Citrus Sinensis ID: 005424

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------
MSQKPRVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPENGELGNEFVEEGENEESPYCGNNIVVEDRPSVGDEDLDSAASPLPSVSASHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
cccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEEccEEEEEcccccEEEEccccccccccccccccHHHHccccccHHHHHHHHHHHHcccccEEccccEEEEEccccccccccHHHHHHHcccccccccccEEHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHcccccccccccccccccEEEEEccccccEEcccccHHHccccEEccccccccccHHHHHHHccccHHHHHHcccccccccccccccccEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHcccHHHHHHHHcccEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHccccccEEEEcccc
ccccccccccccccccccccEEEccccccccccccccEEEcccccccccccccccccccEcccccccccccccccEEEccccccccHHHHHHccccHHHcccHHHHHHccccccccccccEEEEEcccccEEEEEEEEEcccEEEEEEccccEEEEcccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHccEEEccccEEEEEccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHccccEEEccccccccEEEEEEEccccEEEcccHHHHHHHHccEEEEccccccHHHHHHHHccccHHHHHHHcccccccccEEccccEEEEcccccHHHHHHHHHHHHHEcccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHcccHHHHHHHHcccEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccEEEccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHccccHHHEHHHHcccccccHHHHHHHHHHHHccccccccccccccEEEEEEEcEEEEcHHcccccccccccHHccccccHHHHHHHHHcccccHHHHHccc
msqkprvqpafqsikslpvdfrfigsplsdqveksddvnfrhsdvaslsvpengelgnefveegeneespycgnnivvedrpsvgdedldsaasplpsvsashtdrrwsdttsyagKKKLQSwfqlpngnwelGKILSisgtesvislpegkvlkvksenlvsanpdildgvddlmqlsylnepsvlYNLHYrykqdmiytkagpvlvainpfkkvplygnYYIEAyksksiesphvyaiTDTAIREMIRDEVNQSIIisgesgagktETAKIAMQYLAALgggsgieyeilktnpileafgnaktsrndnssrFGKLIEIHFsetgkisgaNIQTFLLEKSRVVQCAEGERAYHIFYQLcvgappalREKLNLMSAKEYKYLRQSScysingvddaeQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFtvidnenhvepvadegLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVgkrrtgrsisildiygfesfdrnSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDwakvdfednkdclnlfekvpspltqLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
msqkprvqpafqsikslpvdfRFIGSPLSDQVEKSDDVNFRHSdvaslsvpengeLGNEFVEEGENEESPYCGNNIVVEDRPSVGDEDLDSAasplpsvsashtdrrwSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAyksksiespHVYAITDTAIREMIRDEVNQSIIISgesgagktETAKIAMQYLAALGGGSGIEYEILKTNPILEAfgnaktsrndnsSRFGKLIEIHfsetgkisgANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIvqnltlsqatDTRDALAKSIYACLFEWLVEQINKSlavgkrrtgrsiSILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFekvpspltqLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
MSQKPRVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPengelgnefveegeneeSPYCGNNIVVEDRPSVGDEDLDsaasplpsvsasHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
*****************PVDFRFI*******************************************************************************************GKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGN**********RFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVM***
*****************************************************************************************************************YAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSF***************GLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHA**********GNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
**********FQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPENGELGNEFVEEGENEESPYCGNNIVVEDRPSV****************************SYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
********PAFQSIKSLPVDFRFIGSPL******************************************Y**NNIVVE*RPSVGDEDLDSAASPLPSVSASHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQKPRVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPENGELGNEFVEEGENEESPYCGNNIVVEDRPSVGDEDLDSAASPLPSVSASHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQLRVFVLTTKGVLLCYIFYLVVCHAFGIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDILMSGSRSKFVGVMLHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query697 2.2.26 [Sep-21-2011]
P08799 2116 Myosin-2 heavy chain OS=D no no 0.648 0.213 0.473 1e-119
Q9Y4I1 1855 Unconventional myosin-Va yes no 0.678 0.254 0.469 1e-117
Q9QYF3 1828 Unconventional myosin-Va yes no 0.678 0.258 0.467 1e-117
Q99104 1853 Unconventional myosin-Va yes no 0.678 0.255 0.463 1e-116
Q02440 1829 Unconventional myosin-Va yes no 0.678 0.258 0.459 1e-114
O74805 1471 Myosin-51 OS=Schizosaccha yes no 0.681 0.322 0.440 1e-114
Q9NQX4 1742 Unconventional myosin-Vc no no 0.616 0.246 0.487 1e-114
P70569 1846 Unconventional myosin-Vb no no 0.616 0.232 0.490 1e-113
P21271 1818 Unconventional myosin-Vb no no 0.616 0.236 0.488 1e-113
Q9ULV0 1848 Unconventional myosin-Vb no no 0.616 0.232 0.490 1e-113
>sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 Back     alignment and function desciption
 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/465 (47%), Positives = 311/465 (66%), Gaps = 13/465 (2%)

Query: 130 NWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYN 189
           ++E G+I+S +         +G+  +VK ++    NP   DGV+D+ +LSYLNEP+V +N
Sbjct: 46  SYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHN 105

Query: 190 LHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIRE 247
           L  RY QD+IYT +G  LVA+NPFK++P+Y    ++ +K +     +PH++AI+D A R 
Sbjct: 106 LRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRS 165

Query: 248 MIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGG-----GSGI-EYEILKTNPILEAF 301
           M+ D  NQS++I+GESGAGKTE  K  +QYLA++ G     GSG+ E +IL+ NPILEAF
Sbjct: 166 MLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAF 225

Query: 302 GNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLC 361
           GNAKT+RN+NSSRFGK IEI F+  G ISGA+IQ++LLEKSRVV  +E ER YHIFYQL 
Sbjct: 226 GNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLL 285

Query: 362 VGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVF 421
            GA    ++ L+L   + + YL QS C  I GV D+E+F+I  +A+DIV  S+E+Q S+F
Sbjct: 286 AGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIF 345

Query: 422 AMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLI-GCDIGELKLALSTRKMRVGND 480
            ++A +L LGN+ F     E  V  + D+  +  A  + G +   L+ AL   ++  G D
Sbjct: 346 KIIAGILHLGNIKFEKGAGEGAV--LKDKTALNAASTVFGVNPSVLEKALMEPRILAGRD 403

Query: 481 TIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESF 540
            + Q+L + +++ +RDAL K++Y  LF WLV++IN  L   + R    I +LDI GFE F
Sbjct: 404 LVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLC--QERKAYFIGVLDISGFEIF 461

Query: 541 DRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDF 585
             NSFEQ CINY NE+LQQ FN H+FKLEQEEY+++ I+W  +DF
Sbjct: 462 KVNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDF 506
Myosin is a protein that binds to actin and has ATPase activity that is activated by actin.
Dictyostelium discoideum (taxid: 44689)
>sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 Back     alignment and function description
>sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 Back     alignment and function description
>sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 Back     alignment and function description
>sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 Back     alignment and function description
>sp|O74805|MYO51_SCHPO Myosin-51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo51 PE=4 SV=1 Back     alignment and function description
>sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=2 Back     alignment and function description
>sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 Back     alignment and function description
>sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=2 SV=2 Back     alignment and function description
>sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query697
224096506 1174 predicted protein [Populus trichocarpa] 0.868 0.515 0.823 0.0
224083870 1173 predicted protein [Populus trichocarpa] 0.863 0.513 0.820 0.0
225463689 1197 PREDICTED: myosin-J heavy chain-like [Vi 0.860 0.501 0.825 0.0
356576949 1176 PREDICTED: myosin-J heavy chain-like [Gl 0.868 0.514 0.782 0.0
255565536 1181 myosin vIII, putative [Ricinus communis] 0.849 0.501 0.798 0.0
297742765 1135 unnamed protein product [Vitis vinifera] 0.809 0.496 0.805 0.0
356530262 1177 PREDICTED: myosin-J heavy chain-like [Gl 0.868 0.514 0.780 0.0
15231004 1166 myosin 1 [Arabidopsis thaliana] gi|11994 0.855 0.511 0.791 0.0
6491702 1166 myosin [Arabidopsis thaliana] 0.855 0.511 0.791 0.0
20268744 1166 putative myosin [Arabidopsis thaliana] 0.855 0.511 0.791 0.0
>gi|224096506|ref|XP_002310637.1| predicted protein [Populus trichocarpa] gi|222853540|gb|EEE91087.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/612 (82%), Positives = 546/612 (89%), Gaps = 7/612 (1%)

Query: 1   MSQKPRVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPENGELGNEF 60
           M  K +V P+ +SIKSLPVDFRF+GSP S+Q+EKS DV   +S+   LS PE  ++GN  
Sbjct: 1   MLPKSQVLPSLESIKSLPVDFRFVGSPTSEQLEKSVDVKSLNSNAVCLSFPEKNDIGNGL 60

Query: 61  VEEGEN-------EESPYCGNNIVVEDRPSVGDEDLDSAASPLPSVSASHTDRRWSDTTS 113
           VE  E+       E+SPY    I++E RPSVGDEDLD+   PLPS+S S  +RRWSDT+S
Sbjct: 61  VEGAEDSVGNDVSEDSPYSRTAILIEQRPSVGDEDLDTVVMPLPSISTSRRERRWSDTSS 120

Query: 114 YAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVD 173
           YA  KKLQSWFQLPNGNWELGKILS SGTES ISLP+GKVLKVK+E+LV ANPDILDGVD
Sbjct: 121 YATNKKLQSWFQLPNGNWELGKILSTSGTESTISLPDGKVLKVKTESLVPANPDILDGVD 180

Query: 174 DLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE 233
           DLMQLSYLNEPSVLYNL YRY +DMIYTKAGPVLVAINPFK+VPLYGN YIEAYK+KS+E
Sbjct: 181 DLMQLSYLNEPSVLYNLQYRYNRDMIYTKAGPVLVAINPFKEVPLYGNNYIEAYKNKSME 240

Query: 234 SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK 293
           SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK
Sbjct: 241 SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK 300

Query: 294 TNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERA 353
           TNPILEAFGNAKT RNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSRVVQC EGER+
Sbjct: 301 TNPILEAFGNAKTLRNDNSSRFGKLIEIHFSETGKISGAKIQTFLLEKSRVVQCMEGERS 360

Query: 354 YHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVS 413
           YHIFYQLC GA P LREK+NL  A EYKYLRQS+CY+I GVDDAE+F  V+EALDIVHVS
Sbjct: 361 YHIFYQLCAGASPKLREKINLKIASEYKYLRQSNCYTITGVDDAERFHAVMEALDIVHVS 420

Query: 414 KEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTR 473
           KE+QESVFAMLAAVLWLGNVSF+V+DNENHVEP+ADEGL TVAKLIGC++GELKLALSTR
Sbjct: 421 KENQESVFAMLAAVLWLGNVSFSVVDNENHVEPMADEGLTTVAKLIGCNVGELKLALSTR 480

Query: 474 KMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILD 533
           KMRVGNDTIVQ LTLSQA DTRDALAKSIY+CLF+WLVEQ+NKSLAVGKRRTGRSISILD
Sbjct: 481 KMRVGNDTIVQKLTLSQAIDTRDALAKSIYSCLFDWLVEQVNKSLAVGKRRTGRSISILD 540

Query: 534 IYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLN 593
           IYGFESF+RNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDN+DCLN
Sbjct: 541 IYGFESFERNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNQDCLN 600

Query: 594 LFEKVPSPLTQL 605
           LFEK P  L  L
Sbjct: 601 LFEKKPLGLLSL 612

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083870|ref|XP_002307152.1| predicted protein [Populus trichocarpa] gi|222856601|gb|EEE94148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225463689|ref|XP_002273898.1| PREDICTED: myosin-J heavy chain-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356576949|ref|XP_003556592.1| PREDICTED: myosin-J heavy chain-like [Glycine max] Back     alignment and taxonomy information
>gi|255565536|ref|XP_002523758.1| myosin vIII, putative [Ricinus communis] gi|223536970|gb|EEF38607.1| myosin vIII, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297742765|emb|CBI35399.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356530262|ref|XP_003533701.1| PREDICTED: myosin-J heavy chain-like [Glycine max] Back     alignment and taxonomy information
>gi|15231004|ref|NP_188630.1| myosin 1 [Arabidopsis thaliana] gi|11994771|dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana] gi|25054927|gb|AAN71940.1| putative myosin [Arabidopsis thaliana] gi|332642791|gb|AEE76312.1| myosin 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6491702|emb|CAB61875.1| myosin [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|20268744|gb|AAM14075.1| putative myosin [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query697
TAIR|locus:2011922 1153 VIIIA [Arabidopsis thaliana (t 0.845 0.510 0.761 2.9e-238
TAIR|locus:2162550 1220 ATM2 "myosin 2" [Arabidopsis t 0.718 0.410 0.673 1.1e-179
TAIR|locus:2149932 1545 XIK [Arabidopsis thaliana (tax 0.688 0.310 0.469 1.9e-115
TAIR|locus:2025535 1538 XIC [Arabidopsis thaliana (tax 0.688 0.312 0.467 3.1e-115
TAIR|locus:2199449 1529 XIE [Arabidopsis thaliana (tax 0.688 0.313 0.467 4.1e-113
DICTYBASE|DDB_G0272112 2245 myoJ "myosin-5b" [Dictyosteliu 0.449 0.139 0.492 4.4e-113
TAIR|locus:2046570 1770 XID "myosin XI D" [Arabidopsis 0.764 0.301 0.425 7e-113
TAIR|locus:2197773 1730 XIA "myosin XI A" [Arabidopsis 0.687 0.276 0.449 3.4e-112
TAIR|locus:2125929 1522 XI-I [Arabidopsis thaliana (ta 0.678 0.310 0.468 1.6e-111
TAIR|locus:2020270 1500 XIB "myosin XI B" [Arabidopsis 0.688 0.32 0.448 3.3e-111
TAIR|locus:2011922 VIIIA [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2297 (813.6 bits), Expect = 2.9e-238, P = 2.9e-238
 Identities = 457/600 (76%), Positives = 494/600 (82%)

Query:     6 RVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPXXXXXXXXXXXXXX 65
             +V+ +FQS+K++P D+RF+GSP+SD +E     N        L                 
Sbjct:     4 KVKASFQSLKTMPADYRFLGSPISDHLE----TNLITPPNGHLKNGVNGTASSVGGMDSV 59

Query:    66 XXXSPYCGNNIVVEDRPSVGDEDLDXXXXXXXXXXXXHTDRRWSDTTSYAGKKKLQSWFQ 125
                SPY   +I+  +R S+GD D                DR+WSDT  YA KK LQ W Q
Sbjct:    60 NEDSPYSVRSILNGERSSIGDGD-------SILPLPESNDRKWSDTNVYARKKVLQFWVQ 112

Query:   126 LPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPS 185
             LPNGNWELGKI+S SG ESVI + EGKVLKVKSE LV ANPDILDGVDDLMQLSYLNEP+
Sbjct:   113 LPNGNWELGKIMSTSGEESVIVVTEGKVLKVKSETLVPANPDILDGVDDLMQLSYLNEPA 172

Query:   186 VLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAI 245
             VLYNL YRY QDMIYTKAGPVLVA+NPFK+VPLYGN  IEAY+ +S ESPHVYAI DTAI
Sbjct:   173 VLYNLEYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRNIEAYRKRSNESPHVYAIADTAI 232

Query:   246 REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK 305
             REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK
Sbjct:   233 REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK 292

Query:   306 TSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAP 365
             T RNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSRVVQC EGER+YHIFYQLC GA 
Sbjct:   293 TLRNDNSSRFGKLIEIHFSETGKISGAQIQTFLLEKSRVVQCTEGERSYHIFYQLCAGAS 352

Query:   366 PALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLA 425
             P LREKLNL SAK+Y YL+QS+CYSINGVDDAE+F  V EALDIVHVSKEDQE+VFAMLA
Sbjct:   353 PTLREKLNLTSAKQYNYLKQSNCYSINGVDDAERFHAVKEALDIVHVSKEDQENVFAMLA 412

Query:   426 AVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQN 485
             AVLWLGNVSFT+IDNENHVEP  DE L TVAKLIGC+I ELKLALS R MRV NDTIVQ 
Sbjct:   413 AVLWLGNVSFTIIDNENHVEPEPDESLSTVAKLIGCNINELKLALSKRNMRVNNDTIVQK 472

Query:   486 LTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSF 545
             LTLSQA D RDALAKSIYACLF+WLVEQINKSLAVGKRRTGRSISILDIYGFESF++NSF
Sbjct:   473 LTLSQAIDARDALAKSIYACLFDWLVEQINKSLAVGKRRTGRSISILDIYGFESFNKNSF 532

Query:   546 EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQL 605
             EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDW +VDFEDN++CL+LFEK P  L  L
Sbjct:   533 EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWTRVDFEDNQECLSLFEKKPLGLLSL 592
GO:0003774 "motor activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0016459 "myosin complex" evidence=ISS
GO:0030048 "actin filament-based movement" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006886 "intracellular protein transport" evidence=RCA
GO:0009832 "plant-type cell wall biogenesis" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2162550 ATM2 "myosin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149932 XIK [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025535 XIC [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199449 XIE [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272112 myoJ "myosin-5b" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2046570 XID "myosin XI D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197773 XIA "myosin XI A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125929 XI-I [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020270 XIB "myosin XI B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VII.2372.1
SubName- Full=Putative uncharacterized protein; (1168 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 0.0
smart00242 677 smart00242, MYSc, Myosin 0.0
cd00124 679 cd00124, MYSc, Myosin motor domain 0.0
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 0.0
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 0.0
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 0.0
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 0.0
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 0.0
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 0.0
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 1e-163
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-136
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 1e-134
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-129
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 1e-117
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 1e-112
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 3e-60
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 4e-12
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information 
 Score =  894 bits (2312), Expect = 0.0
 Identities = 380/442 (85%), Positives = 405/442 (91%)

Query: 164 ANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYY 223
           ANPDILDGVDDLMQLSYLNEPSVLYNL YRY QD+IYTKAGPVLVA+NPFK+VPLYGN Y
Sbjct: 2   ANPDILDGVDDLMQLSYLNEPSVLYNLQYRYSQDLIYTKAGPVLVAVNPFKEVPLYGNDY 61

Query: 224 IEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGG 283
           IEAY+ KS +SPHVYAI DTA  EM+RDEVNQSIIISGESGAGKTETAKIAMQYLA+LGG
Sbjct: 62  IEAYRKKSNDSPHVYAIADTAYNEMMRDEVNQSIIISGESGAGKTETAKIAMQYLASLGG 121

Query: 284 GSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSR 343
           GSGIEYEIL+TNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSR
Sbjct: 122 GSGIEYEILQTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGAKIQTFLLEKSR 181

Query: 344 VVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIV 403
           VVQCA GER+YHIFYQLC GAPPAL+EKLNL SA EYKYL+QS CYSINGVDDA++F  +
Sbjct: 182 VVQCARGERSYHIFYQLCAGAPPALKEKLNLKSASEYKYLKQSCCYSINGVDDAQRFHTL 241

Query: 404 VEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDI 463
           VEALDIVH+SKEDQE+VFAMLAAVLWLGNVSFTVIDNENHVEPVADE L T AKLIGC+I
Sbjct: 242 VEALDIVHISKEDQENVFAMLAAVLWLGNVSFTVIDNENHVEPVADEALSTAAKLIGCNI 301

Query: 464 GELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKR 523
            +L LALSTRKM V ND IVQ LTL QA D RDALAKSIYA LF+WLVEQINKSL VGKR
Sbjct: 302 EDLMLALSTRKMHVNNDNIVQKLTLQQAIDARDALAKSIYASLFDWLVEQINKSLEVGKR 361

Query: 524 RTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKV 583
           RTGRSISILDIYGFESFD+NSFEQFCINYANERLQQHFNRHLFKLEQEEY +DGIDW KV
Sbjct: 362 RTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYEEDGIDWTKV 421

Query: 584 DFEDNKDCLNLFEKVPSPLTQL 605
           +FEDN++CL+LFEK P  L  L
Sbjct: 422 EFEDNQECLDLFEKKPLGLLSL 443

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 697
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
PTZ00014 821 myosin-A; Provisional 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 100.0
KOG0162 1106 consensus Myosin class I heavy chain [Cytoskeleton 100.0
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 100.0
KOG0160 862 consensus Myosin class V heavy chain [Cytoskeleton 100.0
KOG4229 1062 consensus Myosin VII, myosin IXB and related myosi 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 98.79
PF0273642 Myosin_N: Myosin N-terminal SH3-like domain; Inter 98.3
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 95.56
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.37
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.9
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.73
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.27
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.96
smart00382148 AAA ATPases associated with a variety of cellular 93.76
PF00004132 AAA: ATPase family associated with various cellula 93.52
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.38
PRK05480209 uridine/cytidine kinase; Provisional 93.3
PRK06696223 uridine kinase; Validated 93.11
PRK00300205 gmk guanylate kinase; Provisional 93.04
PF12846304 AAA_10: AAA-like domain 93.01
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 92.93
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.8
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 92.79
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.78
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.77
PRK08233182 hypothetical protein; Provisional 92.72
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 92.61
PRK06762166 hypothetical protein; Provisional 92.58
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.57
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 92.5
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.47
PRK00131175 aroK shikimate kinase; Reviewed 92.44
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 92.44
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 92.43
PF05729166 NACHT: NACHT domain 92.41
PRK13833323 conjugal transfer protein TrbB; Provisional 92.39
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.34
PRK07261171 topology modulation protein; Provisional 92.27
PRK05541176 adenylylsulfate kinase; Provisional 92.26
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 91.97
PRK09270229 nucleoside triphosphate hydrolase domain-containin 91.89
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 91.88
PRK08118167 topology modulation protein; Reviewed 91.83
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.75
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.69
PRK00440319 rfc replication factor C small subunit; Reviewed 91.66
PTZ00301210 uridine kinase; Provisional 91.56
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.48
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 91.43
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.42
PRK06547172 hypothetical protein; Provisional 91.41
TIGR02928365 orc1/cdc6 family replication initiation protein. M 91.41
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 91.4
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 91.34
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 91.33
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 91.28
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 91.27
PRK08084235 DNA replication initiation factor; Provisional 91.25
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 91.23
PRK00889175 adenylylsulfate kinase; Provisional 91.15
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 91.02
PRK07196434 fliI flagellum-specific ATP synthase; Validated 90.88
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 90.78
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.63
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 90.58
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 90.48
PRK14737186 gmk guanylate kinase; Provisional 90.41
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 90.4
PRK03846198 adenylylsulfate kinase; Provisional 90.39
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 90.35
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 90.33
PRK14738206 gmk guanylate kinase; Provisional 90.2
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 90.17
PRK00411394 cdc6 cell division control protein 6; Reviewed 90.15
PRK12402337 replication factor C small subunit 2; Reviewed 90.11
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 90.11
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 90.11
PRK06217183 hypothetical protein; Validated 90.03
PF1324576 AAA_19: Part of AAA domain 90.01
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 89.94
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 89.89
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.83
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 89.73
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 89.73
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 89.72
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 89.61
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 89.6
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 89.48
PRK04182180 cytidylate kinase; Provisional 89.4
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.18
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 89.07
COG1660286 Predicted P-loop-containing kinase [General functi 88.92
PRK07667193 uridine kinase; Provisional 88.81
PRK12377248 putative replication protein; Provisional 88.77
PRK05057172 aroK shikimate kinase I; Reviewed 88.59
cd03115173 SRP The signal recognition particle (SRP) mediates 88.57
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 88.56
PRK13851344 type IV secretion system protein VirB11; Provision 88.45
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 88.44
PRK14527191 adenylate kinase; Provisional 88.44
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 88.36
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 88.34
PHA00729226 NTP-binding motif containing protein 88.19
PF07475171 Hpr_kinase_C: HPr Serine kinase C-terminal domain; 88.18
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 88.15
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 88.13
PRK04040188 adenylate kinase; Provisional 88.08
PRK09825176 idnK D-gluconate kinase; Provisional 88.01
PRK13764602 ATPase; Provisional 88.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 87.93
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 87.89
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 87.87
PRK06893229 DNA replication initiation factor; Validated 87.85
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 87.79
PF00005137 ABC_tran: ABC transporter This structure is on hol 87.77
PRK08727233 hypothetical protein; Validated 87.76
TIGR02533486 type_II_gspE general secretory pathway protein E. 87.74
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 87.69
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 87.69
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 87.66
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 87.62
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 87.52
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 87.46
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 87.45
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 87.43
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 87.41
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 87.33
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 87.32
PHA02544316 44 clamp loader, small subunit; Provisional 87.3
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 87.27
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 87.2
PRK14531183 adenylate kinase; Provisional 87.17
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 87.1
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 87.08
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 87.06
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 87.04
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 87.01
PRK00698205 tmk thymidylate kinase; Validated 87.0
COG1618179 Predicted nucleotide kinase [Nucleotide transport 86.97
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 86.96
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 86.93
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 86.92
PRK13894319 conjugal transfer ATPase TrbB; Provisional 86.91
PRK13342413 recombination factor protein RarA; Reviewed 86.85
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 86.82
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 86.81
COG1493308 HprK Serine kinase of the HPr protein, regulates c 86.72
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 86.71
PHA02530300 pseT polynucleotide kinase; Provisional 86.71
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 86.64
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 86.6
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 86.58
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 86.52
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 86.5
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 86.49
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 86.4
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 86.39
PRK09473330 oppD oligopeptide transporter ATP-binding componen 86.38
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 86.37
PRK12608380 transcription termination factor Rho; Provisional 86.33
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 86.3
cd03116159 MobB Molybdenum is an essential trace element in t 86.29
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 86.26
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 86.26
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 86.21
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 86.21
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 86.16
PRK03839180 putative kinase; Provisional 86.16
TIGR00064272 ftsY signal recognition particle-docking protein F 86.16
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 86.16
PRK14528186 adenylate kinase; Provisional 86.14
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 86.13
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 86.13
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 86.11
cd03269210 ABC_putative_ATPase This subfamily is involved in 86.08
PLN03025319 replication factor C subunit; Provisional 86.04
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 85.98
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 85.9
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 85.89
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 85.88
PRK08116268 hypothetical protein; Validated 85.84
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 85.83
PRK08356195 hypothetical protein; Provisional 85.81
PRK10416318 signal recognition particle-docking protein FtsY; 85.81
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 85.8
PF1355562 AAA_29: P-loop containing region of AAA domain 85.75
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 85.74
PRK15453290 phosphoribulokinase; Provisional 85.74
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 85.73
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 85.73
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 85.72
PRK10908222 cell division protein FtsE; Provisional 85.71
PRK06761282 hypothetical protein; Provisional 85.7
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 85.7
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 85.69
PF13479213 AAA_24: AAA domain 85.69
PRK14974336 cell division protein FtsY; Provisional 85.68
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 85.68
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 85.66
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 85.6
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 85.58
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 85.58
cd02034116 CooC The accessory protein CooC, which contains a 85.56
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 85.55
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 85.51
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 85.49
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 85.45
COG1123539 ATPase components of various ABC-type transport sy 85.42
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 85.4
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 85.37
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 85.33
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 85.31
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 85.3
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 85.29
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 85.29
PRK05428308 HPr kinase/phosphorylase; Provisional 85.16
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 85.15
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 85.13
COG2884223 FtsE Predicted ATPase involved in cell division [C 85.1
PRK08533230 flagellar accessory protein FlaH; Reviewed 85.1
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 85.06
PRK14242253 phosphate transporter ATP-binding protein; Provisi 85.05
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 85.03
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 85.02
PRK09112351 DNA polymerase III subunit delta'; Validated 85.02
cd03234226 ABCG_White The White subfamily represents ABC tran 84.98
PRK13695174 putative NTPase; Provisional 84.95
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 84.79
PRK06067234 flagellar accessory protein FlaH; Validated 84.77
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 84.76
PRK04328249 hypothetical protein; Provisional 84.76
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 84.73
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 84.72
PRK03731171 aroL shikimate kinase II; Reviewed 84.72
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 84.71
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 84.7
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 84.65
PRK13768253 GTPase; Provisional 84.63
TIGR02746797 TraC-F-type type-IV secretion system protein TraC. 84.62
PRK02496184 adk adenylate kinase; Provisional 84.61
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 84.58
TIGR00152188 dephospho-CoA kinase. This model produces scores i 84.52
PRK14732196 coaE dephospho-CoA kinase; Provisional 84.48
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 84.47
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 84.46
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 84.46
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 84.4
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 84.4
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 84.37
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 84.35
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 84.34
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 84.31
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 84.3
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 84.26
PF13173128 AAA_14: AAA domain 84.26
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 84.23
PRK04195482 replication factor C large subunit; Provisional 84.23
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 84.21
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 84.19
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 84.15
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 84.14
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 84.11
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 84.1
PRK05973237 replicative DNA helicase; Provisional 84.08
COG0802149 Predicted ATPase or kinase [General function predi 84.07
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 84.06
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 84.05
TIGR02237209 recomb_radB DNA repair and recombination protein R 84.02
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 84.02
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 84.01
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 83.97
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 83.95
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 83.95
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 83.92
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 83.9
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 83.87
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 83.85
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 83.85
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 83.85
COG4172534 ABC-type uncharacterized transport system, duplica 83.84
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 83.84
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 83.82
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 83.82
PRK04220301 2-phosphoglycerate kinase; Provisional 83.82
PRK10646153 ADP-binding protein; Provisional 83.81
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 83.78
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 83.77
cd01394218 radB RadB. The archaeal protein radB shares simila 83.74
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 83.72
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 83.7
PRK14530215 adenylate kinase; Provisional 83.7
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 83.69
cd03215182 ABC_Carb_Monos_II This family represents domain II 83.69
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 83.66
PRK10790592 putative multidrug transporter membrane\ATP-bindin 83.66
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.62
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 83.59
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 83.55
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 83.55
PRK10436462 hypothetical protein; Provisional 83.54
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 83.52
PRK13947171 shikimate kinase; Provisional 83.48
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 83.47
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 83.46
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 83.45
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 83.43
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 83.39
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 83.39
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 83.37
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 83.37
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 83.36
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 83.35
PRK14238271 phosphate transporter ATP-binding protein; Provisi 83.33
COG4172534 ABC-type uncharacterized transport system, duplica 83.32
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 83.3
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 83.3
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 83.26
PRK00023225 cmk cytidylate kinase; Provisional 83.25
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 83.24
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 83.22
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 83.19
PRK09087226 hypothetical protein; Validated 83.14
PRK06620214 hypothetical protein; Validated 83.13
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 83.12
PLN02318 656 phosphoribulokinase/uridine kinase 83.12
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 83.07
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 83.06
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 83.05
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 83.0
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.97
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 82.93
PRK09435332 membrane ATPase/protein kinase; Provisional 82.91
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 82.9
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 82.86
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 82.84
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 82.84
TIGR00679304 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene 82.8
cd03246173 ABCC_Protease_Secretion This family represents the 82.77
COG4619223 ABC-type uncharacterized transport system, ATPase 82.76
PRK14240250 phosphate transporter ATP-binding protein; Provisi 82.74
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 82.71
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 82.69
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 82.64
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 82.63
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 82.61
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 82.58
cd03216163 ABC_Carb_Monos_I This family represents the domain 82.58
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 82.57
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 82.57
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 82.56
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 82.56
PLN02796347 D-glycerate 3-kinase 82.52
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 82.48
PRK10619257 histidine/lysine/arginine/ornithine transporter su 82.48
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 82.46
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 82.44
TIGR00101199 ureG urease accessory protein UreG. This model rep 82.36
PRK14239252 phosphate transporter ATP-binding protein; Provisi 82.36
PRK08154309 anaerobic benzoate catabolism transcriptional regu 82.3
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 82.23
PRK06526254 transposase; Provisional 82.21
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 82.18
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 82.15
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 82.11
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 82.1
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 82.1
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 82.09
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 82.07
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 82.07
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 82.02
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 82.01
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 82.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 81.96
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 81.95
COG1123539 ATPase components of various ABC-type transport sy 81.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 81.94
PRK14237267 phosphate transporter ATP-binding protein; Provisi 81.93
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 81.92
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 81.92
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 81.9
TIGR00929785 VirB4_CagE type IV secretion/conjugal transfer ATP 81.88
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 81.88
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 81.87
PRK06921266 hypothetical protein; Provisional 81.87
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 81.87
PRK14241258 phosphate transporter ATP-binding protein; Provisi 81.85
PLN02348395 phosphoribulokinase 81.85
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 81.78
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 81.77
PTZ001121164 origin recognition complex 1 protein; Provisional 81.75
COG1136226 SalX ABC-type antimicrobial peptide transport syst 81.74
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 81.7
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 81.69
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 81.63
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 81.62
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 81.62
cd01128249 rho_factor Transcription termination factor rho is 81.6
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 81.53
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 81.52
cd03112158 CobW_like The function of this protein family is u 81.51
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 81.49
PRK09099441 type III secretion system ATPase; Provisional 81.44
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 81.41
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 81.41
PRK09984262 phosphonate/organophosphate ester transporter subu 81.39
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 81.38
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 81.34
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 81.33
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 81.3
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 81.21
PRK08972444 fliI flagellum-specific ATP synthase; Validated 81.2
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 81.19
PRK00279215 adk adenylate kinase; Reviewed 81.16
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 81.14
PRK14235267 phosphate transporter ATP-binding protein; Provisi 81.08
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 81.01
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 80.99
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 80.99
PRK13946184 shikimate kinase; Provisional 80.98
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 80.98
PRK14243264 phosphate transporter ATP-binding protein; Provisi 80.96
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 80.94
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 80.94
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 80.93
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 80.89
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 80.88
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 80.85
PRK07429327 phosphoribulokinase; Provisional 80.85
PRK07952244 DNA replication protein DnaC; Validated 80.73
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 80.72
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 80.72
PRK01184184 hypothetical protein; Provisional 80.71
PRK13949169 shikimate kinase; Provisional 80.71
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 80.71
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 80.71
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 80.68
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 80.65
PRK14532188 adenylate kinase; Provisional 80.59
PRK03695248 vitamin B12-transporter ATPase; Provisional 80.55
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 80.52
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 80.51
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 80.47
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 80.46
PRK14734200 coaE dephospho-CoA kinase; Provisional 80.41
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 80.39
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 80.38
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 80.38
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 80.37
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 80.37
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 80.34
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 80.31
PRK09580248 sufC cysteine desulfurase ATPase component; Review 80.24
PRK08699325 DNA polymerase III subunit delta'; Validated 80.21
PRK10253265 iron-enterobactin transporter ATP-binding protein; 80.12
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 80.1
PRK05642234 DNA replication initiation factor; Validated 80.08
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 80.07
PRK13341 725 recombination factor protein RarA/unknown domain f 80.04
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 80.04
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 80.02
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-162  Score=1418.49  Aligned_cols=565  Identities=43%  Similarity=0.680  Sum_probs=523.6

Q ss_pred             ccCcEEEEecCCCCEEEEEEEeee--CCeeEEEc--CCCcEEEEecCCcc--cCCCCccCCcCCcccccCCCchhHHHHH
Q 005424          117 KKKLQSWFQLPNGNWELGKILSIS--GTESVISL--PEGKVLKVKSENLV--SANPDILDGVDDLMQLSYLNEPSVLYNL  190 (697)
Q Consensus       117 k~~~~vWv~~~~~~~~~~~v~s~~--~~~v~v~~--~~g~~~~v~~~~l~--~~np~~~~~veDL~~L~~LnE~sVL~nL  190 (697)
                      ..|..||+|+.+.+|+.+.+.+..  +++++-..  .+|....++...+.  ..+||+++++|||+.|++||||+|||||
T Consensus         7 ~~g~~~w~p~~e~~Wi~~~~~k~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~P~~~~vdDLt~LSyLNEpsVl~nL   86 (1463)
T COG5022           7 EVGSGCWIPDEEKGWIWAEIIKEAFNKGKVTEEGKKEDGESVSVKKKVLGNDRIKLPKFDGVDDLTELSYLNEPAVLHNL   86 (1463)
T ss_pred             ccCceeeeeccccceeeeeechhhhhccccccchhhccCcccceeehhcccccccCccccCchhhhhhhccCcHHHHHHH
Confidence            457799999999999999999874  34333222  35655566655543  3557899999999999999999999999


Q ss_pred             HHHHhcCCcccccCCeEEEecCCccCCCCChhHHHhhccCCCC--CCchhHHHHHHHHHHHhcCceeEEEEeCCCCCChh
Q 005424          191 HYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKT  268 (697)
Q Consensus       191 ~~Ry~~~~IYTy~G~iLIaVNPyk~lpiY~~~~~~~Y~~~~~~--~PHifavA~~Ay~~m~~~~~nQsIiiSGESGAGKT  268 (697)
                      ++||.+++||||+|.+|||||||+.+|+|+.++++.|+++.+.  +|||||||+.||++|...++|||||||||||||||
T Consensus        87 ~kRY~n~~IYTYSGlvLIAvNPy~~L~iYt~d~i~~Y~~K~r~el~PHvfAIAe~aY~~lls~~eNQtIiISGESGAGKT  166 (1463)
T COG5022          87 EKRYNNGQIYTYSGLVLIAVNPYRDLGIYTDDIIQSYSGKNRLELEPHVFAIAEEAYRNLLSEKENQTIIISGESGAGKT  166 (1463)
T ss_pred             HHHhhcCceeEEeeeEEEEecCcccCCCccHHHHHHhccCccccCCchHHHHHHHHHHHHHhcCCCceEEEecCCCCCch
Confidence            9999999999999999999999999999999999999999876  79999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHcCCCC-----CchhhhhhhchHHHhhccccccCCCCCCccccEEEEEecCCCCccceeeeeeeccCce
Q 005424          269 ETAKIAMQYLAALGGGS-----GIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSR  343 (697)
Q Consensus       269 e~tK~il~yLa~~~~~~-----~ie~~Il~snpILEAFGNAKT~rNdNSSRFGKfi~L~F~~~G~i~Ga~I~tYLLEKSR  343 (697)
                      |+||+||||||++++++     +||++|+++||||||||||||+||||||||||||+|.||.+|.|+||+|++|||||||
T Consensus       167 e~aK~ImqYlasv~~s~~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyikI~Fd~~g~I~GA~I~~YLLEKSR  246 (1463)
T COG5022         167 ENAKRIMQYLASVTSSSTVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEICGAKIETYLLEKSR  246 (1463)
T ss_pred             HHHHHHHHHHHHhccCCcchHHHHHHHHHhcchHHHHhccccccccCCcccccceEEEEECCCCceechhhhhhhhhhhh
Confidence            99999999999998764     6999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCCCcchhhHHHhcCCCHHHHHhcCCCCcccCccccCCCccccCCcchHHHHHHHHHHHhhcCCCHHHHHHHHHH
Q 005424          344 VVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAM  423 (697)
Q Consensus       344 Vv~q~~gERNfHIFYqLlaG~~~~~r~~l~L~~~~~y~yL~qs~~~~~~~~dD~~~F~~l~~Al~~LGfs~ee~~~I~~i  423 (697)
                      ||+|+.+|||||||||||+|.+.+.|+.+++..+.+|.||++++|..++|+||+++|+.|+.||+++||+++||.+||++
T Consensus       247 VV~Q~~~ERNYHIFYQll~G~~~~~k~~~~~~~~~dY~Yl~~~~~~~I~gIdD~kefk~t~~AlktiGi~~eeq~~IF~i  326 (1463)
T COG5022         247 VVHQNKNERNYHIFYQLLAGDPEELKKLLLLQNPKDYIYLSQGGCDKIDGIDDAKEFKITLDALKTIGIDEEEQDQIFKI  326 (1463)
T ss_pred             hccCCCCccchhhhhhHhcCChHHHHHHhhccChHhhHhHhhcCCCcCCCcccHHHHHHHHHHHHHhCCChHHHHHHHHH
Confidence            99999999999999999999888888888889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCeeeEEeCCCCceeecChhHHHHHHHhhCCCHHHHHHhhcceeeeeccceEEecCCHHHHHHHHHHHHHHHH
Q 005424          424 LAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIY  503 (697)
Q Consensus       424 LAAILhLGNi~F~~~~~~~~~~~~~~e~l~~aA~LLGvd~~~L~~aLt~r~i~v~~e~i~~~lt~~qA~~~RDaLAK~LY  503 (697)
                      ||||||||||+|.. ++++.+.+.+.+.++.+|+|||||+..|.++|++|.|++|+|.|.+++|.+||..+||||||+||
T Consensus       327 LAaILhiGNIef~~-~r~g~a~~~~~~~~~~~c~LLgId~~~f~k~lvk~~ikt~~E~i~~~~n~~QA~~irdslAK~lY  405 (1463)
T COG5022         327 LAAILHIGNIEFKE-DRNGAAIFSDNSVLDKACYLLGIDPSLFVKWLVKRQIKTGGEWIVVPLNLEQALAIRDSLAKALY  405 (1463)
T ss_pred             HHHHHhhcceeeee-cccchhhcCCchHHHHHHHHhCCCHHHHHHHHHHhHhhcCceEEEecCCHHHHHHHHHHHHHHHH
Confidence            99999999999985 44567888999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcccccCCCCCccceEEeeccCCCccCCCCCHHHHHHhHhhHHHHhhhhhhhhhhhhhhhhhcCCccccc
Q 005424          504 ACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKV  583 (697)
Q Consensus       504 ~rLF~WIV~~IN~~L~~~~~~~~~~IgILDIfGFE~f~~NsFEQLcINyaNEkLQq~Fn~~iF~~EqeeY~~EGI~w~~i  583 (697)
                      ++||+|||++||.+|..... ..+|||||||||||+|+.|||||||||||||||||+||+|||++|||||.+|||+|++|
T Consensus       406 ~~lFdwiV~rIN~sL~~~~~-~~~fIGVLDIyGFEiFEkNSFEQlCINYtNEKLQQ~Fn~h~FklEQEeY~kE~IeW~~I  484 (1463)
T COG5022         406 SNLFDWIVDRINKSLDHSAA-ASNFIGVLDIYGFEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYVKEGIEWSFI  484 (1463)
T ss_pred             HHHHHHHHHHHHhhccCccc-cccceeEEeecchhhhccCcHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhcCccccc
Confidence            99999999999999986543 46899999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCChHhHHHhhhc-CCcceeeecc-cccccCcchhhhhhhhhhhcc--c-ceeeeccCCCCceEEEeeecccccccchh
Q 005424          584 DFEDNKDCLNLFEK-VPSPLTQLRV-FVLTTKGVLLCYIFYLVVCHA--F-GIFIQADLTGNFFMFCMVASITTDTKISM  658 (697)
Q Consensus       584 ~f~DN~~~ldLie~-kp~GIlslL~-~~~~~~~t~~~~~~~~~~~~~--f-g~~~~~~~~~~~F~i~h~a~~~~~~~~~~  658 (697)
                      +|.|||+||||||+ .|.|||++|| +|.+|.|++.+|..|+...-.  + .++-.+....+.|+|+|||+-        
T Consensus       485 dy~DnQ~~IDLIE~~~p~GIlslLDEE~~~p~atd~s~~sKL~~~l~~~~~~~f~~~rf~~~~FvvkHYAgD--------  556 (1463)
T COG5022         485 DYFDNQPCIDLIEKKNPLGILSLLDEECVMPHATDESFTSKLAQRLNKNSNPKFKKSRFRDNKFVVKHYAGD--------  556 (1463)
T ss_pred             ccccCcchhHHHhccCCCchHhhhcHHhcCCCCCchHHHHHHHHHhccccCccccccccCCCceEEEeeccc--------
Confidence            99999999999998 5799999998 699999999999999865554  3 344445566668999999999        


Q ss_pred             hhHHHHHHHHHHhccccceeeee-eccCCCCccccc
Q 005424          659 NILSAKVLRFLLFNFRALQIIDI-LMSGSRSKFVGV  693 (697)
Q Consensus       659 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  693 (697)
                        |.|.|+|||.||+|.|.-+.+ |+..|..+||--
T Consensus       557 --VeY~veg~ldKNkD~l~~~ll~Ll~~StNe~vs~  590 (1463)
T COG5022         557 --VEYDVEGFLDKNKDPLNDDLLELLKASTNEFVST  590 (1463)
T ss_pred             --ceeeccchhhhCcchhhHHHHHHHhhccchHHHH
Confidence              999999999999999999888 999999888753

>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>PF02736 Myosin_N: Myosin N-terminal SH3-like domain; InterPro: IPR004009 This domain has an SH3-like fold Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK05428 HPr kinase/phosphorylase; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
3mkd_A692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 1e-122
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-121
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-121
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-121
2y9e_X 758 Structural Basis For The Allosteric Interference Of 1e-121
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 1e-121
2y0r_X 758 Structural Basis For The Allosteric Interference Of 1e-121
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 1e-120
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-120
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 1e-120
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 1e-120
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 1e-120
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-120
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-120
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-120
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 1e-120
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 1e-120
2x9h_A695 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-119
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 1e-119
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 1e-119
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-119
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-119
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 1e-118
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 1e-118
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 1e-115
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 1e-115
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-115
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 1e-106
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 1e-106
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 1e-106
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 1e-106
1b7t_A 835 Myosin Digested By Papain Length = 835 1e-106
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 1e-106
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 1e-105
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 1e-102
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 1e-102
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 1e-101
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 1e-101
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-101
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-101
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-101
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-100
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 3e-96
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 3e-96
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 4e-96
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 1e-95
2x51_A 789 M6 Delta Insert1 Length = 789 3e-95
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 3e-95
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 7e-95
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 4e-93
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 7e-93
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 8e-93
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-92
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 1e-92
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 1e-92
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 2e-92
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 4e-92
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 4e-92
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 2e-91
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 5e-91
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure 
Iteration: 1

 Score =  434 bits (1116), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/504 (45%), Positives = 327/504 (64%), Gaps = 19/504 (3%)
Query: 130 NWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYN 189
           ++E G+I+S +         +G+  +VK ++    NP   DGV+D+ +LSYLNEP+V +N
Sbjct: 45  SYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHN 104
Query: 190 LHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIRE 247
           L  RY QD+IYT +G  LVA+NPFK++P+Y    ++ +K +     +PH++AI+D A R 
Sbjct: 105 LRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRS 164
Query: 248 MIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGG-----GSGI-EYEILKTNPILEAF 301
           M+ D  NQS++I+GESGAGKTE  K  +QYLA++ G     GSG+ E +IL+ NPILEAF
Sbjct: 165 MLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAF 224
Query: 302 GNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLC 361
           GNAKT+RN+NSSRFGK IEI F+  G ISGA+IQ++LLEKSRVV  +E ER YHIFYQL 
Sbjct: 225 GNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLL 284
Query: 362 VGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVF 421
            GA    ++ L+L   + + YL QS C  I GV D+E+F+I  +A+DIV  S+E+Q S+F
Sbjct: 285 AGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIF 344
Query: 422 AMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLI-GCDIGELKLALSTRKMRVGND 480
            ++A +L LGN+ F     E  V  + D+  +  A  + G +   L+ AL   ++  G D
Sbjct: 345 KIIAGILHLGNIKFEKGAGEGAV--LKDKTALNAASTVFGVNPSVLEKALMEPRILAGRD 402
Query: 481 TIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESF 540
            + Q+L + +++ +RDAL K++Y  LF WLV++IN  L   + R    I +LDIYGFE F
Sbjct: 403 LVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLC--QERKAYFIGVLDIYGFEIF 460
Query: 541 DRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFE-DNKDCLNLFEKVP 599
             NSFEQ CINY NE+LQQ FN H+FKLEQEEY+++ I+W  +DF  D++  ++L +   
Sbjct: 461 KVNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQ 520
Query: 600 SP-----LTQLRVFVLTTKGVLLC 618
            P     L +  VF   T   L+ 
Sbjct: 521 PPGILALLDEQSVFPNATDNTLIT 544
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 0.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 0.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 0.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 0.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 0.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 0.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 0.0
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 0.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 0.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 0.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-20
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
 Score =  775 bits (2003), Expect = 0.0
 Identities = 201/529 (37%), Positives = 303/529 (57%), Gaps = 20/529 (3%)

Query: 85  GDEDLDSAASPLPSVSASHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTES 144
           GD ++    +  P +  S  +R  + T  +  KK +  +       +   KI+S  G + 
Sbjct: 2   GDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDV--FVPDDKQEFVKAKIVSREGGKV 59

Query: 145 VISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAG 204
                 GK + VK + ++  NP   D ++D+  L++L+EP+VLYNL  RY   MIYT +G
Sbjct: 60  TAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSG 119

Query: 205 PVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIREMIRDEVNQSIIISGE 262
              V +NP+K +P+Y    + AY+ K      PH+++I+D A + M+ D  NQSI+I+GE
Sbjct: 120 LFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGE 179

Query: 263 SGAGKTETAKIAMQYLAALGG------------GSGIEYEILKTNPILEAFGNAKTSRND 310
           SGAGKT   K  +QY A +                 +E +I++ NP LEAFGNAKT RND
Sbjct: 180 SGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRND 239

Query: 311 NSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALRE 370
           NSSRFGK I IHF  TGK++ A+I+T+LLEKSRV+   + ER YHIFYQ+     P L +
Sbjct: 240 NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLD 299

Query: 371 KLNLM-SAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLW 429
            L +  +  +Y ++ Q    ++  +DDAE+      A D++  + E++ S++ +  A++ 
Sbjct: 300 MLLITNNPYDYAFISQGET-TVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMH 358

Query: 430 LGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLS 489
            GN+ F +   E   EP   E     A L+G +  +L   L   +++VGN+ + +   + 
Sbjct: 359 FGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQ 418

Query: 490 QATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFC 549
           Q      ALAK++Y  +F W+V +IN +L   + R    I +LDI GFE FD NSFEQ C
Sbjct: 419 QVIYATGALAKAVYERMFNWMVTRINATLETKQPRQ-YFIGVLDIAGFEIFDFNSFEQLC 477

Query: 550 INYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDF-EDNKDCLNLFEK 597
           IN+ NE+LQQ FN H+F LEQEEY ++GI+W  +DF  D + C++L EK
Sbjct: 478 INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEK 526
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query697
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.88
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.47
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.52
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.11
3bos_A242 Putative DNA replication factor; P-loop containing 94.09
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.95
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.92
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.84
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.72
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.66
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.58
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.51
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.42
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.36
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.13
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.08
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.81
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.77
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.77
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.76
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.73
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.72
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.71
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.56
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.51
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.49
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.49
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.44
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.38
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.32
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.22
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.2
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.2
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.07
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.03
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.01
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.93
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.85
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.85
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.82
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.72
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 91.67
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.63
1p9r_A418 General secretion pathway protein E; bacterial typ 91.62
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.56
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.5
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 91.5
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.46
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.36
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.21
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.2
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 91.19
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.12
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.1
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 91.08
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 91.06
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 91.02
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 91.01
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.98
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.97
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 90.96
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 90.91
1xjc_A169 MOBB protein homolog; structural genomics, midwest 90.91
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.89
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 90.84
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.82
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 90.81
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 90.79
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.77
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.74
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.67
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 90.57
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.47
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 90.39
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.39
1via_A175 Shikimate kinase; structural genomics, transferase 90.38
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.31
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 90.21
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.07
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.98
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 89.89
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 89.87
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 89.75
4a74_A231 DNA repair and recombination protein RADA; hydrola 89.75
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.71
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 89.7
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 89.67
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.62
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.61
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 89.59
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.54
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 89.49
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.49
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.49
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 89.46
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.39
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 89.37
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 89.31
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.3
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 89.19
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.12
2og2_A359 Putative signal recognition particle receptor; nuc 89.11
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.08
3tlx_A243 Adenylate kinase 2; structural genomics, structura 89.08
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 89.03
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 88.99
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 88.99
2vli_A183 Antibiotic resistance protein; transferase, tunica 88.93
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 88.92
1vma_A306 Cell division protein FTSY; TM0570, structural gen 88.85
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.82
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 88.81
2v1u_A387 Cell division control protein 6 homolog; DNA repli 88.77
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 88.47
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 88.44
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 88.44
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 88.44
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.4
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 88.39
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 88.34
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 88.21
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 88.04
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 88.02
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 88.02
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 87.96
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 87.88
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 87.87
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 87.8
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 87.79
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 87.79
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 87.73
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.67
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.64
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 87.63
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 87.6
2chq_A319 Replication factor C small subunit; DNA-binding pr 87.52
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 87.51
3pvs_A447 Replication-associated recombination protein A; ma 87.5
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.42
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 87.36
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.36
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 87.35
3co5_A143 Putative two-component system transcriptional RES 87.15
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 87.09
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 87.04
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 86.97
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 86.96
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 86.91
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.9
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 86.88
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 86.78
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 86.78
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 86.77
2ghi_A260 Transport protein; multidrug resistance protein, M 86.76
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 86.71
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.66
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 86.63
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 86.62
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.5
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 86.45
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.41
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 86.36
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 86.27
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 86.2
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.18
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 86.14
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 86.12
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 86.06
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.05
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.01
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 86.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 85.99
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 85.96
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 85.96
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 85.93
3r20_A233 Cytidylate kinase; structural genomics, seattle st 85.93
2cvh_A220 DNA repair and recombination protein RADB; filamen 85.86
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 85.85
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 85.73
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.69
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 85.68
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.6
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 85.5
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.47
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 85.44
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 85.43
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 85.37
1g6h_A257 High-affinity branched-chain amino acid transport 85.33
2r62_A268 Cell division protease FTSH homolog; ATPase domain 85.26
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 85.25
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 85.13
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 85.0
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 84.95
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 84.83
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 84.83
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 84.65
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 84.63
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 84.62
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 84.57
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.52
1ji0_A240 ABC transporter; ATP binding protein, structural g 84.33
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 84.29
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 84.23
1ojl_A304 Transcriptional regulatory protein ZRAR; response 84.11
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 84.07
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 83.8
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 83.75
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 83.72
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 83.71
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 83.61
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 83.55
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 83.47
2hf9_A226 Probable hydrogenase nickel incorporation protein 83.44
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 83.43
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 83.39
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 83.37
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.3
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 83.27
2qgz_A308 Helicase loader, putative primosome component; str 83.26
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 83.16
3kta_A182 Chromosome segregation protein SMC; structural mai 82.92
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 82.87
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 82.83
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 82.77
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 82.73
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 82.71
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 82.54
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 82.3
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 82.29
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 82.14
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 82.12
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 82.08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.07
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 81.91
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 81.85
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 81.78
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 81.67
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 81.64
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 81.33
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 80.98
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 80.96
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 80.77
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 80.71
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 80.56
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 80.47
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 80.43
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 80.28
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 80.17
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 80.04
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-171  Score=1486.69  Aligned_cols=595  Identities=36%  Similarity=0.601  Sum_probs=556.8

Q ss_pred             CCCCccccCCCCCcccCCccccccccccccccccCcEEEEecCCCCEEEEEEEeeeCCeeEEEcCCCcEEEEecCCcccC
Q 005424           85 GDEDLDSAASPLPSVSASHTDRRWSDTTSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSA  164 (697)
Q Consensus        85 ~~~~~~~~~~p~~~l~~~~~e~~~~q~~~~~~k~~~~vWv~~~~~~~~~~~v~s~~~~~v~v~~~~g~~~~v~~~~l~~~  164 (697)
                      +|.++....+|+||||+++++++.+|+.||+.++  +|||||++++|++|+|++.++++++|++++|++++|+.++++++
T Consensus         2 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~--~vWv~d~~~~~~~~~v~~~~~~~~~v~~~~g~~~~v~~~~v~~~   79 (783)
T 4db1_A            2 GDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKK--DVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQ   79 (783)
T ss_dssp             TTGGGGGGGGGGGGTCCCHHHHHHHHHSCCCTTT--EEEEECSSSSEEEEEEEEECSSEEEEEETTTEEEEEEGGGCEEC
T ss_pred             CCcchhhcCchhhHhccCHHHHHHhhccCCcCCC--EEEEECCCCCEEEEEEEEecCCEEEEEECCCCEEeCCHHHcccC
Confidence            4677888899999999999999999999999988  99999999999999999999999999999999999999999999


Q ss_pred             CCCccCCcCCcccccCCCchhHHHHHHHHHhcCCcccccCCeEEEecCCccCCCCChhHHHhhccCCCC--CCchhHHHH
Q 005424          165 NPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITD  242 (697)
Q Consensus       165 np~~~~~veDL~~L~~LnE~sVL~nL~~Ry~~~~IYTy~G~iLIaVNPyk~lpiY~~~~~~~Y~~~~~~--~PHifavA~  242 (697)
                      ||+.++++|||+.|++|||++|||||+.||.+++||||+|++||+||||+++|+|++++++.|+++.+.  ||||||||+
T Consensus        80 np~~~~~~eDl~~L~~LnE~svL~nL~~Ry~~~~IYTy~G~iLvavNPyk~l~iY~~~~~~~Y~g~~~~~~pPHifaiA~  159 (783)
T 4db1_A           80 NPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISD  159 (783)
T ss_dssp             CCGGGTTCSBGGGCSCCSHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCSCSSHHHHHHHTTCCGGGSCCCHHHHHH
T ss_pred             CCCccCCcchhhccccccHHHHHHHHHHHhcCCceEEecCceeEecCCCccCCCCCHHHHHHhcCCCcCCCCchhhHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999998765  899999999


Q ss_pred             HHHHHHHhcCceeEEEEeCCCCCChhHHHHHHHHHHHHcCCC------------CCchhhhhhhchHHHhhccccccCCC
Q 005424          243 TAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGG------------SGIEYEILKTNPILEAFGNAKTSRND  310 (697)
Q Consensus       243 ~Ay~~m~~~~~nQsIiiSGESGAGKTe~tK~il~yLa~~~~~------------~~ie~~Il~snpILEAFGNAKT~rNd  310 (697)
                      +||++|+++++||||||||||||||||++|+||+|||.++++            +.++++|+++||||||||||||+|||
T Consensus       160 ~Ay~~m~~~~~nQsIiiSGESGAGKTe~tK~im~yla~v~~~~~~~~~~~~~~~~~ve~~il~snpiLEAFGNAkT~rNd  239 (783)
T 4db1_A          160 NAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRND  239 (783)
T ss_dssp             HHHHHHHHHTCCEEEEEECSTTSSHHHHHHHHHHHHHHHSBCCCC-------CCSCHHHHHHHHHHHHHHHHEECCSSCT
T ss_pred             HHHHHHHhhCCCceEEEeCCCCCCCchHHHHHHHhhhhhccCCCccccccccccccHHHHHHHhHHHHHhccCcccCCCC
Confidence            999999999999999999999999999999999999998753            36899999999999999999999999


Q ss_pred             CCCccccEEEEEecCCCCccceeeeeeeccCceeeecCCCCCcchhhHHHhcCCCHHHHHhcCC-CCcccCccccCCCcc
Q 005424          311 NSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNL-MSAKEYKYLRQSSCY  389 (697)
Q Consensus       311 NSSRFGKfi~L~F~~~G~i~Ga~I~tYLLEKSRVv~q~~gERNfHIFYqLlaG~~~~~r~~l~L-~~~~~y~yL~qs~~~  389 (697)
                      |||||||||+|+|+.+|+|+||+|++|||||||||+|++||||||||||||+|+++++|++|+| .++.+|+||+++ +.
T Consensus       240 NSSRFGK~i~i~F~~~g~i~Ga~I~~YLLEKSRVv~q~~gERnfHIFYqLlaG~~~~~~~~l~L~~~~~~y~yl~~g-~~  318 (783)
T 4db1_A          240 NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQG-ET  318 (783)
T ss_dssp             TEECSEEEEEEEECTTSBEEEEEEEEECCCGGGGTCCCTTCCSBHHHHHHHTCSSHHHHHHTTCCSCGGGCGGGCSS-CC
T ss_pred             CCCccceeEEEEECCCCCEeeeEEEEeecccceeeccCCCCCcchhHHHHHcCCCHHHHHHhccCCCHHHCccccCC-Cc
Confidence            9999999999999999999999999999999999999999999999999999999999999999 579999999997 57


Q ss_pred             ccCCcchHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHHHhhcCeeeEEeCCCCceeecChhHHHHHHHhhCCCHHHHHHh
Q 005424          390 SINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLA  469 (697)
Q Consensus       390 ~~~~~dD~~~F~~l~~Al~~LGfs~ee~~~I~~iLAAILhLGNi~F~~~~~~~~~~~~~~e~l~~aA~LLGvd~~~L~~a  469 (697)
                      .++++||+++|+.+++||++|||+++|+..||+|||||||||||+|...++++++++.+.+.++.+|+||||++++|.++
T Consensus       319 ~~~~~dD~~~f~~~~~Am~~lGfs~~e~~~i~~ilaaILhLGNi~F~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L~~a  398 (783)
T 4db1_A          319 TVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKG  398 (783)
T ss_dssp             CCTTCCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCEEECTTSSCEEESCCHHHHHHHHHTTCCHHHHHHH
T ss_pred             ccCCCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhccceeeccCCCcccccCChHHHHHHHHHhCCCHHHHHHh
Confidence            88999999999999999999999999999999999999999999999887778899999999999999999999999999


Q ss_pred             hcceeeeeccceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCccceEEeeccCCCccCCCCCHHHHH
Q 005424          470 LSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFC  549 (697)
Q Consensus       470 Lt~r~i~v~~e~i~~~lt~~qA~~~RDaLAK~LY~rLF~WIV~~IN~~L~~~~~~~~~~IgILDIfGFE~f~~NsFEQLc  549 (697)
                      ||+|++++|+|.+++++|++||.++||||||+||+|||+|||++||++|.+. .....+||||||||||+|+.|||||||
T Consensus       399 L~~~~i~~~~e~v~~~~~~~qA~~~rdalAK~lY~rLF~wlV~~IN~~l~~~-~~~~~~IGvLDI~GFE~f~~NsFEQlC  477 (783)
T 4db1_A          399 LCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETK-QPRQYFIGVLDIAGFEIFDFNSFEQLC  477 (783)
T ss_dssp             HHSCC------CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCS-CCCSEEEEEEECCCCCCCSSCCHHHHH
T ss_pred             hcceEEEeCCeeEeeCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC-CCCCceEEEeccccccccccCCHHHHH
Confidence            9999999999999999999999999999999999999999999999999864 345689999999999999999999999


Q ss_pred             HhHhhHHHHhhhhhhhhhhhhhhhhhcCCcccccccC-ChHhHHHhhhcCCcceeeecc-cccccCcchhhhhhhhhhhc
Q 005424          550 INYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFE-DNKDCLNLFEKVPSPLTQLRV-FVLTTKGVLLCYIFYLVVCH  627 (697)
Q Consensus       550 INyaNEkLQq~Fn~~iF~~EqeeY~~EGI~w~~i~f~-DN~~~ldLie~kp~GIlslL~-~~~~~~~t~~~~~~~~~~~~  627 (697)
                      ||||||||||+||+|+|+.||+||.+|||+|+.|+|. ||++|||||++ |+|||+||| +|..|++||.+++.++...|
T Consensus       478 INyaNEkLQq~Fn~~~F~~EqeeY~~EgI~w~~i~f~~Dn~~~idLiek-p~Gil~lLDEec~~p~~tD~tf~~kl~~~~  556 (783)
T 4db1_A          478 INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEK-PMGIMSILEEECMFPKATDMTFKAKLFDNH  556 (783)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCCGGGGGHHHHHHHHS-TTSHHHHHCC-TTCTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHhhhcCCCcccccccCChHHHHHHHhC-CCchHhhhhHHhcCCCCCHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999995 99999999997 899999998 58899999999999986554


Q ss_pred             -c-cceeeeccC----CCCceEEEeeecccccccchhhhHHHHHHHHHHhccccceeeee-eccCCCCcccccc
Q 005424          628 -A-FGIFIQADL----TGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDI-LMSGSRSKFVGVM  694 (697)
Q Consensus       628 -~-fg~~~~~~~----~~~~F~i~h~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  694 (697)
                       + ...+..+..    ....|.|+|||+.          |.|.|.+||+||+|.|.-+.+ ||..|+++||..+
T Consensus       557 ~~~~~~f~~~~~~k~~~~~~F~I~HyAG~----------V~Y~~~gfleKNkD~l~~~~~~ll~~S~~~~v~~l  620 (783)
T 4db1_A          557 LGKSANFQKPRNIKGKPEAHFSLIHYAGI----------VDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTL  620 (783)
T ss_dssp             TTTCTTEECCCC----C-CCEEEEETTEE----------EEECCTTHHHHHHCCCCHHHHHHHHTCSSHHHHHH
T ss_pred             cCCCCCccCCCCCCCCCCCCeEEeCcCCc----------eEEeCcChhhhccccccHHHHHHHHHCccHHHHHH
Confidence             2 233333332    3678999999999          999999999999999998888 9999999998765
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 697
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 1e-169
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 1e-164
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 1e-164
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 1e-160
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 1e-160
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 1e-158
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]

 Score =  501 bits (1292), Expect = e-169
 Identities = 192/481 (39%), Positives = 282/481 (58%), Gaps = 22/481 (4%)

Query: 146 ISLPEGKVLKVKSENLVS------ANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMI 199
            S P+ + L V  + L+        NP   + ++D+  ++YLNE SVLYNL  RY   +I
Sbjct: 5   FSDPDFQYLAVDRKKLMKEQTAAFMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLI 64

Query: 200 YTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIES--PHVYAITDTAIREMIRDEVNQSI 257
           YT +G   +A+NP++++P+Y +  I  Y+ K      PH++++ D A + M+ D  NQS 
Sbjct: 65  YTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSC 124

Query: 258 IISGESGAGKTETAKIAMQYLAALGGGSG-------------IEYEILKTNPILEAFGNA 304
           +I+GESGAGKTE  K  + YLA +                  +E +I++ NP+LEA+GNA
Sbjct: 125 LITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNA 184

Query: 305 KTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGA 364
           KT+RN+NSSRFGK I IHF  TGKI+GA+I+T+LLEKSRV      ER YHIFYQ+C  A
Sbjct: 185 KTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNA 244

Query: 365 PPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAML 424
            P L + + +             C +++ +DD E+F++  EA DI+  +KE+++S+F   
Sbjct: 245 IPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCT 304

Query: 425 AAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQ 484
           A++L +G + F     E   E         VA L G + G+L  AL   K++VG + + +
Sbjct: 305 ASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTK 364

Query: 485 NLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNS 544
              ++Q  ++  ALAKS+Y  +F WLV ++NK+L   K +    I +LDI GFE FD NS
Sbjct: 365 GQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDT-KAKRNYYIGVLDIAGFEIFDFNS 423

Query: 545 FEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKVPSPLTQ 604
           FEQ CINY NERLQQ FN H+F LEQEEY ++GI W  +DF  +        + P  +  
Sbjct: 424 FEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILS 483

Query: 605 L 605
           +
Sbjct: 484 I 484
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query697
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1br2a146 Myosin S1 fragment, N-terminal domain {Chicken (Ga 98.57
d2mysa146 Myosin S1 fragment, N-terminal domain {Chicken (Ga 98.49
d1kk8a148 Myosin S1 fragment, N-terminal domain {Bay scallop 98.47
d1w7ja158 Myosin S1 fragment, N-terminal domain {Chicken (Ga 97.17
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.7
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.68
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.37
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.35
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.22
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.0
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.84
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.83
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.73
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.67
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.56
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.54
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.34
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.2
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.06
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.98
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.9
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.46
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.39
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.37
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.14
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.05
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.82
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.69
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.3
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.29
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.23
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.14
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.12
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.08
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.0
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.95
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.83
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.51
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.47
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.35
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.19
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.06
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.01
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.88
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.81
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.68
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.56
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.41
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.33
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.31
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.3
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.09
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.06
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.98
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.91
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.89
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.44
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.44
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.21
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 89.17
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.16
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.06
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 88.78
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 88.55
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 88.33
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.16
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.07
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.05
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.02
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 87.94
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 87.51
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 87.49
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.4
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 87.34
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.95
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 86.85
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 86.79
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.72
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.5
d2hyda1255 Putative multidrug export ATP-binding/permease pro 86.36
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.3
d2awna2232 Maltose transport protein MalK, N-terminal domain 86.25
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.93
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 85.85
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 85.84
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.71
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.18
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.08
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.96
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.91
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 84.87
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.86
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 84.69
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 84.29
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 83.74
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 83.67
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.63
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 83.52
d1okkd2207 GTPase domain of the signal recognition particle r 83.37
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.23
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 83.06
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.82
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 81.86
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 81.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.98
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 80.89
d1vmaa2213 GTPase domain of the signal recognition particle r 80.61
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.52
d1j8yf2211 GTPase domain of the signal sequence recognition p 80.48
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.27
d1xpua3289 Transcription termination factor Rho, ATPase domai 80.19
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 80.13
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=6.2e-148  Score=1282.49  Aligned_cols=520  Identities=43%  Similarity=0.682  Sum_probs=485.6

Q ss_pred             ccCCCCccCCcCCcccccCCCchhHHHHHHHHHhcCCcccccCCeEEEecCCccCCCCChhHHHhhccCCCC--CCchhH
Q 005424          162 VSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYA  239 (697)
Q Consensus       162 ~~~np~~~~~veDL~~L~~LnE~sVL~nL~~Ry~~~~IYTy~G~iLIaVNPyk~lpiY~~~~~~~Y~~~~~~--~PHifa  239 (697)
                      ..+||+.+++||||+.|++|||++||++|++||.+++||||+|++|||||||+++|+|++++++.|+++...  |||||+
T Consensus        31 ~~~nP~~~~~v~Dl~~L~~l~E~~vl~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~iy~~~~~~~y~~~~~~~~~PHifa  110 (712)
T d1d0xa2          31 KRRNPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFA  110 (712)
T ss_dssp             CCCCCGGGTTCSBGGGCSSCCHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCSCCSHHHHHHHTTCCGGGSCCCHHH
T ss_pred             hhcCCccccCCchhhcCCCCCHHHHHHHHHHHHcCCCceeeECCEEEEECCCCCCCCCCHHHHHHHcCCCcCCCCCcHHH
Confidence            569999999999999999999999999999999999999999999999999999999999999999988765  899999


Q ss_pred             HHHHHHHHHHhcCceeEEEEeCCCCCChhHHHHHHHHHHHHcCCCC------CchhhhhhhchHHHhhccccccCCCCCC
Q 005424          240 ITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGS------GIEYEILKTNPILEAFGNAKTSRNDNSS  313 (697)
Q Consensus       240 vA~~Ay~~m~~~~~nQsIiiSGESGAGKTe~tK~il~yLa~~~~~~------~ie~~Il~snpILEAFGNAKT~rNdNSS  313 (697)
                      ||++||+.|+.+++||||||||||||||||++|++|+||+.++++.      .++++|+++||||||||||||++|+|||
T Consensus       111 iA~~Ay~~m~~~~~nQsIiisGeSGaGKTe~~k~il~yL~~~s~~~~~~~~~~i~~~i~~~n~iLEAFGNAkT~~N~NSS  190 (712)
T d1d0xa2         111 ISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSS  190 (712)
T ss_dssp             HHHHHHHHHHHHTCCEEEEEECSTTSSHHHHHHHHHHHHHHHHSCC-----CHHHHHHHHHHHHHHHHHEECCSSCTTEE
T ss_pred             HHHHHHHHHHHhCCCceEEEeCCCCCCHHHHHHHHHHHHHHHhCCCcccccchHHHHHHhhhhHHHHhcCcCcCCCCCcc
Confidence            9999999999999999999999999999999999999999987542      4899999999999999999999999999


Q ss_pred             ccccEEEEEecCCCCccceeeeeeeccCceeeecCCCCCcchhhHHHhcCCCHHHHHhcCCCCcccCccccCCCccccCC
Q 005424          314 RFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSING  393 (697)
Q Consensus       314 RFGKfi~L~F~~~G~i~Ga~I~tYLLEKSRVv~q~~gERNfHIFYqLlaG~~~~~r~~l~L~~~~~y~yL~qs~~~~~~~  393 (697)
                      |||||++|+|+.+|+|+||+|.+||||||||+.|++||||||||||||+|+++++|++|+|.++.+|+||++++|..+++
T Consensus       191 RFGk~~~l~f~~~g~i~ga~i~~yLLEksRvv~~~~gErnfHIFYqll~g~~~~~~~~~~l~~~~~~~yL~~~~~~~~~~  270 (712)
T d1d0xa2         191 RFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKG  270 (712)
T ss_dssp             SSEEEEEEEECTTSCEEEEEEEEECCCGGGGTCCCTTCCSBHHHHHHHHHSCHHHHHHHTCCCGGGCTTTSSSSCCCCTT
T ss_pred             ceeEEEEEEEcCCCccccceeEEeccCCceEEeeccccccHHHHHHHHhCCCHHHHHHhCCCCchhcccccCCCCcccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHHHhhcCeeeEEeCCCCceeecChhHHHHHHHhhCCCHHHHHHhhcce
Q 005424          394 VDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTR  473 (697)
Q Consensus       394 ~dD~~~F~~l~~Al~~LGfs~ee~~~I~~iLAAILhLGNi~F~~~~~~~~~~~~~~e~l~~aA~LLGvd~~~L~~aLt~r  473 (697)
                      +||+++|+.+++||++|||+++|+..||+|||||||||||+|...+ .+.+.+.+.+.++.+|.||||++++|.++|+++
T Consensus       271 ~dd~~~f~~~~~al~~lgfs~~e~~~i~~iLaaILhLGNi~F~~~~-~~~~~i~~~~~l~~~a~LLgv~~~~L~~~L~~~  349 (712)
T d1d0xa2         271 VSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGA-GEGAVLKDKTALNAASTVFGVNPSVLEKALMEP  349 (712)
T ss_dssp             CCHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHTCCCBCCS-SSSCBCSCCHHHHHHHHHHTCCHHHHHHHHHSC
T ss_pred             cChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhccceEeecC-CcceecCCHHHHHHHHHHhCCChhHhhhhhcce
Confidence            9999999999999999999999999999999999999999997543 345678889999999999999999999999999


Q ss_pred             eeeeccceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCccceEEeeccCCCccCCCCCHHHHHHhHh
Q 005424          474 KMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYA  553 (697)
Q Consensus       474 ~i~v~~e~i~~~lt~~qA~~~RDaLAK~LY~rLF~WIV~~IN~~L~~~~~~~~~~IgILDIfGFE~f~~NsFEQLcINya  553 (697)
                      ++.+++|.++++++++||.++||||||+||+|||+|||.+||++|.+.  ....+||||||||||+|+.|||||||||||
T Consensus       350 ~~~~~~e~i~~~l~~~~A~~~rdalaK~LY~~LF~wiV~~IN~~l~~~--~~~~~IgiLDifGFE~f~~NsfEQLcINya  427 (712)
T d1d0xa2         350 RILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQE--RKAYFIGVLDISGFEIFKVNSFEQLCINYT  427 (712)
T ss_dssp             EEEETTEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCS--CCSEEEEEEECCCCCCCSSBCHHHHHHHHH
T ss_pred             eeccCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccC--cccceeeeeecccccccccCcHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999864  356899999999999999999999999999


Q ss_pred             hHHHHhhhhhhhhhhhhhhhhhcCCcccccccC-ChHhHHHhhhc-CCcceeeecc-cccccCcchhhhhhhhhhhccc-
Q 005424          554 NERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFE-DNKDCLNLFEK-VPSPLTQLRV-FVLTTKGVLLCYIFYLVVCHAF-  629 (697)
Q Consensus       554 NEkLQq~Fn~~iF~~EqeeY~~EGI~w~~i~f~-DN~~~ldLie~-kp~GIlslL~-~~~~~~~t~~~~~~~~~~~~~f-  629 (697)
                      |||||++|++++|+.||++|++|||+|..|+|. ||++|++||++ +|.|||++|| +|..++++|..++.++...+.- 
T Consensus       428 NEkLQ~~f~~~~f~~eq~eY~~EgI~~~~i~~~~dn~~~~~Li~~k~p~Gll~lLdee~~~~~~td~~~l~kl~~~~~~~  507 (712)
T d1d0xa2         428 NEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKK  507 (712)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTCC--------CHHHHHHHHHCTTTTCHHHHHHHHHTCTTCCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccCCCcccccCCCcHHHHHHHhccCCCcHHHHhHHHhcCCCCChHHHHHHHHHHhccC
Confidence            999999999999999999999999999999996 99999999985 5899999998 6889999999999998655532 


Q ss_pred             -ceeeeccCCCCceEEEeeecccccccchhhhHHHHHHHHHHhccccceeeee-eccCCCCcccccc
Q 005424          630 -GIFIQADLTGNFFMFCMVASITTDTKISMNILSAKVLRFLLFNFRALQIIDI-LMSGSRSKFVGVM  694 (697)
Q Consensus       630 -g~~~~~~~~~~~F~i~h~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  694 (697)
                       ..+..+....+.|.|+||||.          |+|.|.+||+||+|.|.-+.+ ||..|+.+++..|
T Consensus       508 ~~~~~~~~~~~~~F~I~HyAG~----------V~Y~v~gfl~KNrD~l~~~~~~ll~~S~n~~i~~l  564 (712)
T d1d0xa2         508 NAKYEEPRFSKTEFGVTHYAGQ----------VMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKL  564 (712)
T ss_dssp             STTEECCSSCSSEEEEEETTEE----------EEEECTTHHHHHHCCCCHHHHHHHHTCSCTTHHHH
T ss_pred             CcccccccCCCCceeeEecccc----------eeEecchHHHhccchhHHHHHHHHHHCCcHHHHHH
Confidence             334456677889999999999          999999999999999998888 9999999998755
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1w7ja1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure