Citrus Sinensis ID: 005407

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKISHVPNISFTPPGPAAQGSL
ccccccccccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccccEEccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHccccccccccccccHHHHHccccccccccHHHHccccccccccEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEEEcHHHHHHHHHHHHccEEEEEcccccccccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccHHHHHccccEEccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHcccccEEcccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEcccccccccccccccHHccccccccccEEEEEEccccccHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccEEEccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEccccccccccc
ccHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHcccccccEEcccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHcHHcccccccccccHHHEEcHccccHHHHHHHHEEEEccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEccccccccccccHccccccEEEEEcccccccccccccccccccEEEEEcccccHHHccccccccccccEEEEccccccccccHHcccccccEEEEEcccccHccccHHHcccccccEEEEcccccHccccccccccccccEEEEEEccccccccccccHcHHHHHHHccccccHHHcccccccccHHHHHHccccccccccEEEcccccccccccHHHHHHHccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccHHHcccccHHHHHHcccccccccccccccccccEEEEcccHcHHccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHccccccccccccHcccccEEEccccccHcccc
mqlhesiegkKFFLVLDdvwteepqnwerlwgclrcgskgsrilvTTRKVKVAIAIGttksniipiellsdedcWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELeevdkgllgplllsyrdlppplkkcflycaifpkdsmlEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFqdfersehdgrkiirckMHDIVHDFSQFLtktecsaldvnksrlqlpcwkARHLMIMGemskevpfpsfvynetklrslavprrLYYKRTIAssklfdrltclrsidgppvrkipkGIKKLIHLRYLALGWNPWIKELPEALCELCnlqtldvsgcdnlkRLPERIGELINLRHlmnsrqddssymprgmeRLTSLRTLGSFvasrgksskacSRLKSLNKLKHlegsltlrrlgnerdlgddnddekvdLKSKMRLVELNLWfdrttetkghrvvleclqpprsleKLEILAyegdtipptsnwmlSLTKLRVLTLRHcflceclpclgklpcletltlegmtSVKRLGNEflgiaeddqargdqaetassiirdtaFPRLETLIFLLMTNweewddceiaggktimprlrhlsicwspelkalpdyilgstsLDKLLIYYSRHLnnrynmetgpewpkishvpnisftppgpaaqgsl
mqlhesiegkkffLVLDDVWTEEPQnwerlwgclrcgskgsrilvttrKVKVAIaigttksniipiellSDEDCWSIFSQVALSIRSDIEEYKKFENIGRqiigkckglpLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETklrslavprrlYYKRtiassklfdrltclrsidgppvrkipkgiKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGElinlrhlmnsrqddssymPRGMERLTSLRTLGSfvasrgksskacsrlkslnklkhlegsltlrrlgnerdlgddnddekvdlkskmrlvelnlwfdrttetkghrvvleclqpprsLEKLEILAYEgdtipptsnwMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETassiirdtafpRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKIShvpnisftppgpaaqgsl
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVleselweleeVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKISHVPNISFTPPGPAAQGSL
********GKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHL*******************************************************************************MRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIA**************SIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKI*******************
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVAL***********FENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVN*****LPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTT******VVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQ*********DTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNR*******EWPKISHVPNISFTPPGPA*****
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSF**********CSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQ********ASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKISHVPNISFTPP********
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKISHVPNISFTPP********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYKRTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYSRHLNNRYNMETGPEWPKISHVPNISFTPPGPAAQGSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query698 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.797 0.568 0.333 1e-80
Q7XA40992 Putative disease resistan N/A no 0.740 0.521 0.360 2e-80
Q9LRR4 1054 Putative disease resistan yes no 0.865 0.573 0.343 9e-80
Q7XBQ9970 Disease resistance protei N/A no 0.723 0.520 0.355 2e-76
Q7XA39 988 Putative disease resistan N/A no 0.813 0.574 0.340 1e-74
Q9LRR5 1424 Putative disease resistan no no 0.862 0.422 0.310 5e-67
Q39214926 Disease resistance protei no no 0.542 0.409 0.313 4e-43
Q38834852 Disease resistance RPP13- no no 0.720 0.590 0.281 9e-43
Q8W4J9908 Disease resistance protei no no 0.879 0.676 0.275 1e-33
P59584910 Disease resistance protei no no 0.882 0.676 0.274 2e-33
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  301 bits (772), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 216/648 (33%), Positives = 324/648 (50%), Gaps = 91/648 (14%)

Query: 2   QLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKS 61
           +L E + GK++FLVLDDVW E+   W  L   L+ G+ G+ +L TTR  KV   +GT + 
Sbjct: 246 KLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQ- 304

Query: 62  NIIPIEL--LSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSL 119
              P EL  LS EDCW +F Q A   + +I        IG++I+ KC G+PLA KTLG +
Sbjct: 305 ---PYELSNLSPEDCWFLFMQRAFGHQEEIN--PNLMAIGKEIVKKCGGVPLAAKTLGGI 359

Query: 120 LRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLE 179
           LRFKR+  EW+ V +S +W L + +  +L  L LSY  LP  L++CF+YCA+FPKD+ + 
Sbjct: 360 LRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMA 419

Query: 180 KDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDI 239
           K+ LI  WMA  +L  KG  ++E VG E +  L + S FQ+ E     G+     KMHD+
Sbjct: 420 KENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEV--ESGKTYF--KMHDL 475

Query: 240 VHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAV 299
           +HD +  L     S+ ++     ++      ++M +G       F   V           
Sbjct: 476 IHDLATSLFSANTSSSNIR----EINANYDGYMMSIG-------FAEVV----------- 513

Query: 300 PRRLYYKRTIASSKLFDRLTCLRSID--GPPVRKIPKGIKKLIHLRYLALGWNPWIKELP 357
                   +  S  L  +   LR ++     + ++P  I  L+HLRYL L  N  I+ LP
Sbjct: 514 --------SSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLP 565

Query: 358 EALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTL 417
           + LC+L NLQTLD+  CD+L  LP++  +L +LR+L+      +S  PR +  LT L++L
Sbjct: 566 KRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPR-IGLLTCLKSL 624

Query: 418 GSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVE 477
             FV  + K  +    LK+LN    L GS+++ +L   +    D D ++ +L +K  L  
Sbjct: 625 SCFVIGKRKGHQ-LGELKNLN----LYGSISITKLDRVK---KDTDAKEANLSAKANLHS 676

Query: 478 LNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLS--LTKLRVLTL 535
           L L +D   + +    VLE L+P  +L+ LEI  + G  +P   +WM    L  +  + +
Sbjct: 677 LCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLP---DWMNQSVLKNVVSIRI 733

Query: 536 RHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDT 595
           R C  C CLP  G+LPCLE+L L         G+  +   ED+   G             
Sbjct: 734 RGCENCSCLPPFGELPCLESLELHT-------GSADVEYVEDNVHPG------------- 773

Query: 596 AFPRLETLIFLLMTNWEEWDDCEIAG-----GKTIMPRLRHLSICWSP 638
            FP L  L+         WD   + G     G+   P L  ++  W P
Sbjct: 774 RFPSLRKLVI--------WDFSNLKGLLKMEGEKQFPVLEEMTFYWCP 813
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query698
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.946 0.744 0.447 1e-144
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.934 0.689 0.446 1e-139
224115686 938 cc-nbs-lrr resistance protein [Populus t 0.924 0.687 0.429 1e-138
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.949 0.671 0.425 1e-138
359482790 923 PREDICTED: putative disease resistance p 0.926 0.700 0.418 1e-137
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.938 0.680 0.446 1e-136
359482788 903 PREDICTED: putative disease resistance p 0.911 0.704 0.434 1e-135
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.941 0.698 0.435 1e-135
359482769 904 PREDICTED: putative disease resistance p 0.912 0.704 0.428 1e-132
224115608 922 cc-nbs-lrr resistance protein [Populus t 0.905 0.685 0.427 1e-132
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 316/706 (44%), Positives = 428/706 (60%), Gaps = 45/706 (6%)

Query: 3   LHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSN 62
           + ESI GK+  LVLDDVWTE    WE+L   L   ++GSRILVTTRK  VA  +GT   +
Sbjct: 205 VSESITGKRLLLVLDDVWTENHGQWEQLKPSLTGCARGSRILVTTRKDAVATMMGT--DH 262

Query: 63  IIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRF 122
            I IE LSDE C SIF+ VA   RS+ +E ++  +IG +I  KCKGLPLA K LG L++ 
Sbjct: 263 RINIEKLSDEICRSIFNHVAFQERSE-DERERLTDIGDKIANKCKGLPLAAKVLGGLMQS 321

Query: 123 KRKIEEWQRVLESELWELEEVDKG-----LLGPLLLSYRDLPPPLKKCFLYCAIFPKDSM 177
           KR  EEW+RVL SELW L+EVD+      +  PLLLSY DLP  +++CFLYCA+FPKD  
Sbjct: 322 KRTREEWERVLSSELWRLDEVDRDQVESRIFIPLLLSYYDLPSVVRRCFLYCAMFPKDFE 381

Query: 178 LEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMH 237
           + KD+L+++WMAQ Y+K     DME+VGE YF  LA  S FQDFE    +G K    KMH
Sbjct: 382 MVKDELVKMWMAQGYIKETSGGDMELVGERYFHVLAARSFFQDFETDRFEGMKF---KMH 438

Query: 238 DIVHDFSQFLTKTECSALDVNK---SRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKL 294
           DIVHDF+Q++TK EC  +DVN    + ++    + RHL +M  +S+E  FP  ++    L
Sbjct: 439 DIVHDFAQYMTKNECLTVDVNTLGGATVETSIERVRHLSMM--VSEETSFPVSIHKAKGL 496

Query: 295 RSLAVPRRLYYKRTIASSKLFDRLTCLRSID--GPPVRKIPKGIKKLIHLRYLALGWNPW 352
           RSL +  R       A   LF +LTC+RS+D     +++IP  + KLIHLR++ L     
Sbjct: 497 RSLLIDTR-DPSFGAALPDLFKQLTCIRSLDLSASSIKEIPNEVGKLIHLRHVNLARCGE 555

Query: 353 IKELPEALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLT 412
           ++ LPE +C+LCNLQ+LDV+ C +LK LP  IG+LI LRHL   R     ++P+G+ER+T
Sbjct: 556 LESLPETMCDLCNLQSLDVTWCRSLKELPNAIGKLIKLRHLRIYRS-GVDFIPKGIERIT 614

Query: 413 SLRTLGSF-VASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKS 471
            LRTL  F V   G++    + L+ L  L H+ GS ++R LG    + D +D  +  LK+
Sbjct: 615 CLRTLDVFKVCGGGENESKAANLRELKNLNHIGGSFSIRNLGG--GIEDASDAAEAQLKN 672

Query: 472 KMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWMLSLTKLR 531
           K RL+ L L FD   E     +++E LQPP  LE L I +Y G  +P   +WM++LT+L+
Sbjct: 673 KKRLLRLELGFDYNQENG---ILIEALQPPSDLECLTISSYGGLDLP---HWMMTLTRLQ 726

Query: 532 VLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSI 591
            L L  C   E L  LG LP LE L L  +  V+RL   FLGI +D+ A  ++ E A   
Sbjct: 727 ELRLDDCTNLEVLRPLGGLPNLEILVLSSL-KVRRLDAGFLGIEKDENASINEGEIA--- 782

Query: 592 IRDTAFPRLETLIFLLMTNWEEWDDCEIAGGK---------TIMPRLRHLSICWSPELKA 642
            R TAFP+L+ L F  +   EEW+  E   G+         +IMP+L++L I   P L+A
Sbjct: 783 -RVTAFPKLKRLDFRHLLEVEEWEGIERRVGEEDVNTTSIISIMPQLQYLRIINCPLLRA 841

Query: 643 LPDYILGSTSLDKLLIYYSRHLNNRYNM-ETGPEWPKISHVPNISF 687
           LPDY+L +  L +L I +   L  RY   E G +W KISH+PN  F
Sbjct: 842 LPDYVLAA-PLQELDIRWCTILRKRYGKEEMGEDWQKISHIPNSYF 886

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115686|ref|XP_002332117.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874937|gb|EEF12068.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115608|ref|XP_002332098.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874918|gb|EEF12049.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query698
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.871 0.576 0.349 5.5e-77
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.918 0.450 0.317 4.6e-67
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.663 0.256 0.295 3.2e-44
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.722 0.591 0.283 4e-44
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.740 0.558 0.287 1.2e-41
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.617 0.475 0.286 5e-37
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.687 0.421 0.276 1.4e-34
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.808 0.627 0.285 1.7e-34
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.607 0.466 0.297 1.1e-33
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.616 0.473 0.297 1.9e-33
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 775 (277.9 bits), Expect = 5.5e-77, P = 5.5e-77
 Identities = 236/675 (34%), Positives = 339/675 (50%)

Query:     9 GKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVA-IAIGTTKSNIIPIE 67
             G  F LVLDD+W E   +W+ L       ++GS+ILVTTR  +VA I       N+ P  
Sbjct:   276 GLPFLLVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQP-- 333

Query:    68 LLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIE 127
              LSD DCWS+F +     +      ++  ++  +I+ KC+GLPLAVKTLG +LRF+ K+ 
Sbjct:   334 -LSDGDCWSLFMKTVFGNQEPCLN-REIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVI 391

Query:   128 EWQRVXXXXXXXXXXVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKDKLIRLW 187
             EW+RV              LL  L +SY  LP  LK+CF YC+IFPK    EKDK++ LW
Sbjct:   392 EWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLW 451

Query:   188 MAQDYLK-VKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVHDFSQF 246
             MA+ +L+  +  +++E +G EYF  L   SL Q  +          R  MHD +++ +QF
Sbjct:   452 MAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTKT---------RYIMHDFINELAQF 502

Query:   247 LTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETK-LR-----SLAVP 300
              +  E S+   +  +LQ+   + R+L  + +   E P       E K LR     SL   
Sbjct:   503 ASG-EFSSKFEDGCKLQVS-ERTRYLSYLRDNYAE-PMEFEALREVKFLRTFLPLSLTNS 559

Query:   301 RRLYYKRTIASSKLFDRLTCLR--SIDGPPVRKIPKGI-KKLIHLRYLALGWNPWIKELP 357
              R      + S KL   LT LR  S+    + ++P    K + H R+L L     +++LP
Sbjct:   560 SRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTE-LEKLP 618

Query:   358 EALCELCNLQTLDVSGCDNLKRLPERIGELINLRHLMNSRQDDSSYMPRGMERLTSLRTL 417
             ++LC + NLQTL +S C +LK LP  I  LINLR+L +        MPR   RL SL+TL
Sbjct:   619 KSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYL-DLIGTKLRQMPRRFGRLKSLQTL 677

Query:   418 GSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDNDDEKVDLKSKMRLVE 477
              +F  S    S    R+  L  L  L G L +  L    D+ D  +    +L SK  L E
Sbjct:   678 TTFFVSASDGS----RISELGGLHDLHGKLKIVELQRVVDVADAAE---ANLNSKKHLRE 730

Query:   478 LN-LWFDRTTE----TKGHRV-----VLECLQPPRSLEKLEILAYEGDTIPPTSNWML-- 525
             ++ +W   ++     T  HR      V E L+P R +EKL I  Y+G   P   +W+   
Sbjct:   731 IDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRFP---DWLSDP 787

Query:   526 SLTKLRVLTLRHCFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQA 585
             S +++  + LR C  C  LP LG+LPCL+ L + GM  ++ +G +F     D Q R DQ 
Sbjct:   788 SFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFY--FSDQQLR-DQD 844

Query:   586 ETASSIIRDTAFPRLETLIFLLMTNWEEWDDCEIAGGKTIMPRLRHLSICWSPELKA-LP 644
             +          F  LETL F  + +W+EW D  +  G  + P L+ L I   PEL   LP
Sbjct:   845 QQP--------FRSLETLRFDNLPDWQEWLDVRVTRGD-LFPSLKKLFILRCPELTGTLP 895

Query:   645 DYILGSTSLDKLLIY 659
              ++    SL  L IY
Sbjct:   896 TFL---PSLISLHIY 907
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03820007
cc-nbs-lrr resistance protein (888 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-52
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-07
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  182 bits (463), Expect = 3e-52
 Identities = 77/190 (40%), Positives = 111/190 (58%), Gaps = 7/190 (3%)

Query: 3   LHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSN 62
           + E++  K+F LVLDDVW +   +W+++      G  GSR++VTTR   VA  +G T S 
Sbjct: 93  IKEALLRKRFLLVLDDVWEKN--DWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGT-SK 149

Query: 63  IIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRF 122
              +E L  E+ W +FS                E + ++I+ KCKGLPLA+K LG LL F
Sbjct: 150 PHEVESLEPEESWELFSNKVFEKELPPCPE--LEEVAKEIVEKCKGLPLALKVLGGLLAF 207

Query: 123 KRKIEEWQRVLESELWELEE--VDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEK 180
           K  ++EW+ VLE    EL        +L  L LSY +LP  LK+CFLY A+FP+D  + K
Sbjct: 208 KSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRK 267

Query: 181 DKLIRLWMAQ 190
           ++LI+LW+A+
Sbjct: 268 EQLIKLWIAE 277

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 698
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.71
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.69
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.68
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.63
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.29
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.28
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.19
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.15
KOG4237498 consensus Extracellular matrix protein slit, conta 98.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.62
KOG4237498 consensus Extracellular matrix protein slit, conta 98.58
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.56
KOG4341483 consensus F-box protein containing LRR [General fu 98.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.33
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.0
PLN03150623 hypothetical protein; Provisional 98.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.95
PRK04841 903 transcriptional regulator MalT; Provisional 97.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
PLN03150623 hypothetical protein; Provisional 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.82
PRK15386 426 type III secretion protein GogB; Provisional 97.81
KOG4341483 consensus F-box protein containing LRR [General fu 97.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.38
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.01
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.9
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.5
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.22
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.17
PRK06893229 DNA replication initiation factor; Validated 96.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.75
PF05729166 NACHT: NACHT domain 95.42
COG3903414 Predicted ATPase [General function prediction only 95.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.89
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.55
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.5
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.18
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.85
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.67
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.41
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.94
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.72
PRK07471365 DNA polymerase III subunit delta'; Validated 91.64
PRK09087226 hypothetical protein; Validated 91.03
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.02
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.35
PF13173128 AAA_14: AAA domain 89.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.6
PRK13342413 recombination factor protein RarA; Reviewed 88.56
PRK09112351 DNA polymerase III subunit delta'; Validated 88.37
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 88.15
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 87.85
PRK05564313 DNA polymerase III subunit delta'; Validated 87.52
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.49
smart0037026 LRR Leucine-rich repeats, outliers. 86.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.94
TIGR02928365 orc1/cdc6 family replication initiation protein. M 85.87
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 84.94
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 84.68
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 84.45
PRK12402337 replication factor C small subunit 2; Reviewed 84.1
smart0037026 LRR Leucine-rich repeats, outliers. 83.66
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.66
PRK08727233 hypothetical protein; Validated 83.49
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.22
PRK05707328 DNA polymerase III subunit delta'; Validated 80.58
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-64  Score=561.56  Aligned_cols=579  Identities=28%  Similarity=0.431  Sum_probs=407.6

Q ss_pred             hhhhhcCCceEEEEEeCCCCCChhhHHHHHhhcCCCCCCcEEEEEeCchHHHHH-hCCCCccceeccCCChHhHHHHHHH
Q 005407            2 QLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIA-IGTTKSNIIPIELLSDEDCWSIFSQ   80 (698)
Q Consensus         2 ~l~~~L~~kr~LlVLDdvw~~~~~~~~~l~~~~~~~~~gs~IiiTTR~~~v~~~-~~~~~~~~~~v~~L~~~~a~~Lf~~   80 (698)
                      +|.+.|++|||+|||||||+.  .+|+.+..++|...+||||++|||++.||.. |++..  .++++.|..+|||.||++
T Consensus       253 ~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~--~~~v~~L~~~eaW~LF~~  328 (889)
T KOG4658|consen  253 KLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDY--PIEVECLTPEEAWDLFQK  328 (889)
T ss_pred             HHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCc--cccccccCccccHHHHHH
Confidence            477889999999999999986  4599999999999899999999999999998 77744  899999999999999999


Q ss_pred             HhhccCCchhhhhHHHHHHHHHHHHhCCChHHHHHHHHHhcccCCHHHHHHHHhhhhcc----cccccccchhhHhhhcc
Q 005407           81 VALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWE----LEEVDKGLLGPLLLSYR  156 (698)
Q Consensus        81 ~a~~~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~----~~~~~~~i~~~l~~sy~  156 (698)
                      .||.....  ..+.+.++|++||++|+|+|||++++|+.|+.+++.++|+++.+...+.    ..+.++.++.+++.|||
T Consensus       329 ~v~~~~~~--~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd  406 (889)
T KOG4658|consen  329 KVGPNTLG--SHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYD  406 (889)
T ss_pred             hhcccccc--ccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHh
Confidence            99987442  2445899999999999999999999999999999999999999865443    23345789999999999


Q ss_pred             CCChhHHHHHhhhcCCCCCCccCHHHHHHHHHhcCcccc-CCCccHHHHHHHHHHHHHhCCCcccccccCCCCeeEEEEE
Q 005407          157 DLPPPLKKCFLYCAIFPKDSMLEKDKLIRLWMAQDYLKV-KGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCK  235 (698)
Q Consensus       157 ~L~~~~k~~fl~~a~fp~~~~i~~~~Li~~wi~eg~~~~-~~~~~~~~~~~~~l~~L~~~~ll~~~~~~~~~~~~~~~~~  235 (698)
                      .||++.|.||+|||.||+++.|++++|+.+|+||||+.+ .++..+++.|..|+++|+.++|+......  +..  .+|+
T Consensus       407 ~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~--~~~k  482 (889)
T KOG4658|consen  407 NLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRK--ETVK  482 (889)
T ss_pred             hhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cce--eEEE
Confidence            999999999999999999999999999999999999988 44688999999999999999999876543  222  3899


Q ss_pred             echhHHHHHHHhcc-----cceeecccC-C---ccccCCCCcceEEEEEccCCCcccCCcccCCCCcceEEEecCccchh
Q 005407          236 MHDIVHDFSQFLTK-----TECSALDVN-K---SRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLRSLAVPRRLYYK  306 (698)
Q Consensus       236 ~hdlv~~~~~~~~~-----~~~~~~~~~-~---~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  306 (698)
                      |||+||++|.+++.     .++.+.... +   ......+..+|+++.+.+.....   ..-..+++|++|.+.++.. .
T Consensus       483 mHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L~tLll~~n~~-~  558 (889)
T KOG4658|consen  483 MHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKLRTLLLQRNSD-W  558 (889)
T ss_pred             eeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCccceEEEeecch-h
Confidence            99999999999998     554333322 1   11233445789999988876332   2233566899999998753 2


Q ss_pred             hhcccccccccCccceeeeCC---CCcccchhhcccccCceEeccccccccccchhhhcCCCCcEeeccCCCCCcccchh
Q 005407          307 RTIASSKLFDRLTCLRSIDGP---PVRKIPKGIKKLIHLRYLALGWNPWIKELPEALCELCNLQTLDVSGCDNLKRLPER  383 (698)
Q Consensus       307 ~~~~~~~~~~~l~~L~~L~l~---~~~~lp~~i~~l~~L~~L~L~~~~~l~~lp~~~~~l~~L~~L~l~~~~~l~~lp~~  383 (698)
                      .......+|..++.||+||++   .+.++|++|+.|.+||||+++++. +..+|..+++|+.|.+||+..+..+..+|..
T Consensus       559 l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i  637 (889)
T KOG4658|consen  559 LLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGI  637 (889)
T ss_pred             hhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccch
Confidence            233345668899999999999   778899999999999999999999 9999999999999999999998878888777


Q ss_pred             hhccccCCceecCCccCCCcCCcCCCCCCCCCccCceeccCCCCcccccccccccccccccCceeEccccCcCCCCCcch
Q 005407          384 IGELINLRHLMNSRQDDSSYMPRGMERLTSLRTLGSFVASRGKSSKACSRLKSLNKLKHLEGSLTLRRLGNERDLGDDND  463 (698)
Q Consensus       384 i~~l~~L~~L~l~~~~~~~~~p~~i~~L~~L~~L~~~~~~~~~~~~~~~~l~~l~~L~~L~~~l~i~~l~~~~~~~~~~~  463 (698)
                      +..|++||+|.+.... ...-...++.+.+|++|..........    ..+..+..+..++ ....              
T Consensus       638 ~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~----~~~e~l~~~~~L~-~~~~--------------  697 (889)
T KOG4658|consen  638 LLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSV----LLLEDLLGMTRLR-SLLQ--------------  697 (889)
T ss_pred             hhhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchh----HhHhhhhhhHHHH-HHhH--------------
Confidence            7779999999886542 111112233334444443332222110    0111222222221 0000              


Q ss_pred             hhcccccccccccceeeeeccCCCcccHHHhhccCCCCCCCceEEEEeecCCCCCCCCchh-----cc-ccCccEEEEcC
Q 005407          464 DEKVDLKSKMRLVELNLWFDRTTETKGHRVVLECLQPPRSLEKLEILAYEGDTIPPTSNWM-----LS-LTKLRVLTLRH  537 (698)
Q Consensus       464 ~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~p~~~-----~~-l~~L~~L~L~~  537 (698)
                                   .+.+..+      ........+..+.+|+.|.+.++...++.  ..|.     .. ++++..+...+
T Consensus       698 -------------~l~~~~~------~~~~~~~~~~~l~~L~~L~i~~~~~~e~~--~~~~~~~~~~~~f~~l~~~~~~~  756 (889)
T KOG4658|consen  698 -------------SLSIEGC------SKRTLISSLGSLGNLEELSILDCGISEIV--IEWEESLIVLLCFPNLSKVSILN  756 (889)
T ss_pred             -------------hhhhccc------ccceeecccccccCcceEEEEcCCCchhh--cccccccchhhhHHHHHHHHhhc
Confidence                         0000000      01122233344555666666555554321  1111     11 44566666666


Q ss_pred             CCCCCcCCCCCCCCCcceeeccCCcceeeeCccccCCCccccccccccccccccccCcCCCccccc-ccccccccccCcc
Q 005407          538 CFLCECLPCLGKLPCLETLTLEGMTSVKRLGNEFLGIAEDDQARGDQAETASSIIRDTAFPRLETL-IFLLMTNWEEWDD  616 (698)
Q Consensus       538 c~~~~~l~~l~~L~~L~~L~L~~c~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~l~~~~~  616 (698)
                      |.....+.+..-.|+|++|.+.+|..++.+....-....             .......|+++..+ .+.+.+.++.+..
T Consensus       757 ~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~-------------l~~~i~~f~~~~~l~~~~~l~~l~~i~~  823 (889)
T KOG4658|consen  757 CHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLE-------------LKELILPFNKLEGLRMLCSLGGLPQLYW  823 (889)
T ss_pred             cccccccchhhccCcccEEEEecccccccCCCHHHHhhh-------------cccEEecccccccceeeecCCCCceeEe
Confidence            665555554445577777777777655554322110000             00012456666666 3555555544443


Q ss_pred             cccCCCcCCCCccceeeeccCCCCCCCCccccCCCCcceEEEccC
Q 005407          617 CEIAGGKTIMPRLRHLSICWSPELKALPDYILGSTSLDKLLIYYS  661 (698)
Q Consensus       617 ~~~~~~~~~~~~L~~L~l~~c~~L~~lp~~~~~l~~L~~L~i~~C  661 (698)
                           ....++.|+.+.+..||++..+|       .+..+.|.+|
T Consensus       824 -----~~l~~~~l~~~~ve~~p~l~~~P-------~~~~~~i~~~  856 (889)
T KOG4658|consen  824 -----LPLSFLKLEELIVEECPKLGKLP-------LLSTLTIVGC  856 (889)
T ss_pred             -----cccCccchhheehhcCcccccCc-------cccccceecc
Confidence                 11256668888888898888777       3444566665

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 4e-04
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 106/259 (40%), Gaps = 51/259 (19%)
Query: 13  FLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIEL-LSD 71
            L+LDDVW     +W      L+      +IL+TTR   V  ++   K  ++P+E  L  
Sbjct: 239 LLILDDVW----DSW-----VLKAFDSQCQILLTTRDKSVTDSVMGPKY-VVPVESSLGK 288
Query: 72  EDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLR-FKRKIE--- 127
           E    I S      ++D+ E          II +CKG PL V  +G+LLR F  + E   
Sbjct: 289 EKGLEILSLFVNMKKADLPEQ------AHSIIKECKGSPLVVSLIGALLRDFPNRWEYYL 342
Query: 128 ------EWQRVXXXXXXXXXXVDKGLLGPLLLSYRDLPPPLKKCFLYCAIFPKDSMLEKD 181
                 +++R+          +D+     + +S   L   +K  +   +I  KD  +   
Sbjct: 343 KQLQNKQFKRIRKSSSYDYEALDEA----MSISVEMLREDIKDYYTDLSILQKDVKVPTK 398
Query: 182 KLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCKMHDIVH 241
            L  LW            DME    E  E +    + +     + +G K  R  +HD+  
Sbjct: 399 VLCILW------------DMET---EEVEDILQEFVNKSLLFCDRNG-KSFRYYLHDLQV 442
Query: 242 DFSQFLTKTECSAL-DVNK 259
           D   FLT+  CS L D++K
Sbjct: 443 D---FLTEKNCSQLQDLHK 458

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-73
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-62
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-35
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  247 bits (633), Expect = 2e-73
 Identities = 63/366 (17%), Positives = 111/366 (30%), Gaps = 46/366 (12%)

Query: 2   QLHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKS 61
           ++    +  +  L+LDDVW             L+      +IL+TTR   V  ++   K 
Sbjct: 228 RILMLRKHPRSLLILDDVWDSWV---------LKAFDSQCQILLTTRDKSVTDSVMGPKY 278

Query: 62  NIIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLR 121
            +     L  E    I S           +          II +CKG PL V  +G+LLR
Sbjct: 279 VVPVESSLGKEKGLEILSLFVN------MKKADLPEQAHSIIKECKGSPLVVSLIGALLR 332

Query: 122 FKRKI-EEWQRVLESELWELEEVDK-----GLLGPLLLSYRDLPPPLKKCFLYCAIFPKD 175
                 E + + L+++ ++            L   + +S   L   +K  +   +I  KD
Sbjct: 333 DFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKD 392

Query: 176 SMLEKDKLIRLWMAQDYLKVKGREDMEVVGEEYFESLAMHSLFQDFERSEHDGRKIIRCK 235
             +    L  LW  +               E+  +     SL            K  R  
Sbjct: 393 VKVPTKVLCILWDME-----------TEEVEDILQEFVNKSLLFCDRNG-----KSFRYY 436

Query: 236 MHDIVHDFSQFLTKTECSALDVNKSRLQLPCWKARHLMIMGEMSKEVPFPSFVYNETKLR 295
           +HD+  DF      ++   L            +   L    E      +    Y+    +
Sbjct: 437 LHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYW-YNFLAYHMASAK 495

Query: 296 SLAVPRRLYYK--------RTIASSKLFDRLTCLRSIDGPPVRKIPKGIKKLIHLRYLAL 347
                  L +           +  + L       R I       + +  ++ + L    L
Sbjct: 496 MHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLL 555

Query: 348 GWNPWI 353
           G  P+ 
Sbjct: 556 GRQPFP 561
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query698
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.97
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.93
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.86
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.68
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.67
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.64
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.64
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.64
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.61
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.55
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.53
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.5
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.49
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.49
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.48
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.47
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.47
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.46
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.46
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.45
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.44
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.42
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.36
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.35
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.35
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.34
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.34
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.29
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.29
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.2
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.12
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.05
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.02
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.01
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.0
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.98
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.94
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.93
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.9
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.85
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.82
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.73
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.69
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.62
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.33
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.92
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.91
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.85
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.77
2fna_A357 Conserved hypothetical protein; structural genomic 97.74
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.48
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.2
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.41
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.31
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.29
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.99
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.63
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.48
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.72
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.08
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.92
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.78
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.31
3bos_A242 Putative DNA replication factor; P-loop containing 85.11
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 84.84
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 82.37
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 81.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 80.33
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.97  E-value=1.6e-32  Score=300.97  Aligned_cols=225  Identities=20%  Similarity=0.281  Sum_probs=175.5

Q ss_pred             hhhhhcCCc-eEEEEEeCCCCCChhhHHHHHhhcCCCCCCcEEEEEeCchHHHHHhCCCCccceeccCCChHhHHHHHHH
Q 005407            2 QLHESIEGK-KFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQ   80 (698)
Q Consensus         2 ~l~~~L~~k-r~LlVLDdvw~~~~~~~~~l~~~~~~~~~gs~IiiTTR~~~v~~~~~~~~~~~~~v~~L~~~~a~~Lf~~   80 (698)
                      .+++.|++| ||||||||||+.+...|..        .+||+||||||++.++..++.. ..+|+|++|+.++||+||.+
T Consensus       234 ~l~~~L~~~kr~LlVLDdv~~~~~~~~~~--------~~gs~ilvTTR~~~v~~~~~~~-~~~~~l~~L~~~ea~~Lf~~  304 (549)
T 2a5y_B          234 MICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQT-CEFIEVTSLEIDECYDFLEA  304 (549)
T ss_dssp             HHHHHHTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEESBGGGGGGCCSC-EEEEECCCCCHHHHHHHHHH
T ss_pred             HHHHHHcCCCcEEEEEECCCCchhhcccc--------cCCCEEEEEcCCHHHHHHcCCC-CeEEECCCCCHHHHHHHHHH
Confidence            467788896 9999999999743223332        1799999999999999877532 24799999999999999999


Q ss_pred             HhhccCCchhhhhHHHHHHHHHHHHhCCChHHHHHHHHHhcccCCHHHHHHHHhhhhcccccccccchhhHhhhccCCCh
Q 005407           81 VALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPP  160 (698)
Q Consensus        81 ~a~~~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~  160 (698)
                      +||....    .+.+.+++++|+++|+|+||||+++|+.|+.+ . ..|...+....+..  ....+..++.+||+.||.
T Consensus       305 ~a~~~~~----~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~-w~~~~~l~~~l~~~--~~~~i~~~l~~Sy~~L~~  376 (549)
T 2a5y_B          305 YGMPMPV----GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T-FEKMAQLNNKLESR--GLVGVECITPYSYKSLAM  376 (549)
T ss_dssp             TSCCCC------CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S-HHHHHHHHHHHHHH--CSSTTCCCSSSSSSSHHH
T ss_pred             HhcCCCC----chhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h-HHHHHHhHHHhhcc--cHHHHHHHHhcccccccH
Confidence            9986532    35678899999999999999999999999755 3 23333333322221  246799999999999999


Q ss_pred             hHHHHHh-----------hhcCCCCCCccCHHHHHHHHHhc--CccccCC-CccHHHHHHHHHHHHHhCCCcccccccCC
Q 005407          161 PLKKCFL-----------YCAIFPKDSMLEKDKLIRLWMAQ--DYLKVKG-REDMEVVGEEYFESLAMHSLFQDFERSEH  226 (698)
Q Consensus       161 ~~k~~fl-----------~~a~fp~~~~i~~~~Li~~wi~e--g~~~~~~-~~~~~~~~~~~l~~L~~~~ll~~~~~~~~  226 (698)
                      ++|.||+           |||+||+++.|+    ++.|+|+  ||+...+ ....+++++ ++++|++++|++.....  
T Consensus       377 ~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~--  449 (549)
T 2a5y_B          377 ALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRM--  449 (549)
T ss_dssp             HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECS--
T ss_pred             HHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCC--
Confidence            9999999           999999999988    8999999  9998765 566778777 99999999999976543  


Q ss_pred             CCeeEEEEEechhHHHHHHHhccccee
Q 005407          227 DGRKIIRCKMHDIVHDFSQFLTKTECS  253 (698)
Q Consensus       227 ~~~~~~~~~~hdlv~~~~~~~~~~~~~  253 (698)
                       +..  +|+|||++|++|+.++.+++.
T Consensus       450 -~~~--~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          450 -PVL--TFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             -SSC--EEECCHHHHHHHHTTSCTHHH
T ss_pred             -Cce--EEEeChHHHHHHHHHHHHHHH
Confidence             222  799999999999998877654
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 698
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 7e-26
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  105 bits (263), Expect = 7e-26
 Identities = 34/165 (20%), Positives = 57/165 (34%), Gaps = 19/165 (11%)

Query: 3   LHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSN 62
            +  I+      V DDV  EE   W +            R LVTTR V+++ A   T   
Sbjct: 128 CNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQTC-E 178

Query: 63  IIPIELLSDEDCWSIFSQVALSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRF 122
            I +  L  ++C+       + +    +E     ++  + I    G P  +         
Sbjct: 179 FIEVTSLEIDECYDFLEAYGMPMPVGEKEE----DVLNKTIELSSGNPATLMMFFKSCEP 234

Query: 123 KRKIEEWQRVLESELWELE-EVDKGLLGPLLLSYRDLPPPLKKCF 166
           K   E+          +LE     G+      SY+ L   L++C 
Sbjct: 235 KTF-EKM----AQLNNKLESRGLVGVECITPYSYKSLAMALQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query698
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.62
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.35
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.32
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.32
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.18
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.14
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.03
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.01
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.96
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.86
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.77
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.5
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.28
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.24
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.82
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.37
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.08
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 88.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 87.2
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.90  E-value=1.5e-24  Score=212.51  Aligned_cols=150  Identities=20%  Similarity=0.239  Sum_probs=121.4

Q ss_pred             hhhhcCCceEEEEEeCCCCCChhhHHHHHhhcCCCCCCcEEEEEeCchHHHHHhCCCCccceeccCCChHhHHHHHHHHh
Q 005407            3 LHESIEGKKFFLVLDDVWTEEPQNWERLWGCLRCGSKGSRILVTTRKVKVAIAIGTTKSNIIPIELLSDEDCWSIFSQVA   82 (698)
Q Consensus         3 l~~~L~~kr~LlVLDdvw~~~~~~~~~l~~~~~~~~~gs~IiiTTR~~~v~~~~~~~~~~~~~v~~L~~~~a~~Lf~~~a   82 (698)
                      +++.+.+||+|+||||||+.  .+|+.+.      ..|||||||||++.++..+... ...|+|++|+.+|||+||..+|
T Consensus       128 ~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~-~~~~~l~~L~~~ea~~Lf~~~~  198 (277)
T d2a5yb3         128 CNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQT-CEFIEVTSLEIDECYDFLEAYG  198 (277)
T ss_dssp             HHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSC-EEEEECCCCCHHHHHHHHHHTS
T ss_pred             HHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCC-CceEECCCCCHHHHHHHHHHHh
Confidence            45678999999999999974  5565543      2489999999999999877654 2479999999999999999999


Q ss_pred             hccCCchhhhhHHHHHHHHHHHHhCCChHHHHHHHHHhcccCCHHHHHHHHhhhhcccccccccchhhHhhhccCCChhH
Q 005407           83 LSIRSDIEEYKKFENIGRQIIGKCKGLPLAVKTLGSLLRFKRKIEEWQRVLESELWELEEVDKGLLGPLLLSYRDLPPPL  162 (698)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~  162 (698)
                      |....    .+..++++++|+++|+|+||||+++|+.|+. ++.+.|........   .....++..++..||++||+++
T Consensus       199 ~~~~~----~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~~~~~~~L~---~~~~~~v~~il~~sY~~L~~~l  270 (277)
T d2a5yb3         199 MPMPV----GEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNKLE---SRGLVGVECITPYSYKSLAMAL  270 (277)
T ss_dssp             CCCC------CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHHHHHHHHHH---HHCSSTTCCCSSSSSSSHHHHH
T ss_pred             CCccC----chhhHHHHHHHHHHhCCCHHHHHHHHHHhcc-CCHHHHHHHHHHHh---cCcHHHHHHHHHHHHhcccHHH
Confidence            86544    3445789999999999999999999999964 46788887665432   1234679999999999999999


Q ss_pred             HHHHhhh
Q 005407          163 KKCFLYC  169 (698)
Q Consensus       163 k~~fl~~  169 (698)
                      |.||-++
T Consensus       271 k~c~~~l  277 (277)
T d2a5yb3         271 QRCVEVL  277 (277)
T ss_dssp             HHHHHTS
T ss_pred             HHHHHhC
Confidence            9999753
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure