 g~i~~Lv~lL~~~~~~v~~~Aa~aL~Nl~~~~~~~~~~~L~~~g~i~---------------------------------  404 (510)
T 3ul1_B          358 GLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIE---------------------------------  404 (510)
T ss_dssp             THHHHHHHHHHSSCHHHHHHHHHHHHHHHHHCCHHHHHHHHHTTCHH---------------------------------
T ss_pred             CCHHHHHHHHcCCCHHHHHHHHHHHHHHHccCCHHHHHHHHHCCCHH---------------------------------
Confidence            999999999999999999999999999985  566777888877754                                 


Q ss_pred             HHHHHHhhccHHHHHHHHHHHHhccC-------CCccceeeecCCcHHHHHHHHhhcchhhhhhHHHHHHHHh
Q 005282          438 HLLYLLRVADRAVKRRVTLALAHLCA-------PDDCKTIFIDNNGLELLLGLLESTSVKQREESSVALYKLA  503 (704)
Q Consensus       438 ~L~~ll~~~~~~v~~~a~~~L~~l~~-------~~~~~~~l~~~~~i~~L~~ll~~~~~~~~~~a~~~L~~L~  503 (704)
                      +|+.++.+.++.++..++++|.++..       .+..+..+.+.||++.|..+..+++.++...|...|...-
T Consensus       405 ~L~~LL~~~d~~i~~~~L~aL~nil~~~~~~~~~~~~~~~iee~ggl~~ie~Lq~~~n~~i~~~A~~iie~yf  477 (510)
T 3ul1_B          405 PLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYF  477 (510)
T ss_dssp             HHHHGGGCSCHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHHC
T ss_pred             HHHHHhcCCCHHHHHHHHHHHHHHHHHhHhccchHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHHHHHC
Confidence            47778899999999999999999842       1223355678899999999988999999999988887654



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 704
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 6e-23
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-18
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 1e-13
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-22
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-22
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-21
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-20
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-15
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-11
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-04
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-22
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-19
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-17
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-16
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-16
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-14
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 1e-20
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-19
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-18
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 9e-18
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-06
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-05
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 8e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-04
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 0.002
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 0.003
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 3e-04
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 4e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 0.002
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 0.004
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  100 bits (249), Expect = 6e-23
 Identities = 87/464 (18%), Positives = 170/464 (36%), Gaps = 68/464 (14%)

Query: 3   RRERQTSPARRS------LKRKLEQDFEEKPDRKVSIVESGATQQDLVQDIRAQI-DILN 55
           RR+ Q    R++       KR+      +  D       S +  Q     ++ ++  +  
Sbjct: 24  RRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQMTQ 83

Query: 56  SKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYE 115
              S D  ++ +A      ++       I  +++  G VP LVE ++             
Sbjct: 84  QLNSDDMQEQLSATVKFRQILSREHRPPI-DVVIQAGVVPRLVEFMRENQ---------P 133

Query: 116 HEVEKECAFALGLLAV-KPEHQQIIVDTGALPHLVSLLKQYKNGGNSRAL---------- 164
             ++ E A+AL  +A       +++VD  A+P  + LL         +A+          
Sbjct: 134 EMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDS 193

Query: 165 ------------------------SGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVE 200
                                     +IR A   ++NL            V   +P L +
Sbjct: 194 TDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAK 253

Query: 201 LLKFVDVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIG 260
           L+  +D +    A  A+  L+    E  + +++      LV +L  E   V   A+  +G
Sbjct: 254 LIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVG 313

Query: 261 NLVHSSPSIKKEVILAGALQPVIGLLSSSCSESKREAALLLGQFAAADSNSKVHIVQRGA 320
           N+V  +    + VI AG L  +  LLSS     K+EA   +    A ++     ++    
Sbjct: 314 NIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANL 373

Query: 321 VRPLIEMLQSPDSQLKEMSAFALGRLAQDTHNQAGI----AQDGGILPLLKLLDSKNGSL 376
           + PL+++L+  + + K+ + +A+   +     +  I       G I PL  LL+  +  +
Sbjct: 374 IPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRI 433

Query: 377 QHNAAFALYGLAD-----------NEDNVADLV-RVGGVQKLQD 408
                 AL  +             N +  AD + + GG++K+ +
Sbjct: 434 IEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFN 477


>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query704
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.97
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.96
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.87
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.8
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.8
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.56
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.52
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.39
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.37
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.04
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.02
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.02
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.9
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.9
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.85
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.65
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.62
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.62
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.58
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.56
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.55
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.3
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.06
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.03
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.88
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.95
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.78
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.61
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.51
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.24
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 95.64
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 95.57
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.47
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 94.9
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 93.37
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 92.31
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 91.77
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 90.07
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 85.27
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.9e-34  Score=308.68  Aligned_cols=433  Identities=19%  Similarity=0.220  Sum_probs=362.0

Q ss_pred             HHHHHHhhhccCCchhhHHHHHHHHHHHHHhhcChhHHHHHHhCCChHHHHhhccCCCcCCCCCCCCchHHHHHHHHHHH
Q 005282           48 RAQIDILNSKFSSDETDRAAAKTASHALVEFAKNEEIVSLIVDNGAVPALVEHLQTPPQLTNAQIPYEHEVEKECAFALG  127 (704)
Q Consensus        48 ~~l~~~l~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~l~~~g~i~~L~~lL~~~~~~~~~~~~~d~~v~~~a~~~L~  127 (704)
                      +.+++.|..++...+ +...+..++.+|.+++.+++.+..+++.|+++.|+.+|++++.          +++..|+++|+
T Consensus        58 ~~~v~~l~~~L~~~~-~~~~~~~a~~~L~~l~~~~~~~~~i~~~g~i~~Li~lL~~~~~----------~v~~~a~~aL~  126 (529)
T d1jdha_          58 PQMVSAIVRTMQNTN-DVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVD----------SVLFYAITTLH  126 (529)
T ss_dssp             HHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHTTCSCH----------HHHHHHHHHHH
T ss_pred             hhHHHHHHHHHcCCC-CHHHHHHHHHHHHHHhCCchhHHHHHHCCCHHHHHHHhCCCCH----------HHHHHHHHHHH
Confidence            344555555553222 3346888999999999999999999999999999999998754          99999999999


Q ss_pred             hhc-CChhhHHHHHHcCCcHHHHHHHhhccCCCCCcchhHHHHHHHHHHHHhhhcChhhhhhhhccCCcHHHHHHhcC-C
Q 005282          128 LLA-VKPEHQQIIVDTGALPHLVSLLKQYKNGGNSRALSGVIRRAADAITNLAHENANIKTRVRVEDGIPPLVELLKF-V  205 (704)
Q Consensus       128 ~l~-~~~~~~~~~~~~g~l~~L~~lL~~~~~~~~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~~-~  205 (704)
                      +++ +++..+..+.+.|+++.|+.+|++.+.        +++..++++|.+++..++..+..+...|+++.|+.++.+ +
T Consensus       127 ~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~--------~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~  198 (529)
T d1jdha_         127 NLLLHQEGAKMAVRLAGGLQKMVALLNKTNV--------KFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYT  198 (529)
T ss_dssp             HHHHHCTTHHHHHHHHTHHHHHHHGGGCCCH--------HHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHHHHHCC
T ss_pred             HhhcccchhhhHHHhcCCchHHHHHHHccCh--------HHHHHHHHHHHHHhhhhhHHHHHHHhcccchHHHHHHHhhh
Confidence            999 788889999999999999999987665        999999999999998888888999999999999999974 5


Q ss_pred             CHHHHHHHHHHHHHhccCCchhhHHhHhcCChHHHHHhhcCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCCHHHHHHH
Q 005282          206 DVKVQRAAAGALRTLAFKNDENKKLIVECNALPTLVLMLRSEDASVHFEAVGVIGNLVHSSPSIKKEVILAGALQPVIGL  285 (704)
Q Consensus       206 ~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~l~~L~~l  285 (704)
                      +..++..+++++.+++. +++++..+.+.|+++.|+.++.+++..++..+++++.+++.....   .....|+++.|+.+
T Consensus       199 ~~~~~~~~~~~l~~ls~-~~~~~~~~~~~g~~~~L~~ll~~~~~~~~~~a~~~l~~ls~~~~~---~~~~~~~i~~Lv~l  274 (529)
T d1jdha_         199 YEKLLWTTSRVLKVLSV-CSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATK---QEGMEGLLGTLVQL  274 (529)
T ss_dssp             CHHHHHHHHHHHHHHTT-STTHHHHHHHTTHHHHHHTTTTSSCHHHHHHHHHHHHHHHTTCTT---CSCCHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHhhhhc-cccccchhhhhhhhhhHHHHhcccchhhhhhhhhHHHhccccccc---hhhhhhcchhhhhh
Confidence            57899999999999996 788999999999999999999999999999999999999855332   12234679999999


Q ss_pred             hcCCChhHHHHHHHHHHHHhccCCcchHHHHhcCChHHHHHhhC--CCCHHHHHHHHHHHHHhhcCCch----hhhHHhh
Q 005282          286 LSSSCSESKREAALLLGQFAAADSNSKVHIVQRGAVRPLIEMLQ--SPDSQLKEMSAFALGRLAQDTHN----QAGIAQD  359 (704)
Q Consensus       286 l~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~ll~--~~~~~v~~~a~~~L~~l~~~~~~----~~~~~~~  359 (704)
                      +.+++..++..++.+|++++..++.++..+.+.++++.|+..+.  ++.+.+++.++++|++++.....    +..+...
T Consensus       275 l~~~~~~~~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~Li~~l~~~~~~~~~~~~a~~aL~~l~~~~~~~~~~~~~i~~~  354 (529)
T d1jdha_         275 LGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLH  354 (529)
T ss_dssp             TTCSCHHHHHHHHHHHHHHTTTCHHHHHHHHHTTHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSSTTHHHHHHHHHHT
T ss_pred             cccccHHHHHHHHHHHHhhccchhHHHHHHHHhhhHHHHHHHHHhhhcchhHHHHHHHHhhcccchhhcchhhhhhHHhc
Confidence            99999999999999999999877788888889999999999884  46688999999999999976543    3446678


Q ss_pred             CChHHHHHhhcCC-ChhHHHHHHHHHHHcccCCchhhHHHhhCCccccccccccccc-----------------------
Q 005282          360 GGILPLLKLLDSK-NGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQDGEFTVQP-----------------------  415 (704)
Q Consensus       360 ~~~~~L~~ll~~~-~~~v~~~a~~~L~~l~~~~~~~~~l~~~g~i~~l~~~~~~~~~-----------------------  415 (704)
                      ++++.++.++..+ +..++..++++|.+++.+++++..+.+.|+++.+++.......                       
T Consensus       355 ~~l~~L~~ll~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~g~i~~L~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~~  434 (529)
T d1jdha_         355 YGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEE  434 (529)
T ss_dssp             TCHHHHHHTTSTTCCHHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHC-----------CBTTBCHHH
T ss_pred             ccchhHHHHHhccchHHHHHHHHHHHhhcchhhhhhhhhhhcccHHHHHHHHhcCCHHHHHHHHhhhhhHHhhcccchHH
Confidence            9999999999764 4568889999999999999999999999999887643211100                       


Q ss_pred             chHHHHHHHHHHH-------HHhhcchhHHHHHHHhhccHHHHHHHHHHHHhccCCCccceeeecCCcHHHHHHHHhhcc
Q 005282          416 TKDCVARTLKRLE-------EKVHGRVLNHLLYLLRVADRAVKRRVTLALAHLCAPDDCKTIFIDNNGLELLLGLLESTS  488 (704)
Q Consensus       416 ~~~~~~~~~~~~~-------~~~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~l~~~~~i~~L~~ll~~~~  488 (704)
                      ........+....       .....+.++.|+.++.++++.++..++++|++|+.+++.+..+.+.||++.|++++.+++
T Consensus       435 ~~~~~~~al~~la~~~~~r~~~~~~~~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~i~~~g~~~~L~~Ll~s~n  514 (529)
T d1jdha_         435 IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRN  514 (529)
T ss_dssp             HHHHHHHHHHHHTTSHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSHHHHHHHHHTTCHHHHHHGGGCSS
T ss_pred             HHHHHHHHHHHHccCHHHHHHHHHCCCHHHHHHHhCCCCHHHHHHHHHHHHHHhcChhhHHHHHHCCCHHHHHHHhCCCC
Confidence            0111111121111       111456789999999999999999999999999988888888899999999999999999


Q ss_pred             hhhhhhHHHHHHHHh
Q 005282          489 VKQREESSVALYKLA  503 (704)
Q Consensus       489 ~~~~~~a~~~L~~L~  503 (704)
                      +.++..|+.+|.+|+
T Consensus       515 ~~v~~~a~~aL~~ls  529 (529)
T d1jdha_         515 EGVATYAAAVLFRMS  529 (529)
T ss_dssp             HHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHhC
Confidence            999999999999874



>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure